[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for ftul2:ACD30480.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1fnnA1.bssp"
#ERROR : Can't open dsspfile "1r1uA.bssp"
#ERROR : Can't open dsspfile "1ulyA.bssp"
#ERROR : Can't open dsspfile "1z05A1.bssp"
#ERROR : Can't open dsspfile "1lvaA3.bssp"
#ERROR : Can't open dsspfile "2hs5A1.bssp"
#ERROR : Can't open dsspfile "2jn6A1.bssp"
#ERROR : Can't open dsspfile "2h6bA1.bssp"
#ERROR : Can't open dsspfile "2b0lA1.bssp"
#ERROR : Can't open dsspfile "2hoeA1.bssp"
#ERROR : Can't open dsspfile "2p4wA1.bssp"
#ERROR : Can't open dsspfile "1cgpA1.bssp"
#ERROR : Can't open dsspfile "1mzbA.bssp"
#ERROR : Can't open dsspfile "1wi9A.bssp"
#ERROR : Can't open dsspfile "1z6rA1.bssp"
#ERROR : Can't open dsspfile "1r1tA.bssp"
#ERROR : Can't open dsspfile "1qbjA.bssp"
#ERROR : Can't open dsspfile "1fp2A1.bssp"
#ERROR : Can't open dsspfile "2gauA1.bssp"
#ERROR : Can't open dsspfile "1ft9A1.bssp"
#ERROR : Can't open dsspfile "2cohA1.bssp"
#ERROR : Can't open dsspfile "1q1hA.bssp"
#ERROR : Can't open dsspfile "1oyiA.bssp"
#ERROR : Can't open dsspfile "1biaA1.bssp"
#ERROR : Can't open dsspfile "2g9wA1.bssp"
#ERROR : Can't open dsspfile "2htjA1.bssp"
#ERROR : Can't open dsspfile "1mkmA1.bssp"
#ERROR : Can't open dsspfile "1p6rA.bssp"
#ERROR : Can't open dsspfile "1u2wA1.bssp"
#ERROR : Can't open dsspfile "2oa4A1.bssp"
#ERROR : Can't open dsspfile "2co5A1.bssp"
#ERROR : Can't open dsspfile "2fnaA1.bssp"
#ERROR : Can't open dsspfile "1v4rA1.bssp"
#ERROR : Can't open dsspfile "2f2eA1.bssp"
#ERROR : Can't open dsspfile "1y0uA.bssp"
#ERROR : Can't open dsspfile "2d1hA1.bssp"
#ERROR : Can't open dsspfile "1ub9A.bssp"
#ERROR : Can't open dsspfile "1sfuA.bssp"
#ERROR : Can't open dsspfile "1zybA1.bssp"
#ERROR : Can't open dsspfile "1xcbA1.bssp"
#ERROR : Can't open dsspfile "1xmkA1.bssp"
#ERROR : Can't open dsspfile "1tqiA1.bssp"
#ERROR : Can't open dsspfile "2eshA1.bssp"
#ERROR : Can't open dsspfile "2a61A1.bssp"

## Summary of PDB Search
:121
    1e-12  14%  1fnnA1 [a.4.5.11] CELL DIVISION CONTROL PROTEIN 6 A:277 -- 388
    3e-11  24%  1r1uA  [a.4.5.5] REPRESSOR PROTEIN
    2e-10  15%  1ulyA  [a.4.5.58] HYPOTHETICAL PROTEIN PH1932
    2e-09  19%  1z05A1 [a.4.5.63] TRANSCRIPTIONAL REGULATOR, ROK FAMILY A:10 --
    3e-09  18%  1lvaA3 [a.4.5.35] SELENOCYSTEINE-SPECIFIC ELONGATION FACTOR A:511
    1e-08  10%  2hs5A1 [a.4.5.6] PUTATIVE TRANSCRIPTIONAL REGULATOR GNTR A:25 --
    1e-08  10%  2jn6A1 [a.4.1.19] PROTEIN CGL2762 A:1 -- 89
    2e-08  20%  2h6bA1 [a.4.5.4] CHLOROPHENOL REDUCTION GENE K A:148 -- 229
    3e-08  13%  2b0lA1 [a.4.5.66] GTP-SENSING TRANSCRIPTIONAL PLEIOTROPIC A:167
    1e-07  23%  2hoeA1 [a.4.5.63] N-ACETYLGLUCOSAMINE KINASE A:10 -- 71
    1e-07  24%  2p4wA1 [a.4.5.64] TRANSCRIPTIONAL REGULATORY PROTEIN ARSR FAMILY
    1e-07  12%  1cgpA1 [a.4.5.4] PROTEIN (CATABOLITE GENE ACTIVATOR PROTEIN (CAP)
    2e-07  11%  1mzbA  [a.4.5.42] FERRIC UPTAKE REGULATION PROTEIN
    4e-07  16%  1wi9A  [a.4.5.47] PROTEIN C20ORF116 HOMOLOG
    5e-07  12%  1z6rA1 [a.4.5.63] MLC PROTEIN A:12 -- 81
