[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for ftul2:ACD30379.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1sg2A.bssp"
#ERROR : Can't open dsspfile "1u2mA.bssp"

## Summary of PDB Search
:167
    2e-13  24%  1sg2A  [f.48.1.1] SEVENTEEN KILODALTON PROTEIN
    6e-08  15%  1u2mA  [f.48.1.1] HISTONE-LIKE PROTEIN HLP-1
:167

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxTKIAVVNPVEIFNDSDLGSVSVKKLENDLKPDATKLKQEQDNIMQQMKT
1sg2A           ---------------------DKIAIVNMGSLFQQVAQKTGVSNTLENEFKGRASELQRMETDLQAKMKK
1u2mA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           LQDNSATMTKSELDKKXXXXXXXXXNFAEKARILQQKEYTAKDKLSKKFQASFDKAVQTIAKQKNYNVVL
1sg2A           LQ---SMKAGSDRTKLEKDVMAQRQTFAQKAQAFEQDRARRSNEERGKLVTRIQTAVKSVANSQDIDLVV
1u2mA           ----------ADKIAIVNXGSLFQQVAQKTGVSNTLERARRSNEERGKLVTRIQTAVKSVANSQDIDLVV


                         +         .         .         .         .         *         .:210
query           TTQALAYVNNVDDISSQVVELMxxxxx
1sg2A           DANAAYNSSDVKDITADVLKQV-----
1u2mA           DANAVANSSDVKDITADVLKQV-----