[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for ftul2:ACD30340.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1a27A.bssp"
#ERROR : Can't open dsspfile "1pwxA.bssp"
#ERROR : Can't open dsspfile "1bdbA.bssp"
#ERROR : Can't open dsspfile "1yb1A.bssp"
#ERROR : Can't open dsspfile "1xg5A.bssp"
#ERROR : Can't open dsspfile "1fjhA.bssp"
#ERROR : Can't open dsspfile "1nasA.bssp"
#ERROR : Can't open dsspfile "1c14A.bssp"
#ERROR : Can't open dsspfile "1u7uA.bssp"
#ERROR : Can't open dsspfile "1lu9A1.bssp"
#ERROR : Can't open dsspfile "1nytA1.bssp"
#ERROR : Can't open dsspfile "1n5dA.bssp"
#ERROR : Can't open dsspfile "2c54A1.bssp"
#ERROR : Can't open dsspfile "1ae1A.bssp"
#ERROR : Can't open dsspfile "2gdzA1.bssp"
#ERROR : Can't open dsspfile "2ib0A1.bssp"
#ERROR : Can't open dsspfile "1jr2A.bssp"
#ERROR : Can't open dsspfile "1ahhA.bssp"
#ERROR : Can't open dsspfile "1zemA1.bssp"
#ERROR : Can't open dsspfile "1qp8A1.bssp"
#ERROR : Can't open dsspfile "2ag5A1.bssp"
#ERROR : Can't open dsspfile "1snyA.bssp"
#ERROR : Can't open dsspfile "1x74A1.bssp"
#ERROR : Can't open dsspfile "1c3vA1.bssp"
#ERROR : Can't open dsspfile "1w6uA.bssp"
#ERROR : Can't open dsspfile "1e5lA2.bssp"
#ERROR : Can't open dsspfile "1zbqA1.bssp"
#ERROR : Can't open dsspfile "1h5qA.bssp"
#ERROR : Can't open dsspfile "2joeA1.bssp"
#ERROR : Can't open dsspfile "1b8pA1.bssp"
#ERROR : Can't open dsspfile "1dohA.bssp"
#ERROR : Can't open dsspfile "1a4iA1.bssp"
#ERROR : Can't open dsspfile "1dhrA.bssp"
#ERROR : Can't open dsspfile "1vhcA.bssp"
#ERROR : Can't open dsspfile "1vm6A3.bssp"
#ERROR : Can't open dsspfile "1spxA.bssp"
#ERROR : Can't open dsspfile "1di6A.bssp"
#ERROR : Can't open dsspfile "1vlwA.bssp"
#ERROR : Can't open dsspfile "2zqnA1.bssp"
#ERROR : Can't open dsspfile "1i24A.bssp"
#ERROR : Can't open dsspfile "1e1cA2.bssp"
#ERROR : Can't open dsspfile "1gu7A2.bssp"
#ERROR : Can't open dsspfile "1pjqA1.bssp"
#ERROR : Can't open dsspfile "1u9jA.bssp"
#ERROR : Can't open dsspfile "1h2iA.bssp"
#ERROR : Can't open dsspfile "2fr0A1.bssp"
#ERROR : Can't open dsspfile "1a9yA.bssp"
#ERROR : Can't open dsspfile "1ujmA.bssp"
#ERROR : Can't open dsspfile "1rkxA.bssp"
#ERROR : Can't open dsspfile "1npdA1.bssp"
#ERROR : Can't open dsspfile "1adeA.bssp"
#ERROR : Can't open dsspfile "2bgkA1.bssp"
#ERROR : Can't open dsspfile "1gefA.bssp"
#ERROR : Can't open dsspfile "1yo6A1.bssp"
#ERROR : Can't open dsspfile "1ftrA1.bssp"
#ERROR : Can't open dsspfile "1bw3A.bssp"
#ERROR : Can't open dsspfile "1qycA.bssp"
#ERROR : Can't open dsspfile "1sb8A.bssp"
#ERROR : Can't open dsspfile "1qorA2.bssp"
#ERROR : Can't open dsspfile "1hdoA.bssp"
#ERROR : Can't open dsspfile "2hjsA1.bssp"
#ERROR : Can't open dsspfile "1cjcA1.bssp"
#ERROR : Can't open dsspfile "1o5iA.bssp"
#ERROR : Can't open dsspfile "1edzA1.bssp"
#ERROR : Can't open dsspfile "2a35A1.bssp"
#ERROR : Can't open dsspfile "1b6rA2.bssp"
#ERROR : Can't open dsspfile "1xseA.bssp"
#ERROR : Can't open dsspfile "1d0iA.bssp"
#ERROR : Can't open dsspfile "1lsuA.bssp"
#ERROR : Can't open dsspfile "1k6iA.bssp"
#ERROR : Can't open dsspfile "1vl0A.bssp"
#ERROR : Can't open dsspfile "1bncA2.bssp"
#ERROR : Can't open dsspfile "1p9oA.bssp"
#ERROR : Can't open dsspfile "1bvrA.bssp"
#ERROR : Can't open dsspfile "1a9xA3.bssp"
#ERROR : Can't open dsspfile "1xq6A.bssp"
#ERROR : Can't open dsspfile "1yxmA1.bssp"
#ERROR : Can't open dsspfile "1e3jA2.bssp"
#ERROR : Can't open dsspfile "2bd0A1.bssp"
#ERROR : Can't open dsspfile "1bxkA.bssp"
#ERROR : Can't open dsspfile "1a71A2.bssp"
#ERROR : Can't open dsspfile "2gdtA1.bssp"
#ERROR : Can't open dsspfile "1bg6A2.bssp"
#ERROR : Can't open dsspfile "2bkaA1.bssp"
#ERROR : Can't open dsspfile "2b69A1.bssp"
#ERROR : Can't open dsspfile "1aorA1.bssp"
#ERROR : Can't open dsspfile "1o89A2.bssp"
#ERROR : Can't open dsspfile "2nacA1.bssp"
#ERROR : Can't open dsspfile "1gdhA1.bssp"
#ERROR : Can't open dsspfile "1db3A.bssp"
#ERROR : Can't open dsspfile "1ks9A2.bssp"
#ERROR : Can't open dsspfile "1e0dA1.bssp"
#ERROR : Can't open dsspfile "1psdA1.bssp"
#ERROR : Can't open dsspfile "2f1kA2.bssp"
#ERROR : Can't open dsspfile "1a2zA.bssp"
#ERROR : Can't open dsspfile "1jztA.bssp"

## Summary of PDB Search
:274
    2e-39  26%  1a27A  [c.2.1.2] 17-BETA-HYDROXYSTEROID-DEHYDROGENASE
    6e-33  18%  1pwxA  [c.2.1.2] HALOHYDRIN DEHALOGENASE
    6e-29  18%  1bdbA  [c.2.1.2] CIS-BIPHENYL-2,3-DIHYDRODIOL-2,3-DEHYDROGENASE
    2e-28  26%  1yb1A  [c.2.1.2] 17-BETA-HYDROXYSTEROID DEHYDROGENASE TYPE XI
    6e-28  33%  1xg5A  [c.2.1.2] ARPG836
    2e-26  27%  1fjhA  [c.2.1.2] 3ALPHA-HYDROXYSTEROID DEHYDROGENASE/CARBONYL
    9e-26  20%  1nasA  [c.2.1.2] SEPIAPTERIN REDUCTASE
    3e-25  15%  1c14A  [c.2.1.2] ENOYL REDUCTASE
    4e-25   9%  1u7uA  [c.72.3.1] COENZYME A BIOSYNTHESIS BIFUNCTIONAL PROTEIN
    2e-24  16%  1lu9A1 [c.2.1.7] METHYLENE TETRAHYDROMETHANOPTERIN DEHYDROGENASE
    2e-23  17%  1nytA1 [c.2.1.7] SHIKIMATE 5-DEHYDROGENASE A:102 -- 271
    6e-22  18%  1n5dA  [c.2.1.2] CARBONYL REDUCTASE/20BETA-HYDROXYSTEROID
    5e-21  11%  2c54A1 [c.2.1.2] GDP-MANNOSE-3', 5'-EPIMERASE A:13 -- 374
    6e-21  29%  1ae1A  [c.2.1.2] TROPINONE REDUCTASE-I
    2e-20  27%  2gdzA1 [c.2.1.2] NAD+-DEPENDENT 15-HYDROXYPROSTAGLANDIN A:3 -- 256
    2e-19   8%  2ib0A1 [a.25.1.9] CONSERVED HYPOTHETICAL ALANINE RICH PROTEIN A:17
    3e-19  10%  1jr2A  [c.113.1.1] UROPORPHYRINOGEN-III SYNTHASE
    5e-19  25%  1ahhA  [c.2.1.2] 7 ALPHA-HYDROXYSTEROID DEHYDROGENASE
    1e-18  28%  1zemA1 [c.2.1.2] XYLITOL DEHYDROGENASE A:3 -- 262