    6e-07  34%  1r1tA  [a.4.5.5] TRANSCRIPTIONAL REPRESSOR SMTB
    6e-07  14%  1qbjA  [a.4.5.19] PROTEIN (DOUBLE-STRANDED RNA SPECIFIC ADENOSINE
    7e-07  19%  1fp2A1 [a.4.5.29] ISOFLAVONE O-METHYTRANSFERASE A:8 -- 108
    7e-07  10%  2gauA1 [a.4.5.4] TRANSCRIPTIONAL REGULATOR, CRP/FNR FAMILY A:152
    1e-06  15%  1ft9A1 [a.4.5.4] CARBON MONOXIDE OXIDATION SYSTEM TRANSCRIPTION
    1e-06  15%  2cohA1 [a.4.5.4] TRANSCRIPTIONAL REGULATOR A:118 -- 199
    2e-06  21%  1q1hA  [a.4.5.41] TRANSCRIPTION FACTOR E
    3e-06  13%  1oyiA  [a.4.5.19] DOUBLE-STRANDED RNA-BINDING PROTEIN
    4e-06  13%  1biaA1 [a.4.5.1] BIRA BIFUNCTIONAL PROTEIN A:1 -- 63
    4e-06  16%  2g9wA1 [a.4.5.39] CONSERVED HYPOTHETICAL PROTEIN A:3 -- 124
    6e-06  16%  2htjA1 [a.4.5.73] P FIMBRIAL REGULATORY PROTEIN KS71A A:1 -- 73
    1e-05  23%  1mkmA1 [a.4.5.33] ICLR TRANSCRIPTIONAL REGULATOR A:1 -- 75
    2e-05  18%  1p6rA  [a.4.5.39] PENICILLINASE REPRESSOR
    2e-05  28%  1u2wA1 [a.4.5.5] CADMIUM EFFLUX SYSTEM ACCESSORY PROTEIN A:12 --
    3e-05  10%  2oa4A1 [a.4.12.3] SIR5 A:1 -- 93
    3e-05  14%  2co5A1 [a.4.5.48] VIRAL PROTEIN F93 A:5 -- 93
    3e-05  13%  2fnaA1 [a.4.5.11] CONSERVED HYPOTHETICAL PROTEIN A:284 -- 356
    3e-05  17%  1v4rA1 [a.4.5.6] TRANSCRIPTIONAL REPRESSOR A:1 -- 100
    4e-05  14%  2f2eA1 [a.4.5.69] PA1607 A:5 -- 146
    4e-05  17%  1y0uA  [a.4.5.5] ARSENICAL RESISTANCE OPERON REPRESSOR, PUTATIVE
    4e-05  27%  2d1hA1 [a.4.5.50] 109AA LONG HYPOTHETICAL TRANSCRIPTIONAL A:1 --
    6e-05  20%  1ub9A  [a.4.5.28] HYPOTHETICAL PROTEIN PH1061
    9e-05  11%  1sfuA  [a.4.5.19] 34L PROTEIN
    2e-04  17%  1zybA1 [a.4.5.4] TRANSCRIPTION REGULATOR, CRP FAMILY A:148 -- 220
    3e-04  16%  1xcbA1 [a.4.5.38] REDOX-SENSING TRANSCRIPTIONAL REPRESSOR REX A:4
    4e-04  15%  1xmkA1 [a.4.5.19] DOUBLE-STRANDED RNA-SPECIFIC ADENOSINE
    5e-04  15%  1tqiA1 [a.4.5.56] CONSERVED HYPOTHETICAL PROTEIN A:1 -- 90
    6e-04  14%  2eshA1 [a.4.5.61] CONSERVED HYPOTHETICAL PROTEIN TM0937 A:4 --
    0.001  19%  2a61A1 [a.4.5.28] TRANSCRIPTIONAL REGULATOR TM0710 A:5 -- 143
:121

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKLANIVDFQKALGDETRIRILMVIYQHQLCLCHLAHIFKLANSTLSKHLDILRRNGFIHKRKQGRFHYF
1fnnA1          -KLFLLAIVRSLKISHTPYITFGDAEESYKIVCEEYGERPRVHSQLWSYLNDLREKGIVETRQNTTLISI
1r1uA           -TLERVTEIFKALGDYNRIRIMELLSVSEASVGHISHQLNLSQSNVSHQLKLLKSVHLVKAKRQGQSMIY
1ulyA           VKVITDPEVIKVXLEDTRRKILKLLRNKEXTISQLSEILGKTPQTIYHHIEKLKEAGLVEVKRTEXKGNL
1z05A1          -----------HIKQINAGRVYKLIDQKGISRIDLSKESELAPASITKITRELIDAHLIHETTVQE-AIS
1lvaA3          ----------SETQKKLLKDLEDKYRVSRPSFKEVAGSFNLDPSELEELLHYLVREGVLVKINDEFY---
2hs5A1          ----------TRVAGILRDAIIDGTFRPRLSEPDICAALDVSRNTVREAFQILIEDRLVAHELNRGVFV-
2jn6A1          ----------KTYSEEFKRDAVALYENSDASLQQIANDLGINRVTLKNWIIKYGSNHNVQGTTPSAAVSE
2h6bA1          -----ILRLFYELCSSQGKRVGDTYEITPLSQKSIGEITGVHHVTVSRVLACLKRENILDKKKNKIIVY-
2b0lA1          ----------YSELEAIEHIFEELDGNEGLVASKIADRVGITRSVIVNALRKLESAGVIESRSLGMKGTY
2hoeA1          ------------------SRILKRIXKSPVSRVELAEELGLTKTTVGEIAKIFLEKGIVVEEKDSP----
