[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for ftul2:ACD31463.1

[Show Plain Result]


## Summary of Sequence Search
    1::1290
   22::71      5e-14  68%   97 aa  PF00586 AIRS "AIR synthase related protein, N-terminal domain"
   62::148     1e-05  29%  148 aa  PF02769 AIRS_C "AIR synthase related protein, C-terminal domain"
   24::169     2e-04  27%  188 aa  PF03962 Mnd1 "Mnd1 family"
    1::1290

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00586         ----------------------------------------------------------------------
PF02769         ----------------------------------------------------------------------
PF03962         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxVEGQVSASELKQIQDIVHDRMVEEVFS
PF00586         ----------------------------------------------------------------------
PF02769         ----------------------------------------------------------------------
PF03962         -------------------------------------------VKGIISMSVKDVVQSLVDDGLVEVEKI


                         +         .         .         .         .         *         .:210
query           CKDDLYRLFSVTAPKELEFVNVLEKGAQAIKEADRKLGLALSEQEIEYLADEYTKLGRNPTDTELYMFAQ
PF00586         ----------------------------------------------------------------------
PF02769         ----------------------------------------------------------------------
PF03962         GSSNLYWSFPSTATQQLQ--NELEKLQKEIEE--LRASIAELEERLEAL-----KSGREETEEREELLAE


                         .         .         .         +         .         .         .:280
query           ANSEHCRHKIFNAKWTIDGQEQDKSLFKMIRNTTEKSPQGVLSAYKDNAAVIEGATAQRFxxxxxxxxxx
PF00586         ----------------------------------------------------------------------
PF02769         ----------------------------------------------------------------------
PF03962         L--QQLEKELEQLKAELESRENDPEVIEQLKEATEIAKEAA-NRWTDNIYLLESYLSKKF----------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxKVETHNHPTAIAPFSGSATGVGGEIRDEGATGLGAKPKAGLTGFTVSNLNIPxxxxxxxx
PF00586         ----------KVETHNHPTAIEPFGGAATAVGGAIRD--LLAMGAKPLAGLDGFAVGKLLDP--------
PF02769         ----------------------------------------------------------------------
PF03962         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00586         ----------------------------------------------------------------------
PF02769         ----------------------------------------------------------------------
PF03962         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00586         ----------------------------------------------------------------------
PF02769         ----------------------------------------------------------------------
PF03962         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxDVGAGGISNAFPELVKDGGGGGYFELRKVNVGEEGLSPLEIWSNESQERYVLSVDPESL
PF00586         ----------------------------------------------------------------------
PF02769         -----------DITGGGLLGHLGEMAEASGVGAEIDLDKVPLFDELQSPLEMLFSETSGRLLVVVPPEEA
PF03962         ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           ELFEQLCNRERCPFAVVGEAISEKHITLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00586         ----------------------------------------------------------------------
PF02769         EAVLAALEEAGLNAAVIGEVTEGKALVI------------------------------------------
PF03962         ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00586         ----------------------------------------------------------------------
PF02769         ----------------------------------------------------------------------
PF03962         ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00586         ----------------------------------------------------------------------
PF02769         ----------------------------------------------------------------------
PF03962         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00586         ----------------------------------------------------------------------
PF02769         ----------------------------------------------------------------------
PF03962         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00586         ----------------------------------------------------------------------
PF02769         ----------------------------------------------------------------------
PF03962         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:980
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00586         ----------------------------------------------------------------------
PF02769         ----------------------------------------------------------------------
PF03962         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:1050
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00586         ----------------------------------------------------------------------
PF02769         ----------------------------------------------------------------------
PF03962         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:1120
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00586         ----------------------------------------------------------------------
PF02769         ----------------------------------------------------------------------
PF03962         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:1190
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00586         ----------------------------------------------------------------------
PF02769         ----------------------------------------------------------------------
PF03962         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:1260
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00586         ----------------------------------------------------------------------
PF02769         ----------------------------------------------------------------------
PF03962         ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:1330
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00586         ------------------------------
PF02769         ------------------------------
PF03962         ------------------------------