[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for ftul2:ACD30541.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1i9bA.bssp"

## Summary of PDB Search
:351
    7e-14  15%  1i9bA  [b.96.1.1] ACETYLCHOLINE BINDING PROTEIN
:351

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxKPTLVKTSAFITDIQILNEMNEQLQIDVIFRFSWNDQRLE
1i9bA           ------------------------------RPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWSDRTLA


                         .         .         *         .         .         .         .:140
query           FDKNEEKTPYKLYQGDFQYDEVFEGWKPQISIINEIGTPQIKARQIKIYPNGDIIYTEQRTLHLETPMRL
1i9bA           WNSSHS--------PDQVSVPISSLWVPDLAAYNAISKPEVTPQLARVVSDGEVLYMPSIRQRFSCDVSG


                         +         .         .         .         .         *         .:210
query           EKFPFDKQTLKAYIIPFGYNSKEVQLIVEPNHKITVKDYVKDHPNINVAEWHLSNFDLKNIEPIKYYYGK
1i9bA           VDTESG-ATCRIKIGSWTHHSREISVDPTTENSDDSEYF------SQYSRFEILDVTQKKNS--VTYSCC


                         .         .         .         +         .         .         .:280
query           PQRISMLEFSISLERKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1i9bA           PEAYEDVEVSLNFRKK------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1i9bA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           x
1i9bA           -