[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for ftul2:ACD30394.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1o0wA1.bssp"
#ERROR : Can't open dsspfile "1i4sA.bssp"
#ERROR : Can't open dsspfile "1iv7A.bssp"
#ERROR : Can't open dsspfile "1whnA.bssp"
#ERROR : Can't open dsspfile "1uilA.bssp"
#ERROR : Can't open dsspfile "1whqA.bssp"
#ERROR : Can't open dsspfile "1uhzA.bssp"
#ERROR : Can't open dsspfile "2dixA1.bssp"
#ERROR : Can't open dsspfile "1o0wA2.bssp"
#ERROR : Can't open dsspfile "1di2A.bssp"
#ERROR : Can't open dsspfile "1ekzA.bssp"
#ERROR : Can't open dsspfile "2dmyA1.bssp"
#ERROR : Can't open dsspfile "1qu6A2.bssp"
#ERROR : Can't open dsspfile "1qu6A1.bssp"

## Summary of PDB Search
:230
    6e-39  36%  1o0wA1 [a.149.1.1] RIBONUCLEASE III A:-1 -- 167
    3e-35  38%  1i4sA  [a.149.1.1] RIBONUCLEASE III
    1e-20  14%  1iv7A  [d.17.1.1] MONELLIN
    3e-14  17%  1whnA  [d.50.1.1] HYPOTHETICAL PROTEIN RIKEN CDNA 2310016K04
    4e-12  17%  1uilA  [d.50.1.1] DOUBLE-STRANDED RNA-BINDING MOTIF
    4e-12  19%  1whqA  [d.50.1.1] RNA HELICASE A
    2e-10  14%  1uhzA  [d.50.1.1] STAUFEN (RNA BINDING PROTEIN) HOMOLOG 2
    2e-10  28%  2dixA1 [d.50.1.1] INTERFERON-INDUCIBLE DOUBLE STRANDED RNA- A:7 --
    2e-10  28%  1o0wA2 [d.50.1.1] RIBONUCLEASE III A:168 -- 236
    7e-10  29%  1di2A  [d.50.1.1] DOUBLE STRANDED RNA BINDING PROTEIN A
    3e-09  21%  1ekzA  [d.50.1.1] MATERNAL EFFECT PROTEIN (STAUFEN)
    1e-08  20%  2dmyA1 [d.50.1.1] SPERMATID PERINUCLEAR RNA-BINDING PROTEIN A:8 --
    1e-08  11%  1qu6A2 [d.50.1.1] PROTEIN KINASE PKR A:91 -- 179
    3e-08  18%  1qu6A1 [d.50.1.1] PROTEIN KINASE PKR A:1 -- 90
:230

