[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for ftul2:ACD30267.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1e2dA.bssp"
#ERROR : Can't open dsspfile "4tmkA.bssp"
#ERROR : Can't open dsspfile "1g3uA.bssp"
#ERROR : Can't open dsspfile "1j90A.bssp"
#ERROR : Can't open dsspfile "1p5zB.bssp"
#ERROR : Can't open dsspfile "1uf9A.bssp"
#ERROR : Can't open dsspfile "1e2hA.bssp"
#ERROR : Can't open dsspfile "1knqA.bssp"
#ERROR : Can't open dsspfile "1grqA.bssp"

## Summary of PDB Search
:209
    1e-45  29%  1e2dA  [c.37.1.1] THYMIDYLATE KINASE
    2e-41  43%  4tmkA  [c.37.1.1] PROTEIN (THYMIDYLATE KINASE)
    1e-39  20%  1g3uA  [c.37.1.1] THYMIDYLATE KINASE
    2e-21  17%  1j90A  [c.37.1.1] DEOXYRIBONUCLEOSIDE KINASE
    2e-20  18%  1p5zB  [c.37.1.1] DEOXYCYTIDINE KINASE
    1e-15  14%  1uf9A  [c.37.1.1] TT1252 PROTEIN
    5e-14  13%  1e2hA  [c.37.1.1] THYMIDINE KINASE
    1e-13  10%  1knqA  [c.37.1.17] GLUCONATE KINASE
    7e-04  15%  1grqA  [c.37.1.3] CHLORAMPHENICOL 3-O PHOSPHOTRANSFERASE
:209

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MQSKFIVIEGLDGAGKSTAISFVRKYLEKNNLAAIYTREPGGTKIAEELRNLVLHNKYDEEIHSDSELLM
1e2dA           -RGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGKLLSSYLQKKSDVEDH--SVHLL
4tmkA           -RSKYIVIEGLEGAGKTTARNVVVETLEQLGIRMVFTREPGGTQLAEKLRSLLLDIKSDEVITDKAEVLM
1g3uA           ----LIAIEGVDGAGKRTLVEKLSGAFRAAGRSVATLAFPRGQSVAADIAAEALHGEHGDLASSVYAMAT
1j90A           -QPFTVLIEGNIGSGKTTYLNHFEKYKN----DICLLTEPVEKWRNVNGVNLELMYKDPKKWAMPFQSYV
1p5zB           -RIKKISIEGNIAAGKSTFVNILKQLCEDWEVPVARWCNVQSTNGGNVLQMMYEKSFTFQTYACLSRIRA
1uf9A           -------ITGNIGSGKSTVAALLRSWGYPLDALAARARENKEEELKRLFPEAVVGGRLDR--RALARLVF
1e2hA           -TLLRVYIDGPHGMGKTTTTQLLRDDIVYVPEPMTYWRVLGASETIANIYTTQGEISAGDAAVVMTSAQI
1knqA           --------------------------------------------------------------FLDGDFLH
1grqA           MTTRMIILNGGSSAGKSGIVRCLQSVLPEPWLAFGVDSLIEAMPLKMQSAEGGIEFDADGGVSIGPEFRA


                         .         .         *         .         .         .         .:140
query           IYAGRVQHYRNLIAPALEKGINVVSDRFYWSSMAYQGGGRGVELSKIRALNDNFLNGCEPDLVIYLDIDP
1e2dA           FSANRWEQVP-LIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSLDWCKQPDVGLP---KPDLVLFLQLQL
4tmkA           FYAARVQLVETVIKPALANGTWVIGDRHDLSTQAYQGGGRGIDQHMLATLRDAVLGDFRPDLTLYLDVTP
1g3uA           LFALDRAGAVHTIQGLCRGYDVVILDRYVASNAAYSAAAAGKAAAWVQRIEFARLGLPKPDWQVLLAVSA
1j90A           TLTMLQSHTAPTNKKLKIMERSIFSARYCFVENMRRNGSLEQGMYNTLEEWYKFIEHVQADLIIYLRTSP
1p5zB           QLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESECMNETEWTIDWMNNQFGQSLELDGIIYLQATP
1uf9A           SDPERLKALEAVVHPEVRRLLXEELSRLEAPLVFLEI-----PLLFEKGWEG------RLHGTLLVAAPL
1e2hA           TMGMPYAVTDAVLAPHIGGEATLIFDRHPIAALLCYYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPE
1knqA           PRRNIEKMASGEPLNDDDRKPWLQALNDAAFAMQRTNKVSLIVCALKKHYRDLLREGNPNLSFIYLKGDF
1grqA           LEGAWAEGVV------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           ILGLQRAQKVGSPDRIEKAGLEFFNKTRKVFKDLVKDSDNAIEIDAAKSIQEVEKQIYLILDKHFNxxx
1e2dA           ADAAKR----GAFGHERYENGAFQERALRCFHQLMKDTLNWKMVDASKSIEAVHEDIRVLSED------
4tmkA           EVGLKRARARGELDRIEQESFDFFNRTRARYLELAAQDKSIHTIDATQPLEAVMDAIRTTVTHWVK---
1g3uA           ELAGERSRGPGRARDNYERDAELQQRTGAVYAELAAQGGRWLVVGADVDPGRL----------------
1j90A           EVAYERIRQRARSEE-SCVPLKYLQELHELHEDIHQRRPQSCKLDADLNLE------------------
1p5zB           ETCLHRIYLRGRNEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLS---
1uf9A           EERVRRVXARSGLSREEVLARERAQXPEEEKRKRAT-----WVLENTGSLEDLERALKAVLAEL-----
1e2hA           DRHIDRLAKRQ--RPGERLDLAMLAAIRRVYGLLA----------------------------------
1knqA           DVIESRLKA----RKGHFFKTQMLVTQFETLQEPGADETDVLVVDIDQPLEGVVASTIEVIKK------
1grqA           ---------------------------------------------------------------------