    1e-18  14%  1qp8A1 [c.2.1.4] FORMATE DEHYDROGENASE A:83 -- 263
    3e-18  25%  2ag5A1 [c.2.1.2] DEHYDROGENASE/REDUCTASE (SDR FAMILY) MEMBER 6 A:1
    5e-18  24%  1snyA  [c.2.1.2] SNIFFER CG10964-PA
    7e-18  14%  1x74A1 [c.123.1.1] 2-METHYLACYL-COA RACEMASE A:2 -- 360
    5e-17   8%  1c3vA1 [c.2.1.3] DIHYDRODIPICOLINATE REDUCTASE A:501 -- 605 A:715
    7e-17  17%  1w6uA  [c.2.1.2] 2,4-DIENOYL-COA REDUCTASE, MITOCHONDRIAL
    1e-16  14%  1e5lA2 [d.81.1.2] SACCHAROPINE REDUCTASE A:125 -- 391
    2e-16  24%  1zbqA1 [c.2.1.2] 17-BETA-HYDROXYSTEROID DEHYDROGENASE 4 A:3 -- 304
    3e-16  23%  1h5qA  [c.2.1.2] NADP-DEPENDENT MANNITOL DEHYDROGENASE
    2e-15  14%  2joeA1 [d.371.1.1] HYPOTHETICAL LIPOPROTEIN YEHR A:2 -- 131
    2e-15  12%  1b8pA1 [c.2.1.5] PROTEIN (MALATE DEHYDROGENASE) A:3 -- 158
    3e-15  22%  1dohA  [c.2.1.2] TRIHYDROXYNAPHTHALENE REDUCTASE
    3e-15   7%  1a4iA1 [c.2.1.7] METHYLENETETRAHYDROFOLATE DEHYDROGENASE / A:127 --
    4e-15  12%  1dhrA  [c.2.1.2] DIHYDROPTERIDINE REDUCTASE
    1e-14   8%  1vhcA  [c.1.10.1] PUTATIVE KHG/KDPG ALDOLASE
    5e-14   9%  1vm6A3 [c.2.1.3] DIHYDRODIPICOLINATE REDUCTASE A:1 -- 96 A:183 --
    8e-14  28%  1spxA  [c.2.1.2] SHORT-CHAIN REDUCTASE FAMILY MEMBER (5L265)
    1e-13  12%  1di6A  [c.57.1.1] MOLYBDENUM COFACTOR BIOSYTHETIC ENZYME
    2e-13  11%  1vlwA  [c.1.10.1] 2-DEHYDRO-3-DEOXYPHOSPHOGLUCONATE ALDOLASE/4-
    3e-13   6%  2zqnA1 [b.42.2.1] 29-KDA GALACTOSE-BINDING LECTIN A:131 -- 260
    5e-13   8%  1i24A  [c.2.1.2] SULFOLIPID BIOSYNTHESIS PROTEIN SQD1
    6e-13  12%  1e1cA2 [c.23.6.1] METHYLMALONYL-COA MUTASE ALPHA CHAIN A:561 -- 728
    2e-12  10%  1gu7A2 [c.2.1.1] 2,4-DIENOYL-COA REDUCTASE A:161 -- 349
    2e-12  14%  1pjqA1 [c.2.1.11] SIROHEME SYNTHASE A:1 -- 113
    2e-12  11%  1u9jA  [c.2.1.2] HYPOTHETICAL PROTEIN YFBG
    3e-12  13%  1h2iA  [d.50.1.3] DNA REPAIR PROTEIN RAD52 HOMOLOG
    4e-12  19%  2fr0A1 [c.2.1.2] ERYTHROMYCIN SYNTHASE, ERYAI A:1657 -- 1915
    7e-12  14%  1a9yA  [c.2.1.2] UDP-GALACTOSE 4-EPIMERASE
    1e-11  15%  1ujmA  [c.2.1.2] ALDEHYDE REDUCTASE II
    1e-11  13%  1rkxA  [c.2.1.2] CDP-GLUCOSE-4,6-DEHYDRATASE
    1e-11  13%  1npdA1 [c.2.1.7] HYPOTHETICAL SHIKIMATE 5-DEHYDROGENASE-LIKE A:107
    2e-11  12%  1adeA  [c.37.1.10] ADENYLOSUCCINATE SYNTHETASE
    3e-11  22%  2bgkA1 [c.2.1.2] RHIZOME SECOISOLARICIRESINOL DEHYDROGENASE A:11 --
    3e-11  14%  1gefA  [c.52.1.18] HOLLIDAY JUNCTION RESOLVASE
    3e-11  20%  1yo6A1 [c.2.1.2] PUTATIVE CARBONYL REDUCTASE SNIFFER A:1 -- 250
    5e-11  13%  1ftrA1 [d.58.33.1] FORMYLMETHANOFURAN\:TETRAHYDROMETHANOPTERIN A:1
    1e-10  13%  1bw3A  [b.52.1.2] BARWIN, BASIC BARLEY SEED PROTEIN
    1e-10  14%  1qycA  [c.2.1.2] PHENYLCOUMARAN BENZYLIC ETHER REDUCTASE PT1
    3e-10  25%  1sb8A  [c.2.1.2] WBPP
    5e-10  14%  1qorA2 [c.2.1.1] QUINONE OXIDOREDUCTASE A:113 -- 291
    5e-10  15%  1hdoA  [c.2.1.2] BILIVERDIN IX BETA REDUCTASE
    5e-10  12%  2hjsA1 [c.2.1.3] USG-1 PROTEIN HOMOLOG A:3 -- 129 A:320 -- 336
    7e-10  11%  1cjcA1 [c.3.1.1] PROTEIN (ADRENODOXIN REDUCTASE) A:107 -- 331
    3e-09  20%  1o5iA  [c.2.1.2] 3-OXOACYL-(ACYL CARRIER PROTEIN) REDUCTASE
    7e-09  14%  1edzA1 [c.2.1.7] 5,10-METHYLENETETRAHYDROFOLATE DEHYDROGENASE A:149
    2e-08  15%  2a35A1 [c.2.1.2] HYPOTHETICAL PROTEIN PA4017 A:4 -- 215
    2e-08  19%  1b6rA2 [c.30.1.1] PROTEIN (N5-CARBOXYAMINOIMIDAZOLE
    4e-08  25%  1xseA  [c.2.1.2] 11BETA-HYDROXYSTEROID DEHYDROGENASE TYPE 1
    9e-08  14%  1d0iA  [c.23.13.1] TYPE II 3-DEHYDROQUINATE HYDRATASE
    3e-07  18%  1lsuA  [c.2.1.9] CONSERVED HYPOTHETICAL PROTEIN YUAA
    5e-07  16%  1k6iA  [c.2.1.2] NMRA
    5e-07  25%  1vl0A  [c.2.1.2] DTDP-4-DEHYDRORHAMNOSE REDUCTASE, RFBD ORTHOLOG
    1e-06  17%  1bncA2 [c.30.1.1] BIOTIN CARBOXYLASE A:1 -- 114
    2e-06  18%  1p9oA  [c.72.3.1] PHOSPHOPANTOTHENOYLCYSTEINE SYNTHETASE
    2e-06  13%  1bvrA  [c.2.1.2] PROTEIN (ENOYL-ACYL CARRIER PROTEIN (ACP)
    2e-06  19%  1a9xA3 [c.30.1.1] CARBAMOYL PHOSPHATE SYNTHETASE (LARGE CHAIN)
    3e-06  28%  1xq6A  [c.2.1.2] UNKNOWN PROTEIN
    5e-06  21%  1yxmA1 [c.2.1.2] PEROXISOMAL TRANS 2-ENOYL COA REDUCTASE A:7 -- 303
    2e-05  23%  1e3jA2 [c.2.1.1] NADP(H)-DEPENDENT KETOSE REDUCTASE A:143 -- 312
    3e-05  30%  2bd0A1 [c.2.1.2] SEPIAPTERIN REDUCTASE A:2 -- 241
    3e-05  22%  1bxkA  [c.2.1.2] PROTEIN (DTDP-GLUCOSE 4,6-DEHYDRATASE)
    3e-05  14%  1a71A2 [c.2.1.1] LIVER ALCOHOL DEHYDROGENASE A:164 -- 339
    7e-05  10%  2gdtA1 [d.346.1.1] LEADER PROTEIN P65 HOMOLOG NSP1 (EC 3.4.22.-)
    7e-05  30%  1bg6A2 [c.2.1.6] N-(1-D-CARBOXYLETHYL)-L-NORVALINE DEHYDROGENASE
    7e-05  28%  2bkaA1 [c.2.1.2] TAT-INTERACTING PROTEIN TIP30 A:5 -- 236
    8e-05  21%  2b69A1 [c.2.1.2] UDP-GLUCURONATE DECARBOXYLASE 1 A:4 -- 315
    9e-05  18%  1aorA1 [a.110.1.1] ALDEHYDE FERREDOXIN OXIDOREDUCTASE A:211 --
    1e-04  23%  1o89A2 [c.2.1.1] YHDH A:116 -- 292
    2e-04  13%  2nacA1 [c.2.1.4] NAD-DEPENDENT FORMATE DEHYDROGENASE A:148 -- 335
    2e-04  21%  1gdhA1 [c.2.1.4] D-GLYCERATE DEHYDROGENASE A:101 -- 291
    2e-04  43%  1db3A  [c.2.1.2] GDP-MANNOSE 4,6-DEHYDRATASE
    3e-04  17%  1ks9A2 [c.2.1.6] 2-DEHYDROPANTOATE 2-REDUCTASE A:1 -- 167
    4e-04  15%  1e0dA1 [c.5.1.1] UDP-N-ACETYLMURAMOYLALANINE--D-GLUTAMATE LIGASE
    4e-04  26%  1psdA1 [c.2.1.4] D-3-PHOSPHOGLYCERATE DEHYDROGENASE A:108 -- 295
    5e-04  29%  2f1kA2 [c.2.1.6] PREPHENATE DEHYDROGENASE A:1 -- 165
    6e-04   8%  1a2zA  [c.56.4.1] PYRROLIDONE CARBOXYL PEPTIDASE
    0.001  32%  1jztA  [c.104.1.1] HYPOTHETICAL 27.5 KDA PROTEIN IN SPX19-GCR2
:274

