[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for ftul2:ACD30290.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2ghoD1.bssp"
#ERROR : Can't open dsspfile "1iw7D.bssp"
#ERROR : Can't open dsspfile "1i3qA.bssp"
#ERROR : Can't open dsspfile "1dioA.bssp"
#ERROR : Can't open dsspfile "1lm5A.bssp"
#ERROR : Can't open dsspfile "1i3qB.bssp"
#ERROR : Can't open dsspfile "1g7dA.bssp"
#ERROR : Can't open dsspfile "1kitA2.bssp"
#ERROR : Can't open dsspfile "2r7kA1.bssp"
#ERROR : Can't open dsspfile "1t0hB.bssp"
#ERROR : Can't open dsspfile "1r3eA2.bssp"
#ERROR : Can't open dsspfile "1xi8A2.bssp"
#ERROR : Can't open dsspfile "2nqmA2.bssp"
#ERROR : Can't open dsspfile "1qwyA.bssp"
#ERROR : Can't open dsspfile "1vs6W1.bssp"
#ERROR : Can't open dsspfile "2hgjD2.bssp"
#ERROR : Can't open dsspfile "1cfmA2.bssp"
#ERROR : Can't open dsspfile "1brwA3.bssp"
#ERROR : Can't open dsspfile "1v8qA.bssp"
#ERROR : Can't open dsspfile "2c35A1.bssp"
#ERROR : Can't open dsspfile "1accA.bssp"
#ERROR : Can't open dsspfile "1uz5A2.bssp"
#ERROR : Can't open dsspfile "2hgjD2.bssp"

## Summary of PDB Search
:1417
      0.0  48%  2ghoD1 [e.29.1.2] DNA-DIRECTED RNA POLYMERASE BETA' CHAIN D:3 -- 1501
      0.0  38%  1iw7D  [e.29.1.2] RNA POLYMERASE BETA SUBUNIT
    e-174  24%  1i3qA  [e.29.1.2] DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
    6e-31   7%  1dioA  [c.1.19.3] PROTEIN (DIOL DEHYDRATASE)
    1e-25  10%  1lm5A  [d.211.2.1] SUBDOMAIN OF DESMOPLAKIN CARBOXY-TERMINAL DOMAIN
    4e-24  11%  1i3qB  [e.29.1.1] DNA-DIRECTED RNA POLYMERASE II 140KD POLYPEPTIDE
    1e-22  11%  1g7dA  [a.71.1.1] ENDOPLASMIC RETICULUM PROTEIN ERP29
    5e-21  16%  1kitA2 [b.29.1.8] SIALIDASE A:347 -- 543
    3e-17  11%  2r7kA1 [c.30.1.8] 5-FORMAMINOIMIDAZOLE-4-CARBOXAMIDE-1-(BETA)-D-
    1e-14  23%  1t0hB  [c.37.1.1] VOLTAGE-GATED CALCIUM CHANNEL SUBUNIT BETA2A
    7e-14   8%  1r3eA2 [d.265.1.2] TRNA PSEUDOURIDINE SYNTHASE B A:10 -- 237
    8e-12  18%  1xi8A2 [b.103.1.1] MOLYBDENUM COFACTOR BIOSYNTHESIS PROTEIN A:6 --
    7e-11  21%  2nqmA2 [b.103.1.1] MOLYBDOPTERIN BIOSYNTHESIS PROTEIN MOEA A:7 --
    7e-10  19%  1qwyA  [b.84.3.2] PEPTIDOGLYCAN HYDROLASE
    8e-10  13%  1vs6W1 [b.84.4.1] 50S RIBOSOMAL PROTEIN L27 W:1 -- 84
    8e-08  18%  2hgjD2 [b.40.4.5] 50S RIBOSOMAL PROTEIN L2 D:5 -- 126
    3e-07  22%  1cfmA2 [b.84.2.2] CYTOCHROME F A:169 -- 232
    6e-07  15%  1brwA3 [d.41.3.1] PROTEIN (PYRIMIDINE NUCLEOSIDE PHOSPHORYLASE) A:331
    7e-07  12%  1v8qA  [b.84.4.1] TT0826
    3e-06  13%  2c35A1 [a.60.8.2] DNA-DIRECTED RNA POLYMERASE II 16 KDA A:14 -- 142
    5e-06  21%  1accA  [f.11.1.1] ANTHRAX PROTECTIVE ANTIGEN
    1e-05  23%  1uz5A2 [b.103.1.1] 402AA LONG HYPOTHETICAL MOLYBDOPTERIN A:5 -- 180
    3e-06  22%  2hgjD2 [b.40.4.5] 50S RIBOSOMAL PROTEIN L2 D:5 -- 126(query 908->967)
:1417

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxQNYNSKKFDIIKISLASPEVIRSWSHGEVKKPETINYRTFKPERDGLFCAKIFGPIKDYECLC
2ghoD1          ------------KEVRKVRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDYECAC
1iw7D           ----------------------------------------------------------------------
1i3qA           -------QQYSSRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRAKIGGLNDPRLGSIDRNLKCQT
1dioA           ----------------------------------------------------------------------
1lm5A           ----------------------------------------------------------------------
1i3qB           ----------------------------------------------------------------------
1g7dA           ----------------------------------------------------------------------
1kitA2          ----------------------------------------------------------------------
2r7kA1          ----------------------------------------------------------------------
1t0hB           ----------------------------------------------------------------------
1r3eA2          --------------YDQVPPAYSAKKYKGERLYKLAREGKIINLPPKRVKIFKIWDVNIEGRDVSFRVEV
1xi8A2          ----------------------------------------------------------------------
2nqmA2          ----------------------------------------------------------------------
1qwyA           ----------------------------------------------------------------------
1vs6W1          ----------------------------------------------------------------------
2hgjD2          ----------------------------------------------------------------------
1cfmA2          ----------------------------------------------------------------------
1brwA3          ----------------------------------------------------------------------
1v8qA           ----------------------------------------------------------------------
2c35A1          ----------------------------------------------------------------------
1accA           ----------------------------------------------------------------------
1uz5A2          ----------------------------------------------------------------------
2hgjD2          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           GKYKRLKHXXXXXXXXXXXXXQAKVRRERMGHIDLVCPVVHIWYLKSLPSRIGLFLDMPLKNVEKVLYFE
2ghoD1          GKYKRQRFEGKVCERCGVEVTRSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLSATELEQVLYFN
1iw7D           ---------------------------------------------------------SILVVKARVYPFE
1i3qA           CQEGMNE------------------CPGHFGHIDLAKPVFHVGFIAKIKKCVCMHCGKLLLDEHNELMRQ
1dioA           ----------------------------------------------------------------------
1lm5A           ----------------------------------------------------------------------
1i3qB           ----------------------------------------------------------------------
1g7dA           -----------------------------------------------------------------LPAYD
