[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for ftul2:ACD30570.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2fhbA5.bssp"
#ERROR : Can't open dsspfile "1gjuA2.bssp"
#ERROR : Can't open dsspfile "1m7xA3.bssp"
#ERROR : Can't open dsspfile "1eh9A3.bssp"
#ERROR : Can't open dsspfile "1a47A4.bssp"
#ERROR : Can't open dsspfile "1bvzA3.bssp"
#ERROR : Can't open dsspfile "1h3gA3.bssp"
#ERROR : Can't open dsspfile "1iv8A2.bssp"
#ERROR : Can't open dsspfile "1c7sA3.bssp"
#ERROR : Can't open dsspfile "1g5aA2.bssp"
#ERROR : Can't open dsspfile "1bliA2.bssp"
#ERROR : Can't open dsspfile "1wzaA2.bssp"
#ERROR : Can't open dsspfile "1lwhA2.bssp"
#ERROR : Can't open dsspfile "1amyA2.bssp"
#ERROR : Can't open dsspfile "1bf2A3.bssp"
#ERROR : Can't open dsspfile "1r7aA2.bssp"
#ERROR : Can't open dsspfile "1m53A2.bssp"
#ERROR : Can't open dsspfile "1gcyA2.bssp"
#ERROR : Can't open dsspfile "1mwoA2.bssp"
#ERROR : Can't open dsspfile "1m7xA2.bssp"
#ERROR : Can't open dsspfile "1bagA2.bssp"
#ERROR : Can't open dsspfile "1aqhA2.bssp"
#ERROR : Can't open dsspfile "2aaaA2.bssp"
#ERROR : Can't open dsspfile "1uuqA.bssp"
#ERROR : Can't open dsspfile "1nouA1.bssp"
#ERROR : Can't open dsspfile "1px8A2.bssp"
#ERROR : Can't open dsspfile "1m7xA1.bssp"
#ERROR : Can't open dsspfile "1ktbA2.bssp"
#ERROR : Can't open dsspfile "1bhwA.bssp"
#ERROR : Can't open dsspfile "1zy9A2.bssp"
#ERROR : Can't open dsspfile "1hp4A1.bssp"
#ERROR : Can't open dsspfile "2ot9A1.bssp"
#ERROR : Can't open dsspfile "2c0hA1.bssp"
#ERROR : Can't open dsspfile "1r8lA.bssp"
#ERROR : Can't open dsspfile "1cz1A.bssp"
#ERROR : Can't open dsspfile "1qnoA.bssp"
#ERROR : Can't open dsspfile "1chkA.bssp"
#ERROR : Can't open dsspfile "1bf2A1.bssp"
#ERROR : Can't open dsspfile "1eceA.bssp"
#ERROR : Can't open dsspfile "2bhuA1.bssp"
#ERROR : Can't open dsspfile "1vjzA.bssp"
#ERROR : Can't open dsspfile "1eh9A1.bssp"
#ERROR : Can't open dsspfile "2fhbA1.bssp"
#ERROR : Can't open dsspfile "1tg7A5.bssp"
#ERROR : Can't open dsspfile "1rh9A1.bssp"
#ERROR : Can't open dsspfile "1bqcA.bssp"
#ERROR : Can't open dsspfile "1edgA.bssp"
#ERROR : Can't open dsspfile "1z0mA1.bssp"
#ERROR : Can't open dsspfile "1aqhA1.bssp"
#ERROR : Can't open dsspfile "2hq4A1.bssp"
#ERROR : Can't open dsspfile "2qlvB1.bssp"
#ERROR : Can't open dsspfile "1bvzA2.bssp"
#ERROR : Can't open dsspfile "1izjA2.bssp"
#ERROR : Can't open dsspfile "1gviA2.bssp"
#ERROR : Can't open dsspfile "1t92A.bssp"
#ERROR : Can't open dsspfile "1m53A1.bssp"
#ERROR : Can't open dsspfile "1tg7A2.bssp"
#ERROR : Can't open dsspfile "1wzaA1.bssp"
#ERROR : Can't open dsspfile "1uokA1.bssp"
#ERROR : Can't open dsspfile "1ntfA.bssp"
#ERROR : Can't open dsspfile "1cwyA.bssp"
#ERROR : Can't open dsspfile "1pz2A1.bssp"
#ERROR : Can't open dsspfile "2aamA1.bssp"