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MVNNSKTILITGCSHGGIGYATAVHLKNLGHRVFASARQQKDVEALSQEGFETYLIDVTNYEYIDNALAD
1a27A           -----TVVLITGCS-SGIGLHLAVRLASDPSQSFKVYATLRDLKTQGRLSLETLQLDVRDSKSVAAARER
1pwxA           ------TAIVTNVKHF-GGMGSALRLSEAGHTVACHDESFKQKDELEAFAETYPQLKPMSEQEPAELIEA
1bdbA           -----EAVLITGGA-SGLGRALVDRFVAEGAKVAVLDKSAERLAELETDIVGDVRSLEDQKQAASRCVAR
1yb1A           -----EIVLITGAG-HGIGRLTAYEFAKLKSKLVLWDINKHGLEETAAKCKHTFVVDCSNREDIYSSAKK
1xg5A           -----RLALVTGAS-GGIGAAVARALVQQGLKVVGCARTVGNIEELAAECLIPYRCDLSNEEDILSMFSA
1fjhA           -------IVISGCA-TGIGAATRKVLEAAGHQIVGIDIRDAEVIA-----------DLSTAEGRKQAIAD
1nasA           -----AVCVLTGAS-RGFGRALAPQLARLLSPGSVMLVSARSESMLRQLLAAADLGTEAGVQRLLSAVRE
1c14A           -----KRILVTGVASKSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFSDIVLQCDVAEDASIDTMFAE
1u7uA           -----LNIMITAGP-TREPLDPVRYISDHSSGKMAAARRGANVTLVSGPVPTPPFVKRVDVMTALEMEAA
1lu9A1          -VKGKKAVVLAGT--GPVGMRSAALLAGEGAEVVLCGRKLDKAQAAADSVNKRFKVNVTAAETADDASRA
1nytA1          -------ILLIGA--GGASRGVLLPLLSLDCAVTITNRTVSRAEELAKLFAHTGS----------IQALS
1n5dA           ---NTRVALVTGAN-KGIGFAIVRDLCRQFAGDVVLTARDVARGQAAVKQLQFHQLDIIDLQSIRALCDF
2c54A1          -----LKISITGAG-GFIASHIARRLKHEGHYVIASDWKKNEHMTCDEFHLVDLRVMENCLKVTEGVDHV
1ae1A           -----TTALVTGGS-KGIGYAIVEELAGLGARVYTCSRNEKELDECLEIWREKGLNDLLSRTERDKLMQT
2gdzA1          -----KVALVTGAA-QGIGRAFAEALLLKGAKVALVDWNLEAGVQCKAALHEQFECDVADQQQLRDTFRK
2ib0A1          -----TIYGYGIVS-ALSPPGVNFLVADALKQHRHRRDDVIVMLSARGVAGYQLPMQVSSAADAARLAVR
1jr2A           ---EDYGGLIFTSP-RAVEAAELCLEQNNKTEVWERSLKEKWNAKSVYVSKIGLDTEGETCGNAEKLAEY
1ahhA           ---DGKCAIITGAG-AGIGKEIAITFATAGASVVVSDINADAANHVVDEGGQAFACDITSEQELSALADF
1zemA1          ---NGKVCLVTGAG-GNIGLATALRLAEEGTAIALLDMNREALEKAEASVREKYVCDVTSEEAVIGTVDS
1qp8A1          -----EKVAVLGL--GEIGTRVGKILAALGAQVRGFSRTPKEGPWRFTNSLEEALCALPLNKHTRGLVKY
2ag5A1          -----KVIILTAAAQG-IGQAAALAFAREGAKVIATDINESKLQELEKYPGIQTRVDVTKKKQIDQFANE
1snyA           -----NSILITGCNRGGLGLVKALNLPQPPQHLFTTCRNREQAKELEDLNIHILEIDLRNFDAYDKLVAD
1x74A1          ----SGLRVVELAG-IGPGPHAAMILGDLGADVVRIDRPISRDAMLRNRRIVTADLKSD----------Q
1c3vA1          -------VGVLGAK-GKVGTTMVRAVAAADDLTLSAELDAGDPLSLLTDGNTEV--VIDFTHPDVVMGNL
1w6uA           -----KVAFITG-GGTGLGKGMTTLLSSLGAQCVIASRKMDVLKATAEQKVHAIQCDVRDPDMVQNTVSE
1e5lA2          ---------------------------------------------------------------IDHLTIE
1zbqA1          -----RVVLVTGAGAGGRAYAALVVVNDLGGDFKGVGKGSLAADKVVEERGGKAVANYDSVEEGEKVVKT
1h5qA           -----KTIIVTGGN-RGIGLAFTRAVAAAGANVAVIYRSAADAVEVTEKVGKAYQCDVSNTDIVTKTIQQ
2joeA1          ----------------EESKKFSANLNGTEIAI-TYVYKGDKVLKQSSETKIQFAIGATTKEDAAKTLEP
1b8pA1          -----MRVAVTGAA-GQICYSLLFRIANGDMLGKDQPVILQLLEIPNEKAQKALQGVMMEIDDCAFPLLA
1dohA           -----KVALVTGAG-RGIGREMAMELGRRGCKVIVNYANSTESAEEVVAAIKKNGSDAACVKANVGVVED
1a4iA1          VPIAGRHAVVVGRS-KIVGAPMHDLLLWNNATVTTCHSKTAHLDEEVNKGDILVKGEWIKPGAIVIDCGI
1dhrA           -----RRVLVYGGR-GALGSRCVQAFRARNWWVASIDVVENEEAS--ASVIVKMTDSFTEQADQVTAEVG
1vhcA           -----IVPVIALDN-ADDILPLADTLAKNGLSVAEITFRSEAAADAIRLLFLIAAGTVLTAEQVVLAKSS
1vm6A3          -------YGIVGYS-GRMGQEIQKVFSEKGHELVLKVDV----NGVEELDSPDVVIDFSSPEALPKTVDL
1spxA           -----KVAIITGSS-NGIGRATAVLFAREGAKVTITTRQQILAAGVSEQNVNSVVADVTTDAGQD-EILS
1di6A           -------LVSISDR-DKGIPALEEWLTSALTTPFELETRL----------------IPDEQAIIEQTLCE
1vlwA           -----IVAVLRANS-VEEAKEKALAVFEGGVHLIEITFTVPDADTVIKEGAIIGAGTVTSVEQCRKAVES
2zqnA1          ----------------------------------------------------------------------
1i24A           -----SRVMVIGGD-GYCGWATALHLSKKNYEVCIVDNLVRRLFDHQLGIASIHDRISRWKALTGKSIEL
1e1cA2          -----LLAKMGQDGHD-RGQKVATAYADLGFDVDVGPLFQTPEETARQAVEAGVSSLAGGHLTLV-PALR
1gu7A2          KLTPGKDWFIQNGGTSAVGKYASQIGKLLNFNSISVIRDRPNLDEVVASLKELGTEDQNNSREFGPTIKE
1pjqA1          -----RDCLIVGG--GDVAERKARLLLEAGARLTVNALTFIPQFTVWANEGMDSCWLAIAATDDDTVNQR
1u9jA           -----TRVLILGVN-GFIGNHLTERLLREDHYEVYGLDIGSDAISRFLPHFHFVEGDISIHSEWIEYHVK
1h2iA           -----------------------------GQCQYTAEEYQAIQKALRQRLGPEYISMAGGGQKVCYIEGH
2fr0A1          ------TVLVTGGT-GGVGGQIARWLARRGAPHLLLVSRSGPDADGAGELVAVAACDVTDRESVRELLGG
1a9yA           -------VLVTGGS-GYIGSHTCVQLLQNGHDVIILDNLCNSKRSVLPVIERLGGKHPTFVEGDIRNEAL
1ujmA           VLPEGSLVLVTGAN-GFVASHVVEQLLEHGYKVRGTARSASKLANLQKR------WDAKYPGRFETAVVE
1rkxA           INNSFKRVFVTGHT-GFKGGWLSLWLQTMGATVKGYSLTAPTVPTARVADGMQSEIGDIRDQNKLLESIR
1npdA1          -----KTXVLLGA--GGASTAIGAQGAIEGKEIKLFNRRDEFFDKALAFAQRVNENTDCVVTVTDLADQQ
1adeA           -----GAKAIGTTG-RGIGPAYEDKVARRGLRVGDLFDKETFAEKLKEVLVNYYKAEAVDYQKVLDDTMA
2bgkA1          -----KVAIITGGA-GGIGETTAKLFVRYGAKVVIADIADDHGQKVCNNVISFVHCDVTKDEDVR-NLVD
1gefA           ----------------QAERELIKLLEKHGFAVVRSAGKKVDLVAGNGKKYLCIEVKVTKKDHLYVGKRD
1yo6A1          -----GSVVVTGAN-RGIGLGLVQQLIRHIIATARDVEKATELKSIKDSRVHVLPLTVTCDKSLDTFVSK
1ftrA1          ----------------EIEDTFAEAFEAKMARVLITAASHKWAMIAVKEGTSVIMCEAGIDCGYV-PPEE
1bw3A           -----YYRPAQNNW-DLGAPAVSAYCATWDASKPLSWRSKYGWTAFRGQAACGKCLRVTNPATGAQITAR
1qycA           ---SRSRILLIGAT-GYIGRHVAKASLDLGHPTFLLVRESTASSNSEKAQLLESFKASGANIVGSIDDHA
1sb8A           -----KVWLITGVA-GFIGSNLLETLLKLDQKVTGHQRNLDEVRSLVSENFKFIQGDIRNLDDCNNACAG
1qorA2          EIKPDEQFLFHAAAGG-VGLIACQWAKALGAKLIGTVGTAQKAQSALKAGAW----QVINYREEDLVERL
1hdoA           -----KKIAIFGAT-GQTGLTTLAQAVQAGYEVTVLVRDSSRLPSEGPRPAHVVVGDVLQAADVDKTVAG
2hjsA1          -----LNVAVVGAT-GSVGEALVGLLDERDFPLHRLHLLASAESAGQRSSLRVGDVDSFDFSSVG-----
1cjcA1          -----DTAVILGQ--GNVALDVARILLTPPDHLEKTDITEAALGALRQSRVKIVGRRGPLQVAF-TIKEL
