[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for ftul2:ACD31468.1

[Show Plain Result]


## Summary of Sequence Search
    1::443
    8::225     9e-64  56%  231 aa  PF01136 Peptidase_U32 "Peptidase family U32"
    1::443

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01136         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxITPVIALKPDAMIMSDPGMIMLVREHFPDQEIHLSVQANAVNYETVRFWQKFGIKRVV
PF01136         ------------LEPLAEAGVDALIVADPGLLMLARERAPDLPIHLSTQANVTNSAALKFLKELGASRVV


                         +         .         .         .         .         *         .:210
query           LSRELSLKEIAEIKENVPDMEIETFVHGSLCMAYSGRCLLSGYYSHRDPNQGVCNNACRNNYKVAEAKQN
PF01136         LSRELSLDEIREIREACPDVELEVFVHGALCLAYSGRCLLSSYLGGRSANRGECAQACRWPYGLIE----


                         .         .         .         +         .         .         .:280
query           EWGDFEPIQTQSTLGIGTPSDKVVLIENDKEPGQYNPMFEDEHGTYIMNSKDLRAIQHVETMMKMGVDCF
PF01136         ----------------------------DGRPGELMPIFEDENGTYILSPKDLCLIEHLPELIEAGVDSL


                         .         *         .         .         .         .         +:350
query           KIEGRTKSFFYAARTAQLYDQAIKDALAGKPFDMTLMDKLEGLAHRGYTEGFxxxxxxxxxxxxxxxxxx
PF01136         KIEGRTKSPEYVARVVQAYRQAIDAALAGRPFDPELLEELEKLANRGYTTGF------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01136         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxx
PF01136         -----------------------