[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for ftul2:ACD30141.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1gt8A2.bssp"
#ERROR : Can't open dsspfile "1znnA1.bssp"
#ERROR : Can't open dsspfile "2a4aA1.bssp"
#ERROR : Can't open dsspfile "1gpwA.bssp"
#ERROR : Can't open dsspfile "1d3gA.bssp"
#ERROR : Can't open dsspfile "1ps9A1.bssp"
#ERROR : Can't open dsspfile "1hg3A.bssp"
#ERROR : Can't open dsspfile "1vhnA.bssp"
#ERROR : Can't open dsspfile "1j2wA.bssp"
#ERROR : Can't open dsspfile "1ep1A.bssp"

## Summary of PDB Search
:248
    1e-08  17%  1gt8A2 [c.1.4.1] DIHYDROPYRIMIDINE DEHYDROGENASE A:533 -- 844
    4e-06  13%  1znnA1 [c.1.2.6] PLP SYNTHASE A:18 -- 271
    8e-05  11%  2a4aA1 [c.1.10.1] DEOXYRIBOSE-PHOSPHATE ALDOLASE A:3 -- 258
    3e-04  24%  1gpwA  [c.1.2.1] HISF PROTEIN
    3e-04  24%  1d3gA  [c.1.4.1] DIHYDROOROTATE DEHYDROGENASE
    3e-04  11%  1ps9A1 [c.1.4.1] 2,4-DIENOYL-COA REDUCTASE A:1 -- 330
    4e-04  19%  1hg3A  [c.1.1.1] TRIOSEPHOSPHATE ISOMERASE
    5e-04  19%  1vhnA  [c.1.4.1] PUTATIVE FLAVIN OXIDOREDUCATASE
    6e-04  12%  1j2wA  [c.1.10.1] ALDOLASE PROTEIN
    7e-04  21%  1ep1A  [c.1.4.1] DIHYDROOROTATE DEHYDROGENASE B (PYRD SUBUNIT)
:248

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxLKFKETSNVYGSFTVNRRWGLIKQAIKTIRKIDKNAWRNKIGLRNPGLANTN
1gt8A2          ----------------------------------------------------------------------
1znnA1          ----------------------------------------------------------------------
2a4aA1          ------------------ICLTDHTFLDENGTEDDIRELCNESVKFAAAVCVYPKF--VKFINEKIKQEI
1gpwA           ----------------------------------------------------------------------
1d3gA           ----------------------------------------------------------------------
1ps9A1          ----------------------------------------------------------------------
1hg3A           ----------------------------------------------------------------------
1vhnA           ----------------------------------------------------------------------
1j2wA           ----------------------------------------------------------------------
1ep1A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           PPKRAQDIISLAALDMSDWHSFAETLKLPKFAQHRNIEINIGCPNASIVDFPAELAPLFEDRNISIKMPP
1gt8A2          -----------CSYNKNDWMELSRKAEASGADA---LELNLSCPHLACGQDPELVRNICRQIPFFAKLTP
1znnA1          --MNAVSIPVMAKVRIGHYVEARVLEALGVDYIDESEVLTPADEEFHICRDLGEAARRIAEGASMLRTPG
2a4aA1          NPFKPKIACVINFYGTDSMEKVLNDTEKALDDGADEIDLVINYKKIIDEGLKEATKLTQSVKKLLTNKIL
1gpwA           ----------------------------------------------------------------------
1d3gA           ----------------------------------------------------------------------
1ps9A1          --------------------------------------------------------SMLDLVEDGGTFAE
1hg3A           ----------------------------------------------------------------------
1vhnA           -------AVQIFGSEPNELSEAARILS-EKYKW---IDLNAGCPVGALLKDLRHFRYIVRELRKSVSGKF
1j2wA           ------------------------------------VDMVLHLGRAKAGDEVRAVREAVPQAVLKVILET
1ep1A           ----------VAGSEEADYVAVCA--KIGDAANVKAIELNISCPNQAFGTDPEVAAALVKACKAVSKVPL


                         +         .         .         .         .         *         .:210
query           TVDHNAKIREYLAVGITTFHLCNTIPTAKGGISGYPLHKYSLPAIKKARQEFGDSXXXXXXXXXYTLDDA
1gt8A2          NVTDIVSIRAAKEGGADGVTATNTVSTTYGGVSGTAIRPIALRAVTTIARAL-PGFPILATGGIDSAESG
1znnA1          TGNIVEAVRHMRKVNAQIRKVVNMSED--ELVAEAKQLGAPVEVLREIKRLGRLPVVNFAAGGVTTPADA
2a4aA1          KVIIEVGELAVLNGNADFIKTSTGKVQINATPSSV---EYIIKAIKKNNPEKNNKIGLKVSGGISDLNTA
1gpwA           -----------------------------------------------------------------DFETA
1d3gA           ------------------------LRSETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDA
1ps9A1          TVELAQAIEAAGATIINTGIGW--HEARIPTIATPVPRGAFSWVTRKLKGHVS--LPLVTTNRINDPQVA
1hg3A           ------------YVAVEPPELIGT------GIPVSKAKPEVITNTVELVKKVNPEVKVLCGAGISTGEDV
1vhnA           SV----KTR----LGWEKNEVEEIYRIVEEGVDEVFIHSFTGRAEWKALSVLEKRIPTFVSGDIFTPEDA
1j2wA           GYFSPEEIARLAEAAI------------RGGADFLKTSGASLEDVALLVRVAQGRAQVKAAGGIRDRETA
1ep1A           YVKLSPNVKAVEAAGADGLTMINTLMGVRFDLSGPAIKPVALKLIHQVAQDVDIPIIGMGGV--ANAQDV


                         .         .         .         +         .         .         .:280
query           KKYIEAGADHLSLSSIMFNPIRGKKLVKEIVKFWLDDx
1gt8A2          LQFLHSGASVLQVCSAVQN--QDFTVIQDYCT------
1znnA1          ALMMHLGADGVFVSGIFKSE------------------
2a4aA1          SHYILLARRFLSDNFRIGSS------------------
1gpwA           SELILRGADKVSINTA---AVENPSLITQIAQ------
1d3gA           LEKIRAGASLVQLYTTFWGPPVVGKVKREL--------
1ps9A1          DDILSRGDADMVSMARPF--LADAELLSKAQSGRADE-
1hg3A           KKAIELGTVGVLLSGVTKAK------------------
1vhnA           KRALESGCD-----------------------------
1j2wA           LRMLKAGAS-----------------------------
1ep1A           LEMYMAGASAVAVTANFADPFVCPKIIDKL--------