1o5iA           -----KGVLVLAAS-RGIGRAVADVLSQEGAEVTICARNEEL----------LKRSGHRYVVCDLRKDLD
1edzA1          -----KKCIVINRS-EIVGRPLAALLANDGATVYSVDVNNIQKFTRGESLKLNKHHVEDLGEYSELLKKC
2a35A1          -----KRVLLAGAT-GLTGEHLLDRILSEPTLAKVIAP----------------------ARKALAEHPR
1b6rA2          -----KQVCVLGN--GQLGRMLRQAGEPLGIAVWPVGLDAEPAAVPFQQSVITAEIERWPETALTRQLAR
1xseA           -----KKVIVTGAS-KGIGREIAYHLAKMGAHVVVTARSKEALQKVVARCLELGAGSMEDMTFAEEFVAE
1d0iA           -----------------------------QPEIYGSDTLADVEALCVKAAAAHGTVDFRQSNHEGELVDW
1lsuA           -----KQFAVIGL--GRFGGSIVKELHRMGHEVLAVDINEEKVNAYASYATHAVIANATEENELLSLGIR
1k6iA           -----KTIAVVNAT-GRQAASLIRVAAAVGHHVRAQVHSLKGLIAE----------ELQAIPNVTLFQGP
1vl0A           -------ILITGAN-GQLGREIQKQLKGKNVEVIPTDVQD---------------LDITNVLAVNKFFNE
1bncA2          -----DKIVIANR--GEIALRILRACKELGIKTVAVHSSADRDLKHVLLADETVCIGPAPSVKSYLNIPA
1p9oA           -----PVRFLDNFSSGRRGATSAEAFLAAGYGVLFLYRARSAFPYAHRFPPQTWL---------------
1bvrA           -----KRILVSGIITDSIAFHIARVAQEQGAQLLRLIQRITDRLPAKAPLLELDVQNEEHLASLAGRVTE
1a9xA3          -----KSILILGA--GPIVIGQACEFDYSGAQACKALREEGYRVINVNSNPATIMTDDATYIEPIHWEVV
1xq6A           --ANLPTVLVTGAS-GRTGQIVYKKLKEGSDKFVAKGRSAQGKEKIGGEA-DVFIGDITDADSINPAFQG
1yxmA1          -----QVAIVTGGA-TGIGKSNVVIASRKLERLKSAADELQANLPPTKQARVIPIQCNIRNEEEVNNLVK
1e3jA2          -----TTVLVIGA--GPIGLVSVLAAKAYGAFVVCTARSPRRLEVAKNCGA-DVTLVVDPAKEEESSIIE
2bd0A1          -----HILLITGAG-KGIGRAIARHHPDFEPVLVLSSRTAADLEKISLECRAEGALTDTITADISDMADT
1bxkA           -----RKILITGGA-GFIGSALVRYIINETSDAVVAGNLMSLAPVAQSERFAFEKVDICDRAELARVFTE
1a71A2          -----STCAVFGLGGAG-LSVIMGCKAAGAARIIGVDINKDKFAKAKEVGAT----ECVNPQDYKKPIQE
2gdtA1          -----RDVLVRGFG-DSVEE--ALSEAREHLKNGTCGLVELEKGVLPQLEQPYVFIKRSDALS-TNHGHK
1bg6A2          ----SKTYAVLGL--GNGGHAFAAYLALKGQSVLAWDIDAQRIKEIQDRG--------------------
2bkaA1          -----KSVFILGAS-GETGRVLLKEILEQGL---------------------------------------
2b69A1          -----KRILITGGA-GFVGSHLTDKLXXDGHEVTVVDNFFTGRKRNVEHWIGHENFELINHDVVEPLYIE
1aorA1          ---NFQTGVYPYAY-EQSGEAMAAKYLVRNKPCYACPI--------------------------------
1o89A2          -------IVVTGAS-GGVGSTAVALLHKLGYQVVAVSGRESTHEYLKSLGA-SRVLPRDEFAESR-----
2nacA1          -----MHVGTVAA--GRIGLAVLRRLAPFDVHLHYTDRHRLPESVEKELNLTWH----------------
1gdhA1          -----KTLGIYGF--GSIGQALAKRAQGFDMDIDYFDTHRASSSDEASYQ--------------------
1db3A           ----SKVALITGVT-GQDGSYLAEFLLEKGYEV-------------------------------------
1ks9A2          -------ITVLGC--GALGQLWLTALCKQGHEVQGWLRVPQPYCSVNLVETDGSIFNESLTANDPDF---
1e0dA1          -----KNVVIIGL--GLTGLSCVDFFLARGVTPRVMDTRMTPPGLDKLPEAVERHTGSLNDEWLMAA---
1psdA1          -----KKLGIIGY--GHIGTQLGILAESLGMYVYFYDIENKLPLG-------------------------
2f1kA2          -------IGVVGL--GLIGASLAGDLRRRGHYLIGVSRQQSTCEKAVERQLVDE----------------
1a2zA           -----KKVLITGFE-PFGGDSKNPTEQIAKYFDRKQIG--NAMVYGRVLPVSVKRATIELKRYLEEIKP-
1jztA           -----KHVFVIAGPGGGDGLVCARHLKLFGYNP-------------------------------------


                         .         .         *         .         .         .         .:140
query           ILNKTGGSLDVIFNNAGYGQAGALEDIDTKFLKQQFETNVFGLHNLTYKALKIMRKQGYGKIIQHSSVLG
1a27A           V---TEGRVDVLVCNAGLGLLGPLEALGEDAVASVLDVNVVGTVRMLQAFLPDMKRRGSGRVLVTGSVGG
1pwxA           VTSAYGQ-VDVLVSNDIFAEFQPIDKYAVEDYRGAVEALQIRPFALVNAVASQMKKRKSGHIIFITSATP
1bdbA           FGKIDTLIPNAGIWDYSTALVDLPEESLDAAFDEVFHINVKGYIHAVKACLPALVASR-GNVIFTISNAG
1yb1A           VKAEIGD-VSILVNNAGVVYTSDLFATQDPQIEKTFEVNVLAHFWTTKAFLPAMTKNNHGHIVTVASA-A
1xg5A           IRSQHSGV-DICINNAGLARPDTLLSGSTSGWKDMFNVNVLALSICTREAYQSMKERNVGHIININSMSG
1fjhA           VLAKCSKGMDGLVLCAGLGPQ-------TKVLGNVVSVNYFGATELMDAFLPALKKGHQPAAVVISSVAS
1nasA           LPRPEGLQRLLLINNAATLGDVSLNVNDLAEVNNYWALNLTSMLCLTSGTLNAFQDSLSKTVVNISSLCA
1c14A           LGKVWPK-FDGFVHSIGFAPGDQLDGDYVNGFKIAHDISSYSFVAMAKACRSMLNPGS--ALLTLSYLGA
1u7uA           VN-ASVQQQNIFIGCAAVADYRAALTIKMVKNPDIVAGVAA--LKDHRPYVVGFAAETNNVEEYARQKRI
1lu9A1          EAVKGAH-FVFTAGAIGLELLPQAAWQNESSIEIVADYNAQPPLGIGGIDATDKGKEYGGKRAFGALGIG
1nytA1          MDELEGHEFDLIINATSSGISGDIPAIPSSLIHPGIYCYDMFYQKGKTPFLAWCEQRGSKRNADGLGMLV
1n5dA           LRKEYGGL-DVLVNNAAIAFQLDNPTPFHIQAELTMKTNFMGTRNVCTELLPLIKPQ--GRVVNVSSTEG
2c54A1          FNLAADMGGMGFIQSNHSVIMYNNTMISFNMIEAARINGIKRFFYASSACIYPEFKQ-LETTNVSLKESD
1ae1A           VAHVFDGKLNILVNNAGVVIHKEAKDFTEKDYNIIMGTNFEAAYHLSQIAYPLLKASQNGNVIFLSSIAG
2gdzA1          VVDHFGR-LDILVNNAGVNNEKNWEKT--------LQINLVSVISGTYLGLDYMSKQNGGIIINMSSLAG
2ib0A1          MENDGATAWRAVVEHAETADDRASTALTESAVMATRWNRVLGAWPIT-AAF-------------------
1jr2A           ICSRESSALPLLFPCGNLKREILPKALSITVYQTVAHPGIQGNLNSYYSQQGVPASITFFSPSGLTYSLK
1ahhA           AISKLGK-VDILVNNAGGGGPKPFDMPMADF-RRAYELNVFSFFHLSQLVAPEMEKNGGGVILTITSMAA
1zemA1          VVRDFGK-IDFLFNNAGYGAFAPVQDYPSDDFARVLTINVTGAFHVLKAVSRQMITQNYGRIVNTASMAG
1qp8A1          QHLALXA-EDAVFVNVGRAEVLDRDGVLRILKERPQFIFASDVWWGRNDFAKDAEFFSLPNVVATPWVAG
2ag5A1          V-----ERLDVLFNVAGFVHHGTVLDCEEKDWDFSMNLNVRSMYLMIKAFLPKMLAQKSGNIINMSVASS
1snyA           IEGVTKDQGLNVLFAGIAPKSARITAVRSQELLDTLQTNTVVLKKAAKANESQPXGVGRAAIINXSSIIQ
1x74A1          GLELALKLIAKADVLIEGYRPGVTERLGLGPEECAKVNDRLIYARMTGWGQTGPRSQQAGHDINYISLNG
1c3vA1          EFLIDNGI-HAVVGTTGFTAERFQQVESWLVAKPNTSVLIAPNFTSFVPGVLLAVRRIAERPGLTVGLEP
1w6uA           LIKVAGH-PNIVINNAAGNFISPTERLSPNAWKTITDIVLNGTAFVTLEIGKQLIKAQGAAFLSITTIYA
1e5lA2          EVHAAGGKIKTFLSYCGGLPAPESSDNP---LGYKFSWSSRGVLLALRNAASFYKD---GKVTNVAGPEL
1zbqA1          ALDAFGRI-DVVVNNAGILRDRSFARISDEDWDIIHRVHLRGSFQVTRAAWEHMKKQKYGRIIMTSSASG
1h5qA           IDADLGP-ISGLIANAGVSVVKPATELTHEDFAFVYDVNVFGVFNTCRAVAKLWLQKQQKGSIVVTSSMS
