[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for ftul2:ACD31331.1

[Show Plain Result]


## Summary of Sequence Search
    1::61
    3::52      6e-06  50%   52 aa  PF00327 Ribosomal_L30 "Ribosomal protein L30p/L7e"
    1::61

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxKVTLVKSLIGRKENHIASARGLGLRKINHTVEVLDTPENRGMANKIYYMVxxxx
PF00327         -------KVTRVRSIIGRPPKQRKTLRLLGLRKINSAVFVKDNPATRGMLKKVEHLV----