1kitA2          ----------------------------------------------------------------------
2r7kA1          ----------------------------------------------------------------------
1t0hB           ----------------------------------------------------------------------
1r3eA2          SPGTYIRLCMDIGYKLGCGATAVELVRESVGPHTIEESLAAPEEIENRIIPLEKCLE-------------
1xi8A2          ----------------------------------------------------------------------
2nqmA2          ----------------------------------------------------------------------
1qwyA           ----------------------------------------------------------------------
1vs6W1          ----------------------------------------------------------------------
2hgjD2          ----------------------------------------------------------------------
1cfmA2          ----------------------------------------------------------------------
1brwA3          ----------------------------------------------------------------------
1v8qA           ----------------------------------------------------------------------
2c35A1          ----------------------------------------------------------------------
1accA           ----------------------------------------------------------------------
1uz5A2          ----------------------------------------------------------------------
2hgjD2          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           SYIVTDPGMTPLEKKQLLTDEEYAEALENYGYEFEASMGAEAIRDLLADTDIESEIELLQXXXXXXXXXX
2ghoD1          KYIVLDPKGVPVEKRQLLTDEEY--------GGIDARMGAEAIQELLKELDLEKERELLEEMKHPSRARR
1iw7D           DDVEVSTG-DRVAPGDVLADGGK-VKSDVYGYDIDARMGAEAIQQLLKELDLEAEKELLEEMKHPSRARR
1i3qA           ALAIKDSAIWTLCKTKMVCETDVPS--EDDPTQLVSRGGCGNTQPTIRKDGLDADEPELRVLSTEEILNI
1dioA           ----------------------------------------------------------------------
1lm5A           ----------------------------------------------------------------------
1i3qB           ----------------------------------------------------------------------
1g7dA           ALAGQFIEASSREAQAILKQGQDGL----SGVKETDKKWASQYLKIMGKILPASELARISKLIENKMSEG
1kitA2          ----------------------------------------------------------------------
2r7kA1          ----------------MISKDEILEIFDKYNKDTIATLGSHTSLHILKGAKLEGFSTVC-ITMKGRDVPY
1t0hB           ----------------------------------------------------------------------
1r3eA2          ----------------------------------------------------------------------
1xi8A2          ----------------------------------------------------------------------
2nqmA2          ----------------------------------------------------------------------
1qwyA           ----------------------------------------------------------------------
1vs6W1          ----------------------------------------------------------------------
2hgjD2          ----------------------------------------------------------------------
1cfmA2          ----------------------------------------------------------------------
1brwA3          ----------------------------------------------------------------------
1v8qA           ----------------------------------------------------------------------
2c35A1          ---------------------EEDASQLIFPKEFETLLNSEVHMLLEHNESAEDEQELSEVFMKTLNYTA
1accA           ----------------------------------------------------------------------
1uz5A2          ----------------------------------------------------------------------
2hgjD2          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           XXXXXIKRLRLLETFQASGNKPEWMVMTXXXXXXXXXXXXXXIEGGRFATSDLNDLYXXXXXXXXXXXXX
2ghoD1          AKAR--KRLEVVRAFLDSGNRPEWMILEAVPVLPPDLRPMVQVDGGRFATSDLNDLYRRLINRNNRLKKL
1iw7D           AKAR--KRLEVVRAFLDSGNRPEWMILEAVPVLPPDLRPMVQVDGGRFATSDLNDLYRRLINRNNRLKKL
1i3qA           FKHISVKDFTSL-GFNEVFSRPEWMILTCLPVPPPPVRPSISFNESQRGEDDLTFKLADILKANISLETL
1dioA           ----------------------------------------------------------------------
1lm5A           ----------------------------------------------------------------------
1i3qB           ----------------------------------------------------------------------
1g7dA           KKEELQRSLNILTAFRKKGAEKEEL---------------------------------------------
1kitA2          ----------------------------------------------------------------------
2r7kA1          KRFKVADKFIYVDNFSDIKNIQEKLREL--NSIVVPHGSFIAYCGLDNVENSF-----------------
1t0hB           ----------------------------------------------------------------------
1r3eA2          ----------------------------------------------------------------------
1xi8A2          ----------------------------------------------------------------------
2nqmA2          ----------------------------------------------------------------------
1qwyA           ----------------------------------------------------------------------
1vs6W1          ----------------------------------------------------------------------
2hgjD2          ----------------------------------------------------------------------
1cfmA2          ----------------------------------------------------------------------
1brwA3          ----------------------------------------------------------------------
1v8qA           ----------------------------------------------------------------------
2c35A1          RFSRFKNIASVRSLLLQKKLHELACLANLCPETAEESKALIPSLEGRFEDEELQQIL-------------
1accA           ----------------------------------------------------------------------
1uz5A2          ----------------------------------------------------------------------
2hgjD2          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           XXXXAPDIIVRNEKRMLQEAVDALLDNGRRGRAVTGSNKRPLKSLADMIKGKQGRFRQNLLGKRVDYSGR
2ghoD1          LAQGAPEIIIRNEKRMLQEAVDAVIDNGRRGSPVTNGSERPLRSLTDILSGKQGRFRQNLLGKRVDYSGR
1iw7D           LAQGAPEIIIRNEKRMLQEAVDALLDNGRRGAPVTNGSDRPLRSLTDILSGKQGRFRQNLLGKRVDYSGR