2joeA1          LSAKYKN-IAGVEEKLTYTDTYAQEDMEKVDFKALQGISGINVSAEDAQMELVMKAAGFKEV--------
1b8pA1          GMTAHADPMTAFKDADVALLVGARPRGPGMERKDLLEANAQIFTVQGKAIDAVASRN--IKVLVVGNPAN
1dohA           IAVKIFGKLDIVCSNSGVVSFGHVKDVTPEEFDRVFTINTRGQFFVAREAYKHLEIGGRLILMGSITGQA
1a4iA1          NYKVVGD-VAYDEAKERASFITPVPGGVGPMTVAMLMQSTVESAKRF-----------------------
1dhrA           KLLGDQKVDAILCVAGGWAGGNAKSKSLFKNCDLMWKQSIWTSTISSHLATKHLKEGGLLTLAGAKAALD
1vhcA           GADFVVT-PGLNPKIVKLCQDLNFPITPGVNNPXAIEIALEX-----------GISAVKFFPAEASGGVK
1vm6A3          CK---KYRAGLVLGTTALKEEHLQMLRELSKEVPVRTVFAIGALKAAEFLVGKDPGMYSFEEV-------
1spxA           TTLGKFGKLDILVNNAGQ---------SIESYDATLNLNLRSVIALTKKAVPHLSSTKGEIVNISSIASG
1di6A           LVDEMSC--HLVLTTGGTGPARRDVTPDA--TLAVADREMPGFGEQMRQ---ISLHFVPTAILSRQVGVI
1vlwA           G-AEFIVSPHLDEEISQFCKEKGVFYMPGVMTPTELVKAMKLGHTILKVVGPQFVKAMKGPFPNVKFVPT
2zqnA1          -------------------------------------FFYIKSELNGKVLDIEGQNPAPGSKIITWDQKK
1i24A           YVGDICDFEFLAESFKSVHFGEQRSAPYSMIDRSRAVYTQHNNVIGTLNVLFAIKEFGEECHLVKLGTMG
1e1cA2          KELDKLGRPDILITVGGVIPEQDFDELRKDGAVEIYTPGTVI-PESAISLVKKLRASL------------
1gu7A2          WIKQSGGEAKLALNCVGGKSSTGIARKLNNNGLM-LTYGGMSFQPVTIPTSLYIFKNFTSAGFWVTEL--
1pjqA1          VSDAAES-RRIFCNVVDAPKAASF----------------------------------------------
1u9jA           KCDVVLPLVAIATPIEYTRNPLRVFELDFEENLRIIRYCVKYRKRIISTSEVYGMCSDKYFDEDHSNLIV
1h2iA           R-VINLANEMFGYNGWAH-SITQQNVDFVDLNNGKFYVGVCAFVRVQLKDGSYHEDVGYGVSEGLKSKAL
2fr0A1          I--GDDVPLSAVFHAAATLDDGTVDTLTGERIERASRAKVLGARNLHELTRELD----LTAFVLFSSFAS
1a9yA           MDHAIDTVIHFAGLKAVGESVQKPLEYYDNNVNGTLRLISAMRAANVKNFIFSSAATVYGDQPKIPYVES
1ujmA           DXLKQ-GAYDEVIKGAAGVAHIASVVSFSNKYDEVVTPAIGGTLNALRAAAATPSVKRFVLTSSTVSALI
1rkxA           EFQPEIVFHMAAQPLVRLSYSEPVETYSTNVMGTVYLLEAIRHVGGVKAVVNITSDKCYDNKEWIWGYRE
1npdA1          AFAEALASADILTNGTKVGXKPLENESLVNDISLLHPGLLVTECVYNPHXTKLLQQQAGCKTIDGYGXLL
1adeA           VALTSMVVDVSDLLDQARQRGD-------FVMFEGAQGTLLDIDHGTYPYVT----SSNTTAGGVATGSG
2bgkA1          TTIAKHGKLDIMFGNVGVLSTTPYSILEAGNEDFKRVMDVYGAFLVAKHAARVMIPAKKGSIVFTAISSF
1gefA           MGRLIEFRRFGGIPVLAVKLNVGWRFIEVSPKIEKFVFTPSSGVSLE-VLLGIQKT--------------
1yo6A1          VGEIVGSDLSLLINNAGVLLSYTNTEPNRAVIAEQLDVNTTSVVLLTQKLLPLQLSVSRAAVITISSGLG
1ftrA1          TPDGRPGVTIMIGHND-------EDELKEQLLDRIGQCVMTAPTASAFDAMPEAEKEDEDRV--------
1bw3A           IVDQANGGLDLDWDTVF----TKIDTNGIGYQQGHLNVNYQF----------------------------
1qycA           SLVEAVKNVDVVISTVGSLQIESQVNIIKAIKEVGTVKRFFPSEFGNDVDNVHAVEPAKSVFEVKAKVRR
1sb8A           V--------DYVLHQAALGSVPRSINDPITS----NATNIDGFLNM----LIAARDAKVQSFTYAASTYG
1qorA2          KEITGGKKVRVVYDSVGRDT----WERSLDCLQRRGLMVSFGNSSGAVTGVNLGILNQKGSYVTRPSLQG
1hdoA           Q-----------------------DAVIVLLGTRNDLSPTTVMSEGARNIVAAMKAHGVDKVVACTSAFL
2hjsA1          ----------------------------------------------------------------------
1cjcA1          REMIQLPGTRPMLDPADFLGLQDRIKEAARPRKRLMELLLRTAT--------------------------
1o5iA           LLFEKVKEVDILVLNAGGPKAGFFDELTNEDFKEAIDSLFLNMIKIVRNYLPAMKEKGWGRIVAITSFSV
1edzA1          SLDSDVVITGVPSENYKFPT------EYIKEGAVCINFACTKNFSDDVKEKASLYVPMTGKVT-------
2a35A1          LDNPVGPLAELLPQLDGSIDTAFCCLGTTIKEAGSEEAFRAVDFDLPLAVGKRALEMGARHYLVVSAL--
1b6rA2          ----------------------------------------------------------------------
1xseA           AGNLMGGLDMLILNHVLYNRLTFF--HGEIDNVRKSMEVNFHSFVVLSVAAMPMLMQSQGSIAVVSSVAG
1d0iA           IHEARLNHCGIVINPAAYSHTSILDALNTCDGLPVVEVHISNIH---------QREPFRHHSYVSQRADG
1lsuA           -------NFEYVIVAIG-ANIQASTLTTL--LLKELDIPNIWVKAQNYYHHKVLEKIGADRIIHPEKDMG
1k6iA           L------LNNVPLMDTLFEGAHLAFINTTSQ----AGDEIAIGKDLADAAKRAGTIQHY--IYSSMPDHS
1vl0A           K------KPNVVINCAAHTAVDKCEEQYDLA----YKINAIGPKNL----AAAAYSVGA-EIVQISTFDG
1bncA2          IISAAEIT-GAVAIHPGYG--FLSENANFAEQVERSGFIFIG----------------------------
1p9oA           ----------------------------------------------------------------------
1bvrA           AIGAGNKLDGVVHSIGFMPQTGMGINPFFDAPYADVSKGIHISAYSYASMAKALLPINPGGSIVGMDFDP
1a9xA3          RKIIEKERPDAVLPTMG-----------------------------------------------------
1xq6A           I---------------------------------------------------------------------
1yxmA1          STLDTFGKINFLVNNGGGQFLSPAEHISSKGWHAVLETNLTGTFYMCKAVYSSWMKEHG-GSIVNIIVPT
1e3jA2          IRSAIGDLPNVTIDCSG-----------------------------------------------------
2bd0A1          HIVERYGHIDCLVNNAGVGRFGALSDLTEEDFDYTMNTNLKGTFFLTQALFALMERQHSGHIFFITSVAA
1bxkA           ------HQPDCVMHLAAESHVDRSIDGPAAF----IETNIVGTYTL------------------------
1a71A2          VLTEMSGGVDFSFEVIGRLDT-------------------------------------------------
2gdtA1          VVELVAEMDGIQYGRSGLGVLVPHVGETPIAYRNVL-LRKNG----------------------------
1bg6A2          ----------------------------------------------------------------------
2bkaA1          ----------------------------------------------------------------------
2b69A1          V--------DQIYHLASPASPPNYXYNPIKT----LKTNTIGTLN----XLGLAKRVGARLLLASTS---
1aorA1          ----------------------------------------------------------------------
1o89A2          --PLEKQVWAGAIDTVG-----------------------------------------------------
2nacA1          ----------------------------------------------------------------------
1gdhA1          ----------------------------------------------------------------------
1db3A           ----------------------------------------------------------------------
1ks9A2          ----------------------------------------------------------------------
1e0dA1          ----------------------------------------------------------------------