2p4wA1          -----LNRLLDVLGNETRRRILFLLTKRPYFVSELSRELGVGQKAVLEHLRILEEAGLIESRVEKIPRGR
1cgpA1          ----------LNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTI----
1mzbA           MVENSELRKAGLKVTLPRVKILQMLDSADVYKALMEAGEDVGLATVYRVLTQFEAAGLVRHNFDGGHAVF
1wi9A           --------------SGFLTEFINYIKKSKVLLEDLAFQMGLRTQDAINRIQDLLTEGTLTGVIDDRGKFI
1z6rA1          ------------IKQTNAGAVYRLIDQLGVSRIDLSRLAQLAPASITKIVHEXLEAHLVQEL--------
1r1tA           ----------AVLADPNRLRLLSLLARSELCVGDLAQAIGVSESAVSHQLRSLRNLRLVSYRKQGR----
1qbjA           ------------IYQDQEQRILKFLEELGTTAHDLSGKLGTPKKEINRVLYSLAKKGKLQKEAGTPPLW-
1fp2A1          YKHIYAFIDSMSLKWAVEMNIPNIIQNHGISLSNLVSILQVKIGNVRRLMRYLAHNGFFEIITKEEESY-
2gauA1          -----LAETLLILKENFGFENDGATLSIYLSREELATLSNMTVSNAIRTLSTFVSERMLALDGKR-----
1ft9A1          ----------GFFIDHANTTGRQTGVIVSFTVEEIANLIGSSRQTTSTALNSLIKEGYISRQGRGHYTI-
2cohA1          ----------LELSETPLAHEEEGKVVLKATHDELAAAVGSVRETVTKVIGELAREGYIRSGYGKIQLL-
1q1hA           ----NAEDLFINLAKSLLIDVLRILLGTEMTDEEIANQLNIKVNDVRKKLNLLEEQGFVSYRKTRSGWFI
1oyiA           ---------------SNAEIVCEAIKTIGATAAQLTRQLNMEKREVNKALYDLQRSAMVYSSDDIPPRWF
1biaA1          --------------NTVPLKLIALLANGEHSGEQLGETLGMSRAAINKHIQTLRDWGVDVFTVPGK----
2g9wA1          --------------GDLERAVXDHLWSRTEPQTALSARRDLAYTTVXAVLQRLAKKNLVLQIRAHR--YA
2htjA1          -----------------KNEILEFLNRHNGKTAEIAEALAVTDYQARYYLLLLEKAGMVQRSPLRR----
1mkmA1          ---------------KKAFEILDFIVKNPVSVSEIAEKFNMSVSNAYKYMVVLEEKGFVLRKKDKRYV--
1p6rA           --------------SDAELEVMKVIWKHSEVIKELSKTSTWSPKTIQTMLLRLIKKGALNHHKEGRVFVY
1u2wA1          VDISGVSQILKAIADENRAKITYALCQDELCVCDIANILGVTIANASHHLRTLYKQGVVNFRLAL-----
2oa4A1          --------NTRRWVASRKIAVVRGVIYGLITLAEAKQTYGLSDEEFNSWVSALAEHGKDALKVTALKKY-
2co5A1          ----------KYMRI-NYYIILKVLVINGSRLEKKRFDIDISDGVLYPLIDSLIDDKILREEEAPDGKVL
2fnaA1          --------------ARKRYLNIXRTLSKCGRALELEEGIEISDSEIYNYLTQLTKHSWIIKEGEKYC---
1v4rA1          ---------YADVATHFRTLIKSGELAPGPSVADIRAQFGVAAKTVSRALAVLKSEGLVSSRGALGTVV-
2f2eA1          -----VARPLDVIGDGWSXLIVRDAFEGLTRFGEFQKSLGLAKNILAARLRNLVEHGVAVPAESGSHQEY
1y0uA           -----HKRYNYAVTNPVRRKILRXLDKG-RSEEEIXQTLSLSKKQLDYHLKVLEAGFCIERVGER-----
2d1hA1          ----------------------------------LADIFKLSKTTVENSLKKLIELGLVVRTKTPKYYYS
1ub9A           MEELKEIMKSHILGNPVRLGIMIFLLPRRAPFSQIQKVLDLTPGNLDSHIRVLERNGLVKTYKV------
1sfuA           -----------------KKEVLSLNTNDYTTAISLSNRLKINKKKINQQLYKLQKEDTVKMVPSNPPKWF
1zybA1          ------------IIRFFLSHCEKPQGEKKVKXDDLARCLDDTRLNISKTLNELQDNGLIELHRKEI----
1xcbA1          -----------ISRLITYLRILEELEAQGTSSEQLGELAQVTAFQVRKDLSYFGSYGTRGVG--------
1xmkA1          --------------AEIKEKICDYLFNVSSSALNLAKNIGLTKRDINAVLIDMERQGDVYRQGTTPPIW-
1tqiA1          ----NIAELYGKM-GKHSWRIMDAIFKEYVPLQLISSHARIGEEKARNILKYLSDLRVV-----------
2eshA1          ---------RGFRGWWLASTILLLVAEKRLAEFGIEIPGIGHMGNIYRVLADLEESGFLSTEWDTTVS--
2a61A1          --------------TPAQFDILQKIYFEGKRPGELSVLLGVAKSTVTGLVKRLEADGYLTRTPDPA----


                         .         .         *         .         .         .         .:140