1i3qA           EHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQLQKSGRPVKSIRARLKGKEGRIRGNLMGKRVDFSAR
1dioA           ----------------------------------------------------------------------
1lm5A           ----------------------------------------------------------------------
1i3qB           --------------------------------------------------------------AEDSWAVI
1g7dA           ----------------------------------------------------------------------
1kitA2          ----------------------------------------------------------------------
2r7kA1          ----------------------------------------------------------------------
1t0hB           -------------------------------------------------------------------SXR
1r3eA2          ----------------------------------------------------------------------
1xi8A2          ----------------------------------------------------------------------
2nqmA2          ----------------------------------------------------------------------
1qwyA           ----------------------------------------------------------------------
1vs6W1          ----------------------------------------------------------------------
2hgjD2          ----------------------------------------------------------------------
1cfmA2          ----------------------------------------------------------------------
1brwA3          ----------------------------------------------------------------------
1v8qA           ----------------------------------------------------------------------
2c35A1          ----------------------------------------------------------------------
1accA           ----------------------------------------------------------------------
1uz5A2          ----------------------------------------------------------------------
2hgjD2          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           SVITVGPSLRLHECGLPKKMALELFKPFVYSKLRLGGHATTIKQAKRMVELEEAVVWDILETVINEHPVL
2ghoD1          SVIVVGPQLKLHQCGLPKRMALELFKPFLLKKMEEKAFAPNVKAARRMLERQRDIVWDALEEVIHGKVVL
1iw7D           SVIVVGPQLKLHQCGLPKRMALELFKPFLLKKMEEKGIAPNVKAARRMLERQRDIVWDALEEVIHGKVVL
1i3qA           TVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYRDSGDRIDLRYSKRAGDIQLQYGWKVERHIMDNDPVL
1dioA           ----------------------------------------------------------------------
1lm5A           ----------------------------------------------------------------------
1i3qB           SAFFREKGLVSQQ--------LDSFNQFVDYTLQICEDSTLIEISFGKIYVTKPMVNESDGVTHALYPQE
1g7dA           ----------------------------------------------------------------------
1kitA2          ----------------------------------------------------------------------
2r7kA1          ----------------------------------------------------------------------
1t0hB           PVVLVGPSLKGYEVTDXXQKAFDFLKHRFEGRISITRVTADISLAKAIIERSN--TRSSLAEVQSEIERI
1r3eA2          ----------------------------------------------------------------------
1xi8A2          ----------------------------------------------------------------------
2nqmA2          ----------------------------------------------------------------------
1qwyA           ----------------------------------------------------------------------
1vs6W1          ----------------------------------------------------------------------
2hgjD2          ----------------------------------------------------------------------
1cfmA2          ----------------------------------------------------------------------
1brwA3          ----------------------------------------------------------------------
1v8qA           ----------------------------------------------------------------------
2c35A1          ----------------------------------------------------------------------
1accA           ----------------------------------------------------------------------
1uz5A2          ----------------------------------------------------------------------
2hgjD2          ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           LNRAPTLHRLGIQAFEPRLIEGKAIQLHPLVCAAFNADFDGDQMAVHVPLTVESQLEARVLMMSTNNILS
2ghoD1          LNRAPTLHRLGIQAFQPVLVEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLS
1iw7D           LNRAPTLHRLGIQAFQPVLVEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLS
1i3qA           FNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVS
1dioA           ----------------------------------------------------------------------
1lm5A           ----------------------------------------------------------------------
1i3qB           RLRNLTYSSGLFVDVKKRTYEKVFIGRLPIMLRSKNCYLSE--------ATESDLYKLKECPFDMGGYFI
1g7dA           ----------------------------------------------------------------------
1kitA2          ----------------------------------------------------------------------
2r7kA1          ----------------------------------------------------------------------
1t0hB           FELARTLQLVVLDADTI--NHPAQLSKTSLA---------------------------------------
1r3eA2          ----------------------------------------------------------------------
1xi8A2          ----------------------------------------------------------------------
2nqmA2          ----------------------------------------------------------------------
1qwyA           ----------------------------------------------------------------------
1vs6W1          ----------------------------------------------------------------------
2hgjD2          ----------------------------------------------------------------------
1cfmA2          ----------------------------------------------------------------------
1brwA3          ----------------------------------------------------------------------
1v8qA           ----------------------------------------------------------------------