1psdA1          ----------------------------------------------------------------------
2f1kA2          ----------------------------------------------------------------------
1a2zA           ---------EIVINLGLAPTYSNITVERIAVNIIDARIPDND----GYQPIDEKIEEDAPLAYMATL---
1jztA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           LVAMKYRGAYNASKYAIEGLTDTMRLELRDSNIFITSLNTGPITSKFRENSIKTITNVNYDSSVHKQQYE
1a27A           LMGLPFNDVYCASKFALEGLCESLAVLLLPFGVHLSLIECGPVHTAFMEKVLGSPEEVLDRTDIHTFHRF
1pwxA           FGPWKELSTYTSARAGACTLANALSKELGEYNIPVFAIGPNYLHS-------------------------
1bdbA           FYPNGGGPLYTAAKHAIVGLVRELAFELAPYVRVNG----------------------------------
1yb1A           HVSVPFLLAYCSSKFAAVGFHKTLTDELQITGVKTTCLCPNFVNTGFIKNPSTSLG--------------
1xg5A           HLPLSVTHFYSATKYAVTALTEGLRQELRETHIRATCISPGVVETQF-----------------------
1fjhA           AHLAFDKNAYAGSKNALTVAVRKRAAAWGEAGVRLNTIAPGAF---------------------------
1nasA           LQPYKGWGLYCAGKAARDMLYQVLAAEEP--SVRVLSYAPGPLDNDMQQL--------------------
1c14A           ERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRT-------------------------
1u7uA           RKNLDLICANSDNNALHLFWQDGDKVLPLERKELLGQLLLDEIVTRYDEKN-------------------
1lu9A1          GLKLKCIAKLFESSEGVFDAEEIYKLA-------------------------------------------
1nytA1          AQAAHAFLLWHGVLPDVEPVIKQLQEEL------------------------------------------
1n5dA           VRALNECSPELQQKFKSETITEEELVGLMNKFVEDTKNGVHRKEGWSDSTYGVTKIGVSVLSRIYARKLR
2c54A1          AWPAEPQDAYGLERLATEELCKHYNKDFGIECRIGRFHNIYGPFGTWKGGREKAPAAFCRKAQTSTDRFE
1ae1A           FSALPSVSLYSASKGAINQMTKSLACEWAKDNIRVNSVAPGVILQK------------------------
2gdzA1          LMPVAQQPVYCASKHGIVGFTRSLAANLMNSGVRLNAICPGFVNTAILES--------------------
2ib0A1          ----------------------------------------------------------------------
1jr2A           HIQELSGDNIDQIKFAAIG--PTTARALAAQGLPVSCTAESPTPQAL-----------------------
1ahhA           ENKNINMTSYASSKAAASHLVRNMAFDLGEKNIRVNGIAPGAILTDALKSVI------------------
1zemA1          VKGPPNMAAYGTSKGAIIALTETAALDLAPYNIRVNAISPGYMGPGFRQVELQAKVGSQYFSTDPKVVAQ
1qp8A1          ----------------------------------------------------------------------
2ag5A1          VKGVVNRCVYSTTKAAVIGLTKSVAADFIQQGIRCNCVCPGTVDTPSLQE--------------------
1snyA           GNTDGGXYAYRTSKSALNAATKSLSVDLYPQRIXCVSLHPGW----------------------------
1x74A1          ILHAIGRGDERPVPPLNLVGDFGGGSMFLLVGILAALWERQSSGKGQVVDA-------------------
1c3vA1          LLDL------------------------------------------------------------------
1w6uA           ETGSGFVVPSASAKAGVEAMSKSLAAEWGKYGMRFNVIQPGPI---------------------------
1e5lA2          MATA--KPYFIYPGFAFVAYPNRDSTPYKERYQIP------------EADNIVRGTLRYQGFPQFIKVLV
1zbqA1          IYGNFGQANYSAAKLGLLGLANSLAIEGRKSNIHCNTIAPNAGSRMTQT---------------------
1h5qA           LNGSLTQVFYNSSKAACSNLVKGLAAEWASAGIRVNALSPGYVNTDQTA---------------------
2joeA1          ----------------------------------------------------------------------
1b8pA1          TIAMKSAPSLPAKN--------------------------------------------------------
1dohA           -KAVPKHAVYSGSKGAIETFARCMAIDMADKKITVNVVAPGGIKTDM-----------------------
1a4iA1          ----------------------------------------------------------------------
1dhrA           --GTPGMIGYGMAKGAVHQLCQSLAGKNSGMPSGAAAIAVLP----------------------------
1vhcA           XIKALLGPYAQLQIXPTGGIGLHNIRDYLAIPNIVACGGSWFVEKKLIQSNN------------------
1vm6A3          ----------------------------------------------------------------------
1spxA           LHATPDFPYYSIAKAAIDQYTRNTAIDLIQHGIRVNSISPGLVATGF-----------------------
1di6A           RKQALILNLPGQPKSIKETLEGVKDAEGNVVVHGIFASVPYCI---------------------------
1vlwA           GGVNLDDEVREKAKAFVEKIRG------------------------------------------------
2zqnA1          GPTAVNQLWYTDQQGVIRSKLNDFAIDASHEQIETQPFDPNNPKRAWIVSG-------------------
1i24A           EYGTPNIDIEEGYITITHNGRTDTL---------------------------------------------
1e1cA2          ----------------------------------------------------------------------
1gu7A2          --LKNNKELKTSTLNQIIAWYE------------------------------------------------
1pjqA1          ----------------------------------------------------------------------
1u9jA           GPVNKPRWIYSVSKQLLDRVIWAYGEKEGLQFTLFRPFNWMGPRLDNLNA--------------------
1h2iA           SLEKARKEAVTDGLKRLRSFGNALGNCILD-KDYLRSLNKLPRQLPLEVDLTK-----------------
2fr0A1          AFGAPGLGGYAPGNAYLDGLAQQRRSDGLPATAVAWGTWAGSGMAEGPVA--------------------
1a9yA           FPTGTPQSPFGKSKLMVEQILTDLQKAQP--DWSIALLRYFNP---------------------------
1ujmA           PKPNVEGIYLDEKSWNL-----------------------------------------------------
1rkxA           NEAMGGYDPYSNSKGCAELVTSSYRNSFFNPANYGQHGTAVAT---------------------------
1npdA1          WQGAEQFTLWTGKDFPLEYVK-------------------------------------------------
1adeA           LGPRYVDYVLGILKAYSTRVG-------------------------------------------------
2bgkA1          TAGEGVSHVYTATKHAVLGLTTSLCTELGEYGIRVNCVSPYIVASPLLTD--------------------
1gefA           ----------------------------------------------------------------------
1yo6A1          SITDNTSGSAQMSKAAINMFGRTLAVDLKDDNVLVVNFCPGWVEQSTAE-LISSFNKLD------NSHNG
1ftrA1          ----------------------------------------------------------------------
1bw3A           ----------------------------------------------------------------------
1qycA           AI--------------------------------------------------------------------
1sb8A           DHPGKPLSPYAVTKYVNELYADVFS---RCYGFSTIGLRYFNV---------------------------
1qorA2          YITTREELTEASNELFSSGV--------------------------------------------------