query           YFNSAYQQQLNWLFDILADDEIIQSDQKLVKQLIAQELEHLPEIHAKxxxx
1fnnA1          GTEPLDTLEA-----------------------------------------
1r1uA           SLDIHVATMLKQAIH------------------------------------
1ulyA           V--EKYYGRTADVFYINL-----YLGDEELRYIARSRLKTKIDIFKR----
1z05A1          RGRPAVGLQTN----------------------------------------
1lvaA3          ---------------------------------------------------
2hs5A1          ---------------------------------------------------
2jn6A1          AEQIRQLKKE-----------------------------------------
2h6bA1          ---------------------------------------------------
2b0lA1          IKVLNNKF-------------------------------------------
2hoeA1          ---------------------------------------------------
2p4wA1          P--------------------------------------------------
1cgpA1          ---------------------------------------------------
1mzbA           ELADSGHHDH-----------------------------------------
1wi9A           Y--------------------------------------------------
1z6rA1          ---------------------------------------------------
1r1tA           ---------------------------------------------------
1qbjA           ---------------------------------------------------
1fp2A1          ---------------------------------------------------
2gauA1          ---------------------------------------------------
1ft9A1          ---------------------------------------------------
2cohA1          ---------------------------------------------------
1q1hA           YYWKPNIDQIN----------------------------------------
1oyiA           ---------------------------------------------------
1biaA1          ---------------------------------------------------
2g9wA1          PVHGRDELVAGLXVDALAQAEDSGSRQAALVHFVER---------------
2htjA1          ---------------------------------------------------
1mkmA1          ---------------------------------------------------
1p6rA           TPNIDESDYI-----------------------------------------
1u2wA1          ---------------------------------------------------
2oa4A1          ---------------------------------------------------
2co5A1          ---------------------------------------------------
2fnaA1          ---------------------------------------------------
1v4rA1          ---------------------------------------------------
2f2eA1          RLTDKGRALFPLLVAIRQW--------------------------------
1y0uA           ---------------------------------------------------
2d1hA1          ISSNILEKIRNDLLN------------------------------------
1ub9A           ---------------------------------------------------
1sfuA           ---------------------------------------------------
1zybA1          ---------------------------------------------------
1xcbA1          ---------------------------------------------------
1xmkA1          ---------------------------------------------------
1tqiA1          ---------------------------------------------------
2eshA1          ---------------------------------------------------
2a61A1          ---------------------------------------------------