2c35A1          ----------------------------------------------------------------------
1accA           ----------------------------------------------------------------------
1uz5A2          ----------------------------------------------------------------------
2hgjD2          ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           PASGQPIITPTQDIVLGLYYITREKEGARGEGKLFSSYEDVSRAYNSGTIDIHAKIKLRIDRQVFDTKGN
2ghoD1          PASGEPLAKPSRDIILGLYYITQVRKEKKGAGMAFATPEEALAAYERGEVALNAPIVVAVGRLKFVFEAL
1iw7D           PASGEPLAKPSRDIILGLYYITQVRKEKKGAGLEFATPEEALAAHERGEVALNAPIKVAGRETSVGRLKY
1i3qA           PQSNKPCMGIVQDTLCGIRKLTLRDTFIELDQVLNMLYWVPDWDGVIPTPAIIKPKPLWSGKQILGIHLQ
1dioA           ----------------------------------------------------------------------
1lm5A           ----------------------------------------------------------------------
1i3qB           INGSEKVLIAQERSAGNIVQVFKKA------APSPISHVAEIR----SALEKGSRFISTL-QVKLYGREG
1g7dA           ----------------------------------------------------------------------
1kitA2          ----------------------------------------------------------------------
2r7kA1          ----------------------------------------------------------------------
1t0hB           ----------------------------------------------------------------------
1r3eA2          ----------------------------------------------------------------------
1xi8A2          ----------------------------------------------------------------------
2nqmA2          ----------------------------------------------------------------------
1qwyA           ----------------------------------------------------------------------
1vs6W1          ----------------------------------------------------------------------
2hgjD2          ----------------------------------------------------------------------
1cfmA2          ----------------------------------------------------------------------
1brwA3          ----------------------------------------------------------------------
1v8qA           ----------------------------------------------------------------------
2c35A1          ----------------------------------------------------------------------
1accA           -------VLPTTSLVLG-KNQTLATIKAKAPNNYYPSKNLAPIALNAQDDFSSTPITMNYN---------
1uz5A2          ----------------------------------------------------------------------
2hgjD2          ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           TYNEKGVVNTTVGRALLLNILPEGLSFSLLNKVLVKKEISKIINQAFRVLGGKATVVLADKLMYAGFKYS
2ghoD1          LAVAHGLLDTSPGRILFARIVGEAVGDEKVAQELIKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTLS
1iw7D           VFANPDELETSPGRILFARIVAEAVEDIQLDVPQEKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTFS
1i3qA           RFDEGTTLLSPKDNGML--IIDGQIIFGVVEKKTVGSSNGGLIHVVTREKGPQVCAKLFGNIQKVVNFWL
1dioA           ----------------------------VTELDGKPVSDFDLIDHFIARYGINLNRAVMAMDSVKLANML
1lm5A           ----------------------------------------------------------------------
1i3qB           SSARTIK--------ATLPYIKQDIPIVIIFRALGIIPDGEILEHICYDVDWQMLEMLKPCVEDGFVIQD
1g7dA           ----------------------------------------------------------------------
1kitA2          ----------------------------------------------------------------------
2r7kA1          ----------------------------------------------------------------------
1t0hB           ----------------------------------------------------------------------
1r3eA2          ----------------------------------------------------------------------
1xi8A2          ----------------------------------------------------------------------
2nqmA2          ----------------------------------------------------------------------
1qwyA           ----------------------------------------------------------------------
1vs6W1          ----------------------------------------------------------------------
2hgjD2          ----------------------------------------------------------------------
1cfmA2          ----------------------------------------------------------------------
1brwA3          ----------------------------------------------------------------------
1v8qA           ----------------------------------------------------------------------
2c35A1          ----------------------------------------------------------------------
1accA           ----------------------------------------------------------------------
1uz5A2          ----------------------------------------------------------------------
2hgjD2          ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           TLSGVSVGVDDMTIPDNXXXXXXXXXXXXXQITEQYQSSLITENERYNNIINIWSKTSDEVGASMMDAIS
2ghoD1          TTSGITIGIDDAVIPEEKQRYLEEADRKLRQIEQAYEMGFLTDRERYDQVIQLWTETTEKVTQAVFKNFE
1iw7D           TTSGITIGIDDAVIPEEKKQYLEEADRKLLQIEQAYEMGFLTDRERYDQILQLWTETTEKVTQAVFKNFE
1i3qA           LHNGFSTGIGDTIADGEITETIAEAKKKVLDVTKEAQANLLTAKHGMDNVVRFLNEARDKAGRLAE----
1dioA           CDPNVKRSEIVPLTTAMTPAKIVEVVSHMNVVERTPSQQAHVTNVKDNPVQIAADAAEGAWRGFDEQETT
1lm5A           ----------------------------------------------------------------------
1i3qB           RETALDFIGKEKRIQYAKDILQ----------KEFLPHITQLEGFESRKAFFL------------GYMIN
1g7dA           ----------------------------------------------------------------------
1kitA2          ----------------------------------------------------------------------
2r7kA1          ----------------------------------------------------------------------
1t0hB           ----------------------------------------------------------------------
1r3eA2          ----------------------------------------------------------------------
1xi8A2          ----------------------------------------------------------------------