1hdoA           LWDPTKVPPRLQAVTDDHIR---MHKVLRESGLKYVAVMPPHIGDQPLTGAYTVTLD-------------
2hjsA1          ----------------------------------------------------------------------
1cjcA1          ----------------------------------------------------------------------
1o5iA           ISPIENLYTSNSARMALTGFLKTLSFEVAPYGITVNCVAPGWTETERVKE--------------------
1edzA1          ----------------------------------------------------------------------
2a35A1          GADAKSSIFYNRVKGELEQALQEQG--WPQLTIARPSLLFGPREEFRLAEILAAPIAGKY----------
1b6rA2          ----------------------------------------------------------------------
1xseA           KITYPLIAPYSASKFALDGFFSTLRSEFLVNNVSITLCILGLIDTETAIKATSGI---------------
1d0iA           VVAGCGVQGYVFGVERIAAL--------------------------------------------------
1lsuA           V---------------------------------------------------------------------
1k6iA           LYGPWPAVPMWAPKFTVE---NYVRQLGLPSTFVYAGIYNNN----------------------------
1vl0A           EAKEPIQSAYGKTKLEGENF---VKALNPKYYIVRTAWLYGDGNN-FVKTXINLGKTHDELKVVHDQVGT
1bncA2          ----------------------------------------------------------------------
1p9oA           ----------------------------------------------------------------------
1bvrA           SRAMPAYNWMTVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTLAMSAIVGG-ALGEEAGAQIQLLEE
1a9xA3          ----------------------------------------------------------------------
1xq6A           ----------------------------------------------------------------------
1yxmA1          KAGFPLAVHSGAARAGVYNLTKSLALEWACSGIRINCVAPGVIYSQT-----------------------
1e3jA2          ----------------------------------------------------------------------
2bd0A1          TKAFRHSSIYCMSKFGQRGLVETMRLYARKCNVRITDVQPGAVYTPMWGK--------------------
1bxkA           ----------------------------------------------------------------------
1a71A2          ----------------------------------------------------------------------
2gdtA1          ----------------------------------------------------------------------
1bg6A2          ----------------------------------------------------------------------
2bkaA1          ----------------------------------------------------------------------
2b69A1          ----------------------------------------------------------------------
1aorA1          ----------------------------------------------------------------------
1o89A2          ----------------------------------------------------------------------
2nacA1          ----------------------------------------------------------------------
1gdhA1          ----------------------------------------------------------------------
1db3A           ----------------------------------------------------------------------
1ks9A2          ----------------------------------------------------------------------
1e0dA1          ----------------------------------------------------------------------
1psdA1          ----------------------------------------------------------------------
2f1kA2          ----------------------------------------------------------------------
1a2zA           ----------------------------------------------------------------------
1jztA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           KILARQHKKVPFNEPAISVAKVVEKIINCDKPKPRYYITKATWIMTSLKRILPTxxxxxxxxxx
1a27A           YQYLAHSKQVFREAAPEEVAEVFLTALRAPKPTLRYFTTERFLPLLRMRLDDPS----------
1pwxA           ----------------------------------------------------------------
1bdbA           ----------------------------------------------------------------
1yb1A           ----------PTLEPEEVVNRLMHGIL---TEQKMIFIPSSIAFLTTLERIL------------
1xg5A           ----------------------------------------------------------------
1fjhA           ----------------------------------------------------------------
1nasA           ----------------------------------------------------------------
1c14A           ----------------------------------------------------------------
1u7uA           ----------------------------------------------------------------
1lu9A1          ----------------------------------------------------------------
1nytA1          ----------------------------------------------------------------
1n5dA           EQRAGDKILLNACCP-------------------------------------------------
2c54A1          MWGDGLQTRSFTFIDECVEGVL--RLTKSDFREPVNIGSDEMVSMNEMAEMV------------
1ae1A           ----------------------------------------------------------------
2gdzA1          ----------------------------------------------------------------
2ib0A1          ----------------------------------------------------------------
1jr2A           ----------------------------------------------------------------
1ahhA           ----------------------------------------------------------------
1zemA1          QMIGS-----------------------------------------------------------
1qp8A1          ----------------------------------------------------------------
2ag5A1          ----------------------------------------------------------------
1snyA           ----------------------------------------------------------------
1x74A1          ----------------------------------------------------------------
1c3vA1          ----------------------------------------------------------------
1w6uA           ----------------------------------------------------------------
1e5lA2          DIGFLSDEEQPFLKEAIPWKEATQKIVKASSAS-EQDIVSTIVSNATFES--------------
1zbqA1          ----------------------------------------------------------------
1h5qA           ----------------------------------------------------------------
