[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for ftul2:ACD30441.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1d2rA.bssp"
#ERROR : Can't open dsspfile "1o5tA.bssp"
#ERROR : Can't open dsspfile "1h3eA1.bssp"
#ERROR : Can't open dsspfile "1j1uA.bssp"
#ERROR : Can't open dsspfile "1nzjA.bssp"
#ERROR : Can't open dsspfile "1a8hA2.bssp"
#ERROR : Can't open dsspfile "1iq0A2.bssp"
#ERROR : Can't open dsspfile "1jiiA.bssp"

## Summary of PDB Search
:334
    2e-34  32%  1d2rA  [c.26.1.1] PROTEIN (TRYPTOPHANYL TRNA SYNTHETASE)
    9e-34  23%  1o5tA  [c.26.1.1] TRYPTOPHANYL-TRNA SYNTHETASE
    3e-31  22%  1h3eA1 [c.26.1.1] TYROSYL-TRNA SYNTHETASE A:6 -- 351
    2e-25  16%  1j1uA  [c.26.1.1] TYROSYL-TRNA SYNTHETASE
    7e-06  18%  1nzjA  [c.26.1.1] HYPOTHETICAL PROTEIN YADB
    5e-05  12%  1a8hA2 [c.26.1.1] METHIONYL-TRNA SYNTHETASE A:1 -- 348
    7e-05   6%  1iq0A2 [c.26.1.1] ARGINYL-TRNA SYNTHETASE A:97 -- 466
    2e-04  22%  1jiiA  [c.26.1.1] TYROSYL-TRNA SYNTHETASE
:334

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSQKIILTGVTPSGTPHLGNYIGAIKPAIEMIKNDQYKCMYFIADQHSLIKLWDKKLRQQYIYEIAASWL
1d2rA           ---KTIFSGIQPSGVITIGNYIGALRQFVELQ--HEYNCYFCIVDQHAITVWQDPHELRQNIRRLAALYL
1o5tA           ----YLYTGRGPSSEAHVGHLIPFIFT-KWLQDVFNVPLVIQMTDDE---KYLWKDLTYSYAVENAKDII
1h3eA1          ---TVKLGADPTRPDLHLGHAVVLRK--MRQFQELGHKVVLIIGDFTGMIPPLTLEETRENAKTYVAQAK
1j1uA           ----SAYIGFEPSGKIHLGHYLQIKKMIDLQNAG--FDIIILLADLHAYLNQGELDEIRKIGDYNKKVFE
1nzjA           ----------SPSGELHFGSLIAALGSYLQARARQGR-WLVRIEDID------PPREVPGAAETILRQLE
1a8hA2          MEKVFYVTTPIYYVNPHLGHAYTTVADFLARWHRLDGYRTFTVYRAAQAAGEDPKAFVDRVSGRFKRAWD
1iq0A2          --GVVLVESVNPNKELHVGHLRNIAGRQAAETLFALRHYGLTWDGKEKYDHFAGRAYVRLHQDPEYERLQ
1jiiA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           ALGLDPDKAYFYRQSDIPEIMELTWIISTTTAKGLLNRAHAYKALVDQNLQEENADPDKGITMGLFNYPV
1d2rA           AVGIDPTQATLFIQSEVPAHAQAAWMLQCIVYIGELERMTQFK---------EKSAGAAAAAAGLLTYPP
1o5tA           ACGFDINKTFIF--SDLDYMGMSSGFYKNVVKIQKHVTFNQVKGIFGFT---------DSDCIGKISFPA
1h3eA1          ILRQEPHLFELRYNSEWLEGLTFKEVVSLMTVAQMLEREDFKKRY----------EAGIPISLHELLYPF
1j1uA           AMGLKAKYVYGSEFQLDKDYTLNVYRLALKTTLKRARRSMELI----------AREDE-NPKVAEVIYPI
1nzjA           HYGLHWDGDVLWQSQRHDAYREA--------LAWLHEQGLSYYC--------------------------
1a8hA2          LLGIAYDDFIRTTEERHKKVVQL-------VLKKVYEAGDIYYGEYEGL---------------------
1iq0A2          PAIEEVLHALERGELR-EEVNRILLAQ-------------------------------------------
1jiiA           ---------------------------------------------------------EHGISYTEFTYTI


                         +         .         .         .         .         *         .:210
query           LMAADILIFDADLVPVGKDQIQHIEIARDIANRFNHIYQKPVLKAPQALTSEDSQTILGLDGRKMSKSYD
1d2rA           LMAADILLYNTDIVPVGEDQKQHIELTRDLAERFNKRYGEFTIPEARIPKVGARIMSLVDPTKKMSKSDP
1o5tA           IQAAPSFIFRDRLIPCAIDQDPYFRMTRDVAPRIG--YPKPALL--------HSTFFPALQGTKMSASPN
1h3eA1          AQAYDSVAIRADVEMGGTDQRFNLLVGREVQRAYGQSPQ-VCFLMP---------LLVGLDGRKMSKSLD
1j1uA           MQVNDIHYLGVDVAVGGMEQRKIHMLARELLPKKVVCIHNPVLTGLDGEGNFIAVDD--SPEEIRAKIKK
1nzjA           ----------------------------------------------------------------------
1a8hA2          ----------------------------------------------------------------------
1iq0A2          ----------------------------------------------------------------------
1jiiA           LQAIDFGHLNCKIQVGGSDQWGNITSGIELMRRMYGQTDAYGLTIP---------LVTKSDGKKFGKSES


                         .         .         .         +         .         .         .:280
query           NTIAIFSMEKKLRKQVMKIITNSQMPEEKKDPNNCTIFAIYKSIASQTEIAALEEKYLAGGLGWGDAKQI
1d2rA           NYITLLDDAKTIEKKIKSAVTDSEGTIRYDKEAKPGISNLLNIYSSGQSIEELERQY--EGKGYGVFKAD
1o5tA           SSIFLTDTAKQIKTKVNKHAFSGGRDEHRQFGGNCDVDVSFMFLEDDDKLEQIRKDYTSGAMLTGELKKA
1h3eA1          NYIGLTEPPEAMFKKLMR-VPDPLLPKAGPVPAHRVLARLLTAAYALPQIPIDRAFYESLGYAWEAFGRD
1j1uA           AYCPAGVVEGNPIMEIAKY-----FLEYPLTIKR---PEKFGGDLTVNSYEELESLFKNKELHPMDLKNA
1nzjA           ----------------------------------------------------------------------
1a8hA2          ----------------------------------------------------------------------
1iq0A2          ----------------------------------------------------------------------
1jiiA           GAVWLYEFYQFWINQ---------------SDEDVIKFLKYFTFLGKEEIDRLEQS-KNEAPHLREAQKT


                         .         *         .         .         .         .         +:350
query           LFEKINEYLRDAREKYDYYINNPKIVDDILNQGAAKVRPLAKDKLKEVKDIIGM
1d2rA           LAQVVIETLRPIQERYHHWMESEE-LDRVLDEGAEKANRVASEMVRKMEQAMGL
1o5tA           LIEVLQPLIAEHQARR------KEVTDEIV------------------------
1h3eA1          K-EAGPEEVRRAEARYD-------------------------------------
1j1uA           VAEELIKILEPIRKRL--------------------------------------
1nzjA           ------------------------------------------------------
1a8hA2          ------------------------------------------------------
1iq0A2          ------------------------------------------------------
1jiiA           LAEEV-------------------------------------------------