2nqmA2          ----------------------------------------------------------------------
1qwyA           ----------------------------------------------------------------------
1vs6W1          ----------------------------------------------------------------------
2hgjD2          ----------------------------------------------------------------------
1cfmA2          ----------------------------------------------------------------------
1brwA3          ----------------------------------------------------------------------
1v8qA           ----------------------------------------------------------------------
2c35A1          ----------------------------------------------------------------------
1accA           ----------------------------------------------------------------------
1uz5A2          ----------------------------------------------------------------------
2hgjD2          ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           KDTVSINGEKKEIESFNSVYMMAKSGARGSYNQMRQLAGMRGLMAKPDGTMIETAITANFREGLSVLQYF
2ghoD1          EN-----------YPFNPLYVMAQSGARGNPQQIRQLCGMRGLMQKPSGETFEVPVRSSFREGLTVLEYF
1iw7D           E-----------NYPFNPLYVMAQSGARGNPQQIRQLCGLRGLMQKPSGETFEVPVRSSFREGLTVLEYF
1i3qA           ----------VNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVAFGFVDRTFVENSYLRGLTPQEFF
1dioA           V--------AVARYAPFNAIALLVGSQVGRPGVLTQCSLEEATELKLGMLGHTCYLASSYASRGLKMRFT
1lm5A           ----------------------------------------------------------------------
1i3qB           RLLLCALDRKDQD--DRDHFGKKRLDLAGPLLAQLFKTLFKKLTKDIFRYMQRTVELANAKTITSGLKYA
1g7dA           ----------------------------------------------------------------------
1kitA2          ---------DWQSNAKIRIVDG-------AANQIQVADGSRKYVVTLSIDESG-GLVANL-NGVSAPIIL
2r7kA1          ----------------------------------------------------------------------
1t0hB           ----------------------------------------------------------------------
1r3eA2          ----------------------------------------------------------------------
1xi8A2          ----------------------------------------------------------------------
2nqmA2          ----------------------------------------------------------------------
1qwyA           ----------------------------------------------------------------------
1vs6W1          ----------------------------------------------------------------------
2hgjD2          ----------------------------------------------------------------------
1cfmA2          ----------------------------------------------------------------------
1brwA3          ----------------------------------------------------------------------
1v8qA           ----------------------------------------------------------------------
2c35A1          ----------------------------------------------------------------------
1accA           ----------------------------------------------------------------------
1uz5A2          ----------------------------------------------------------------------
2hgjD2          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           TSTHGARKGLADTALKTANAGYLTRRLVDVAQDLVVIEEDCGTDDGLMFSAIVEDGEVKVPLVERALGRT
2ghoD1          ISSHGARKGGADTALRTADSGYLTRKLVDVAHEIVVREADCGTTNYISV-PLFQMDEVTRTLRLRKYGRV
1iw7D           ISSHGARKGGADTALRTADSGYLTRKLVDVTHEIVVREADCGTTNYISVPLF-QPDEVTRSLRLRKRADI
1i3qA           FHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDNTTRNLGNVIQFIGEDGMDAAHIEKQSLDTI
1dioA           SGSGSEVQ--MGYAEGKS-MLYLEARCIYITKAAGVQGLQNGSV--------------------------
1lm5A           ----------------------------------IAAIFDTENLEKISITEGIERGIVDSITGQRLLAQA
1i3qB           LATGNWGAGVSQVLNRYTYSSTLSRRT-------------------------------------------
1g7dA           ----------------------------------------------------------------------
1kitA2          QSEHAKVHSFHDYELQYSALNHTTTLFVDGQQITTWAGEVSQENNIQFGADAQIDGRLVLTQQGHNLVEF
2r7kA1          ----------------------------------------------------------------------
1t0hB           ----------------------------------------------------------------------
1r3eA2          ----------------------------------------------------------------------
1xi8A2          -------------------------RLTPYEEALSIVLNDLKEIVEYVPLKDALGRVLAEDIVASYDLSF
2nqmA2          ----------LDTALNE-----MLSRVTPLTAQETLPLVQCFGRILASD-------VVSPLDVPGFDNRR
1qwyA           ----------------------------------------------------------------------
1vs6W1          ----------------------------------------------------------------------
2hgjD2          ----------------------------------------------------------------------
1cfmA2          ----------------------------------------------------------------------
1brwA3          ----------------------------------------------------------------------
1v8qA           ----------------------------------------------------------------------
2c35A1          ----------------------------------------------------------------------
1accA           ----------------------------------------------------------------------
1uz5A2          -----------------------TGAMLPGNADAVIQFEDVERVNGEIIYKPAYPGLG---------VMK
2hgjD2          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           LAADVVTEKGVVLLEAGTXXXXXXXXXXXXXGIDMIKVRSPITCKTRRGLCAKCYGRDLARERQVNVGES
2ghoD1          LAREV--EALGRRLEEGREDVHFLIKAAEAGEVREVPVRSPLTCQTRYGVCQKCYGYDLSMARPVSIGEA
1iw7D           EAGLYVLAREVEVLYLSMDDVHLLIKAAEAGEIQEVPVRSPLTCQTRYGVCQKCYGYDLSMARPVSIGEA
1i3qA           GGSDAAFEK-------------------------------------------------------------
1dioA           ----------------------------------------------------------------------
1lm5A           CTGGIIHTTGQKLSVSQGVIDQDMATRLKPAQKAFIGFKMSAAEAVKEKWLPYEAGQRF--------LEF
1i3qB           ----------------------------------------------------------------------