2joeA1          ----------------------------------------------------------------
1b8pA1          ----------------------------------------------------------------
1dohA           ----------------------------------------------------------------
1a4iA1          ----------------------------------------------------------------
1dhrA           ----------------------------------------------------------------
1vhcA           ----------------------------------------------------------------
1vm6A3          ----------------------------------------------------------------
1spxA           ----------------------------------------------------------------
1di6A           ----------------------------------------------------------------
1vlwA           ----------------------------------------------------------------
2zqnA1          ----------------------------------------------------------------
1i24A           ----------------------------------------------------------------
1e1cA2          ----------------------------------------------------------------
1gu7A2          ----------------------------------------------------------------
1pjqA1          ----------------------------------------------------------------
1u9jA           ----------------------------------------------------------------
1h2iA           ----------------------------------------------------------------
2fr0A1          ----------------------------------------------------------------
1a9yA           ----------------------------------------------------------------
1ujmA           ----------------------------------------------------------------
1rkxA           ----------------------------------------------------------------
1npdA1          ----------------------------------------------------------------
1adeA           ----------------------------------------------------------------
2bgkA1          ----------------------------------------------------------------
1gefA           ----------------------------------------------------------------
1yo6A1          RFFMRNLKPYEF----------------------------------------------------
1ftrA1          ----------------------------------------------------------------
1bw3A           ----------------------------------------------------------------
1qycA           ----------------------------------------------------------------
1sb8A           ----------------------------------------------------------------
1qorA2          ----------------------------------------------------------------
1hdoA           ----------------------------------------------------------------
2hjsA1          ----------------------------------------------------------------
1cjcA1          ----------------------------------------------------------------
1o5iA           ----------------------------------------------------------------
1edzA1          ----------------------------------------------------------------
2a35A1          ----------------------------------------------------------------
1b6rA2          ----------------------------------------------------------------
1xseA           ----------------------------------------------------------------
1d0iA           ----------------------------------------------------------------
1lsuA           ----------------------------------------------------------------
1k6iA           ----------------------------------------------------------------
1vl0A           PTLARVVLKV------------------------------------------------------
1bncA2          ----------------------------------------------------------------
1p9oA           ----------------------------------------------------------------
1bvrA           GWDQRAPIGWNMKDAT-PVAKTVCALLSDWLP----ATTGDIIYA-------------------
1a9xA3          ----------------------------------------------------------------
1xq6A           ----------------------------------------------------------------
1yxmA1          ----------------------------------------------------------------
1e3jA2          ----------------------------------------------------------------
2bd0A1          ----------------------------------------------------------------
1bxkA           ----------------------------------------------------------------
1a71A2          ----------------------------------------------------------------
2gdtA1          ----------------------------------------------------------------
1bg6A2          ----------------------------------------------------------------
2bkaA1          ----------------------------------------------------------------
2b69A1          ----------------------------------------------------------------
1aorA1          ----------------------------------------------------------------
1o89A2          ----------------------------------------------------------------
2nacA1          ----------------------------------------------------------------
1gdhA1          ----------------------------------------------------------------
1db3A           ----------------------------------------------------------------
1ks9A2          ----------------------------------------------------------------
1e0dA1          ----------------------------------------------------------------
1psdA1          ----------------------------------------------------------------
2f1kA2          ----------------------------------------------------------------
1a2zA           ----------------------------------------------------------------
1jztA           ----------------------------------------------------------------