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxSRFYNILGYNFKDYTLLIRALTHRSKTKKNYERLEFLGDSVLSFVIAEVLYKQFTDLAEGKLSQL
1o0wA1          -----EEFQKETGINFKNEELLFRALCHSSKDVESNEKLEFLGDAVLELFVCEILYKKYPEAEVGDLARV
1i4sA           ------QLEKKLGYTFKDKSLLEKALTHVSYSKKHYETLEFLGDALVNFFIVDLLVQYSPNKREGFLSPL
1iv7A           ----------------------------------------------------------------------
1whnA           ----------------------------------------------------------------------
1uilA           ----------------------------------------------------------------------
1whqA           ----------------------------------------------------------------------
1uhzA           ----------------------------------------------------------------------
2dixA1          ----------------------------------------------------------------------
1o0wA2          ----------------------------------------------------------------------
1di2A           ----------------------------------------------------------------------
1ekzA           ----------------------------------------------------------------------
2dmyA1          ----------------------------------------------------------------------
1qu6A2          ----------------------------------------------------------------------
1qu6A1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           RSKLVKGTTLAQLASSLKMDEYIILGASEQGGHKREKILEDVFEAVIGAIYLDSDFATVKKVILKWYQPI
1o0wA1          KSAAASEEVLAMVSRKMNLGKFLFLGKGETGGRDRDSILADAFEALLAAIYLDQGYEKIKELFEQEFEFY
1i4sA           KAYLISEEFFNLLAQKLELHKFIRIK----RGKINETIIGDVFEALWAAVYIDSDANFTRELFYKLFKED
1iv7A           --------IIDIGPFTQNLGKFAVDEENKIGQYGRLTFNKVIRPCMKKTIYENEGFREIKGYEYQLYVYA
1whnA           --------------------------------------------------------------IIKMAIRF
1uilA           --------------------------------------------------------------------DL
1whqA           ----------------------------------------------------------------------
1uhzA           ----------------------------------------------------------------------
2dixA1          ----------------------------------------------------------------------
1o0wA2          ----------------------------------------------------------------------
1di2A           ----------------------------------------------------------------------
1ekzA           ----------------------------------------------------------------------
2dmyA1          ----------------------------------------------------------------------
1qu6A2          ---------------------------------------------------------------------T
1qu6A1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           ISSINLDTIKVKDSKSKLQEILLQNALSLPEYSIETIDGKDHEQQFTVVAVSKDLNLRVKAQGTSRKKAE
1o0wA1          IEKIMKG---------------------------------------------------------------
1i4sA           ILSAIKE---------------------------------------------------------------
1iv7A           SDKLFRADIS-EDYKTRGRKLLRFNGPVPP----------------------------------------
1whnA           DRRAYPPQ---ITPKMCLLEWCRREKLPQPVYETV---QRTIDRMFCSVVTVAEQKYQSTLWDKSKKLAE
1uilA           NAGLHGNW-TLENAKARLNQYFQKEKIQGEYKYTQV--GPDHNRSFIAEMTIYIKQLGAREHGSNKKLAA
1whqA           -----------SGIKNFLYAWCGKRKMT-PAYEIRAV-GNKNRQKFMCEVRVEGFNYAGMGNSTNKKDAQ
1uhzA           -----------SGPISRLAQIQQARKEKEPDYILLSERGMPRRREFVMQVKVGNEVATGTQLGYKASTSL
2dixA1          -----------KTPIQVLHEYGMKTKNI-PVYECERSDVQIHVPTFTFRVTVGDIT--CTGEGTSKKLAK
1o0wA2          ------------DYKTALQEIVQSEHKVPPEYILVRTEKNDGDRIFVVEVRVNGKTIA-TGKGRTKKEAE
1di2A           --------------VGSLQELAVQKGWRLPEYTVAQESGPPHKREFTITCRVET--FVETGSGTSKQVAK
1ekzA           -----MDEGDKKSPISQVHEIGIKRNMT-VHFKVLREEGPAHMKNFITACIVG--SIVTEGEGNGKKVSK
2dmyA1          -----------IDLMNALMRLNQIR--PGLQYKLLSQSGPVHAPVFTMSVDVDGT--TYEASGPSKKTAK
1qu6A2          TTNSSEG-LSMGNYIGLINRIAQKKRLTVNYEQCAS--GVHGPEGFHYKCKMGQKEYS-IGTGSTKQEAK
1qu6A1          --------LSAGFFMEELNTYRQKQGV-VLKYQELPNSGPPHDRRFTFQVIIDGREFPE-GEGRSKKEAK


                         .         .         .         +         .         .         .:280
query           QKTAEKMIEMLSQQGLHEKK
1o0wA1          --------------------
1i4sA           --------------------
1iv7A           --------------------
1whnA           QTAAIVCLRSQGLPEGRLGE
1uilA           QSCALSLVRQLYHLGVIEAY
1whqA           SNAARDFVNYLVRIN-----
1uhzA           QDSGPS--------------
2dixA1          HRAAEAAINILKANA-----
1o0wA2          KEAARIAYEKL---------
1di2A           RVAAEKLLTKF---------
1ekzA           KRAAEKMLVEL---------
2dmyA1          LHVAVKVLQAMGYPT-----
1qu6A2          QLAAK---------------
1qu6A1          NAAAKLAVEILNKE------