1g7dA           ----------------------------------------------------------------------
1kitA2          DAFYLA--QQTPEVEK----------DLEKLGWTKIKTGNTMSLYGNA----------------------
2r7kA1          ----------------------------------------------------------------------
1t0hB           ----------------------------------------------------------------------
1r3eA2          ----------------------------------------------------------------------
1xi8A2          AGEDV--KKGDIALKKGTILRPQDLALLKALGIRKVPVK-------------------------------
2nqmA2          RGEDI--SAGAVVFPAGTRLTTAELPVIASLGIAEVPVI-------------------------------
1qwyA           ----------------------------------------------------------------------
1vs6W1          ----------------------------------------------------------------------
2hgjD2          ----------------------------------------------------------------------
1cfmA2          ----------------------------------------------------------------------
1brwA3          ----------------------------------------------------------------------
1v8qA           ----------------------------------------------------------------------
2c35A1          ----------------------------------------------------------------------
1accA           ----------------------------------------------------------------------
1uz5A2          KGIDI--EKGRLLVKKGERLGFKQTALLSAVGINKVKVF-------------------------------
2hgjD2          -------------------------------------------------------------------FMT


                         .         .         .         +         .         .         .:980
query           VGVIAAQSIGEPGTQLTMRTFHTGGAASLGITVSDIKVKTAGKIKFKNIRTVTNKEGQEIVISRAGEIIV
2ghoD1          VGVVAAESIGEPGTQLTMRTTQGLPRVIELFEARRPKAKA----------VISEIDGVVRIEEGEDRLSV
1iw7D           VGIVAAQSIGEPGTQLTMRTFHTGGVAGAADITQGLPRVIELFEARRPKAKISEIDGVVRIEETEEKLSV
1i3qA           ----------------------------------------------------------------------
1dioA           ----------------------------------------------------------------------
1lm5A           QYLTGGLVDPEVHGRISTEEAIRKGFID-GRAAQRLQDTSSYAKILTC-----PKTKLKISYKDAINRSM
1i3qB           ----------------------------------------------------------------------
1g7dA           ----------------------------------------------------------------------
1kitA2          ----------------------------------------------------------------------
2r7kA1          ----------------------------------------------------------------------
1t0hB           ----------------------------------------------------------------------
1r3eA2          ----------------------------------------------------------------------
1xi8A2          ----------------------------------------------------------------------
2nqmA2          ----------------------------------------------------------------------
1qwyA           ----------------------------------------------------------------------
1vs6W1          ----------------------------------------------------------------------
2hgjD2          ----------------------------------------------------------------------
1cfmA2          ----------------------------------------------------------------------
1brwA3          ----------------------------------------------------------------------
1v8qA           ----------------------------------------------------------------------
2c35A1          ----------------------------------------------------------------------
1accA           ----------------------------------------------------------------------
1uz5A2          ----------------------------------------------------------------------
2hgjD2          VADFSEITKTEPEKSLVKPLKKTGGRNNQGITVRFR--GGGHKRLYRIIDFKRWDKV-------------


                         .         *         .         .         .         .         +:1050
query           SDTMGRVREQHKIPMGAVVPLASGKAVEIGDVIATWDPHAQPLITDVAGKVVLEDVIDGITSKHTYDDLT
2ghoD1          FVESEGFSKEYKLPKDARLLVKDGDYVEAGQPLGAIDPH-------------------------------
1iw7D           FVESEGFSKEYKLPKEARLLVKDGDYVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVEEIQKVYRAQGVK
1i3qA           ----------------------------------------------------------------------
1dioA           ----------------------------------------------------------------------
1lm5A           VEDITGLRLLEAASVSS-----------------------------------------------------
1i3qB           ----------------------------------------------------------------------
1g7dA           ----------------------------------------------------------------------
1kitA2          ----------------------------------------------------------------------
2r7kA1          ----------------------------------------------------------------------
1t0hB           ----------------------------------------------------------------------
1r3eA2          ----------------------------------------------------------------------
1xi8A2          ----------------------------------------------------------------------
2nqmA2          ----------------------------------------------------------------------
1qwyA           ----------------------------------------------------------------------
1vs6W1          ----------------------------------------------------------------------
2hgjD2          ----------------------------------------------------------------------
1cfmA2          ----------------------------------------------------------------------
1brwA3          ----------------------------------------------------------------------
1v8qA           ----------------------------------------------------------------------
2c35A1          ----------------------------------------------------------------------
1accA           ----------------------------------------------------------------------
