[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for ftul2:ACD31359.1

[Show Plain Result]


## Summary of Sequence Search
    1::249
   20::242     4e-13  39%  244 aa  PF00696 AA_kinase "Amino acid kinase family"
    1::249

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxIINQIKTLTNFGVELALVVGGGNILRGG
PF00696         ------------------------------------------VADDIAELHELGVRVVVVSGGGPLLALG


                         .         .         *         .         .         .         .:140
query           RANFGNKIRRATADSMGMIATMINALALRDMLISEGVDAEVFSAKGVDGLLKVASAHEFNQELAKGRVLI
PF00696         IAPGGAGLR-VTDGAAGLVAAELNQPRLRDLLVSLG---ERLSAPAVAALLKDAGVNEVDRELDAGRVPI


                         +         .         .         .         .         *         .:210
query           FAGGTGNPFVTTDTTASLRAVEIGADALLKATTVNGVYDKDPNKYSDAKRFDKVTFSEVVSKELNVMDLG
PF00696         FGGENDTGEITTDTTAALLAAALGADELIILTDVDGVYTADPRKVPDAKLIPELSYAELATGGMKVKHPA


                         .         .         .         +         .         .         .:280
query           AFTQCRDFGIPIYVxxxxxxxxxxxxxxxxxxxxxxxxx
PF00696         AIEAARRGGIPVRI-------------------------