1uz5A2          ----------------------------------------------------------------------
2hgjD2          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:1120
query           GQQTIEITSISQRTTSKNLKPVVKIVDEKGAKLKSIPLAVGAVLNVADDSILEVGDIVAKIPLEGSKNKD
2ghoD1          ----------------------------------------------------------------------
1iw7D           LHDKHIEIVVRQMMKYVEVTDPGDSRLLEGQVLEKWDEALNERLIAEGKTPVAWKPLLMGVTKSALSTKS
1i3qA           ----------------------------------------------------------------------
1dioA           ----------------------------------------------------------------------
1lm5A           ----------------------------------------------------------------------
1i3qB           ----------------------------------------------------------------------
1g7dA           ----------------------------------------------------------------------
1kitA2          ----------------------------------------------------------------------
2r7kA1          ----------------------------------------------------------------------
1t0hB           ----------------------------------------------------------------------
1r3eA2          ----------------------------------------------------------------------
1xi8A2          ----------------------------------------------------------------------
2nqmA2          ----------------------------------------------------------------------
1qwyA           ----------------------------------------------------------------------
1vs6W1          --------------------------HKKAGRNGRDSEAKRLGVKRFGGESVLAGSIIVRQR-----GTK
2hgjD2          --------------------------------------------------------TGGRNNQGRITVRF
1cfmA2          ----------------------------------------------------------------------
1brwA3          ----------------------------------------------------------------------
1v8qA           --------------------------------------------KRYEGQVVRAGNILVRQ-----RGTR
2c35A1          ----------------------------------------------------------------------
1accA           ----------------------------------------------------------------------
1uz5A2          ----------------------------------------------------------------------
2hgjD2          ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:1190
query           ITGGLPRVAELFEARRPKDAAILSPCDGMVRLGNRDTKEKQRIEIIDKNGHIVEEILLPKSRHLVVFDGE
2ghoD1          ----------------------------------------------------------------------
1iw7D           WLSAASTTHVLTEAAIAGKKDELIGLKENVILG-RLIPASDFVRFTQVVDQKTLKAIEEARKE--AVEA-
1i3qA           -----------------------------------------RVVMMKYDRKVPSPTGEYVKEPEWVLETD
1dioA           ----------------------------------------------------------------------
1lm5A           ----------------------------------------------------------------------
1i3qB           ----------------------------------------------------------------------
1g7dA           ----------------------------------------------------------------------
1kitA2          ----------------------------------------------------------------------
2r7kA1          ----------------------------------------------------------------------
1t0hB           ----------------------------------------------------------------------
1r3eA2          ----------------------------------------------------------------------
1xi8A2          ----------------------------------------------------------------------
2nqmA2          ----------------------------------------------------------------------
1qwyA           --------------AMPENSPVYSLTDGTVVQAGWSNYGGGNQVTIKEANSNNYQ-WYMHNNRLTVSAGD
1vs6W1          FHAGA-------NVGCGRDHTLFAKADGKVKFE-VKGPKNRKFISIE-----------------------
2hgjD2          RGGGHKRLYRIIDFKRWDKVGI----PAKVAAIEYDPNRSARIALLHYVDGEKRYIIAPD----GLQVGQ
1cfmA2          ---------------------YNASAAGKIVAALSEKKGGFEVSIEKANG-EVVVDKIPAGPDLIVKEGQ
1brwA3          --------------KAAYTSTVTAAADGYVAEM-AADDIGTAAMWLGGRAKKEDVIDLAVGIVLHKKIGD
1v8qA           FKPGK-------NVGMGRDFTLFALVDGVVEFQ-DRGRLGRYVHVR------------------------
2c35A1          ----------------------------------------------------------------------
1accA           ----------------------------------------------------------------------
1uz5A2          ----------------------------------------------------------------------
2hgjD2          ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:1260
query           QVSRGDVLADGPTDPHDLLKYKGLEEFADYILIEAQSVYRMQGVVINDKHIETIVRQMLRKAVILDEGDS
2ghoD1          ----------------------------------------------------------------------
1iw7D           ----------------------------------------------------------------------
1i3qA           GVNLSEVMTVPGIDPTDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTQGGL------
1dioA           ----------------------------------------------------------------------
1lm5A           ----------------------------------------------------------------------
1i3qB           ----------------------------------------------------------------------
1g7dA           ----------------------------------------------------------------------
1kitA2          ----------------------------------------------------------------------
2r7kA1          ----------------------------------------------------------------------
1t0hB           ----------------------------------------------------------------------
1r3eA2          ----------------------------------------------------------------------
1xi8A2          ----------------------------------------------------------------------
2nqmA2          ----------------------------------------------------------------------
1qwyA           KVKAGDQIAYSGSTG-------------------------------------------------------
1vs6W1          ----------------------------------------------------------------------
2hgjD2          QVVAGPDA--------------------------------------------------------------
1cfmA2          TVQADQPLTNNP----------------------------------------------------------
1brwA3          RVQKGEALSNRPVLDVKE----------------------------------------------------
1v8qA           ----------------------------------------------------------------------
2c35A1          ----------------------------------------------------------------------
1accA           ----------------------------------------------------------------------
1uz5A2          ----------------------------------------------------------------------
2hgjD2          ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:1330
query           KFVKDESIELVRILEENDKLRKQGKKEVEYELVLMGITRSSLSTESFLSAASFQETTRVLTEASINSQID
2ghoD1          ----------------------------------------------------------------------
1iw7D           ----------------------------------------------------------------------
1i3qA           ----------------------------------TSVTRHGFSNTGALMRCSFEETVEILFEAGASAELD
1dioA           ----------------------------------------------------------------------
1lm5A           ----------------------------------------------------------------------
1i3qB           ----------------------------------------------------------------------
1g7dA           ----------------------------------------------------------------------
1kitA2          ----------------------------------------------------------------------
2r7kA1          ----------------------------------------------------------------------
1t0hB           ----------------------------------------------------------------------
1r3eA2          ----------------------------------------------------------------------
1xi8A2          ----------------------------------------------------------------------
2nqmA2          ----------------------------------------------------------------------
1qwyA           ----------------------------------------------------------------------
1vs6W1          ----------------------------------------------------------------------
2hgjD2          ----------------------------------------------------------------------
1cfmA2          ----------------------------------------------------------------------
1brwA3          ----------------------------------------------------------------------
1v8qA           ----------------------------------------------------------------------
2c35A1          ----------------------------------------------------------------------
1accA           ----------------------------------------------------------------------
1uz5A2          ----------------------------------------------------------------------
2hgjD2          ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:1400
query           NLRGLKENVLIGRLIPTGTGLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2ghoD1          ----------------------------------------------------------------------
1iw7D           ----------------------------------------------------------------------
1i3qA           DCRGVSENVILGQMAPIGTGA-------------------------------------------------
1dioA           ----------------------------------------------------------------------
1lm5A           ----------------------------------------------------------------------
1i3qB           ----------------------------------------------------------------------
1g7dA           ----------------------------------------------------------------------
1kitA2          ----------------------------------------------------------------------
2r7kA1          ----------------------------------------------------------------------
1t0hB           ----------------------------------------------------------------------
1r3eA2          ----------------------------------------------------------------------
1xi8A2          ----------------------------------------------------------------------
2nqmA2          ----------------------------------------------------------------------
1qwyA           ----------------------------------------------------------------------
1vs6W1          ----------------------------------------------------------------------
2hgjD2          ----------------------------------------------------------------------
1cfmA2          ----------------------------------------------------------------------
1brwA3          ----------------------------------------------------------------------
1v8qA           ----------------------------------------------------------------------
2c35A1          ----------------------------------------------------------------------
1accA           ----------------------------------------------------------------------
1uz5A2          ----------------------------------------------------------------------
2hgjD2          ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:1470
query           xxxxxxxxxxxxxxxxx
2ghoD1          -----------------
1iw7D           -----------------
1i3qA           -----------------
1dioA           -----------------
1lm5A           -----------------
1i3qB           -----------------
1g7dA           -----------------
1kitA2          -----------------
2r7kA1          -----------------
1t0hB           -----------------
1r3eA2          -----------------
1xi8A2          -----------------
2nqmA2          -----------------
1qwyA           -----------------
1vs6W1          -----------------
2hgjD2          -----------------
1cfmA2          -----------------
1brwA3          -----------------
1v8qA           -----------------
2c35A1          -----------------
1accA           -----------------
1uz5A2          -----------------
2hgjD2          -----------------