#ERROR : Can't open dsspfile "1fhlA.bssp"
#ERROR : Can't open dsspfile "1wu4A1.bssp"

## Summary of PDB Search
:640
    8e-61  11%  2fhbA5 [c.1.8.1] PULLULANASE A:403 -- 965
    8e-52  11%  1gjuA2 [c.1.8.1] MALTODEXTRIN GLYCOSYLTRANSFERASE A:1 -- 572
    7e-51  46%  1m7xA3 [c.1.8.1] 1,4-ALPHA-GLUCAN BRANCHING ENZYME A:227 -- 622
    1e-43  20%  1eh9A3 [c.1.8.1] GLYCOSYLTREHALOSE TREHALOHYDROLASE A:91 -- 490
    4e-42  12%  1a47A4 [c.1.8.1] CYCLODEXTRIN GLYCOSYLTRANSFERASE A:1 -- 406
    8e-42  15%  1bvzA3 [c.1.8.1] PROTEIN (ALPHA-AMYLASE II) A:121 -- 502
    1e-39  19%  1h3gA3 [c.1.8.1] CYCLOMALTODEXTRINASE A:96 -- 517
    8e-39  16%  1iv8A2 [c.1.8.1] MALTOOLIGOSYL TREHALOSE SYNTHASE A:1 -- 653
    1e-38   7%  1c7sA3 [c.1.8.6] BETA-N-ACETYLHEXOSAMINIDASE A:338 -- 780
    2e-37  17%  1g5aA2 [c.1.8.1] AMYLOSUCRASE A:1 -- 554
    1e-36  11%  1bliA2 [c.1.8.1] ALPHA-AMYLASE A:3 -- 393
    1e-34  19%  1wzaA2 [c.1.8.1] ALPHA-AMYLASE A A:28 -- 436
    2e-34  14%  1lwhA2 [c.1.8.1] 4-ALPHA-GLUCANOTRANSFERASE A:1 -- 391
    2e-34  17%  1amyA2 [c.1.8.1] 1,4-ALPHA-D-GLUCAN GLUCANOHYDROLASE A:1 -- 346
    2e-33  18%  1bf2A3 [c.1.8.1] ISOAMYLASE A:163 -- 637
    7e-33  10%  1r7aA2 [c.1.8.1] SUCROSE PHOSPHORYLASE A:1 -- 434
    3e-32  16%  1m53A2 [c.1.8.1] ISOMALTULOSE SYNTHASE A:43 -- 520
    6e-32  12%  1gcyA2 [c.1.8.1] GLUCAN 1,4-ALPHA-MALTOTETRAHYDROLASE A:1 -- 357
    8e-32  11%  1mwoA2 [c.1.8.1] ALPHA AMYLASE A:1 -- 361
    3e-31  32%  1m7xA2 [b.71.1.1] 1,4-ALPHA-GLUCAN BRANCHING ENZYME A:623 -- 728
    3e-30  15%  1bagA2 [c.1.8.1] ALPHA-1,4-GLUCAN-4-GLUCANOHYDROLASE A:1 -- 347
    1e-29  14%  1aqhA2 [c.1.8.1] ALPHA-AMYLASE A:1 -- 354
    2e-29  18%  2aaaA2 [c.1.8.1] ALPHA-AMYLASE A:1 -- 381
    2e-28   6%  1uuqA  [c.1.8.3] MANNOSYL-OLIGOSACCHARIDE GLUCOSIDASE
    4e-26  10%  1nouA1 [c.1.8.6] BETA-HEXOSAMINIDASE BETA CHAIN A:200 -- 552
    4e-25   7%  1px8A2 [c.1.8.3] BETA-XYLOSIDASE A:14 -- 359
    1e-24  44%  1m7xA1 [b.1.18.2] 1,4-ALPHA-GLUCAN BRANCHING ENZYME A:117 -- 226
    2e-24  10%  1ktbA2 [c.1.8.1] ALPHA-N-ACETYLGALACTOSAMINIDASE A:1 -- 293
    3e-24   8%  1bhwA  [c.1.15.3] XYLOSE ISOMERASE
    7e-24   9%  1zy9A2 [c.1.8.13] ALPHA-GALACTOSIDASE A:178 -- 525
    8e-24  11%  1hp4A1 [c.1.8.6] BETA-N-ACETYLHEXOSAMINIDASE A:151 -- 506
    1e-23   8%  2ot9A1 [c.52.1.33] HYPOTHETICAL PROTEIN A:2 -- 180
    6e-23   8%  2c0hA1 [c.1.8.3] MANNAN ENDO-1,4-BETA-MANNOSIDASE A:18 -- 367
    8e-23   7%  1r8lA  [c.1.8.3] ENDO-BETA-1,4-GALACTANASE
    1e-22   9%  1cz1A  [c.1.8.3] PROTEIN (EXO-B-(1,3)-GLUCANASE)
    2e-22   9%  1qnoA  [c.1.8.3] ENDO-1,4-B-D-MANNANASE
    2e-20   9%  1chkA  [d.2.1.7] CHITOSANASE
    2e-20  11%  1bf2A1 [b.1.18.2] ISOAMYLASE A:1 -- 162
    5e-20   8%  1eceA  [c.1.8.3] ENDOCELLULASE E1
    9e-19  23%  2bhuA1 [b.1.18.2] MALTOOLIGOSYLTREHALOSE TREHALOHYDROLASE A:14 --
    2e-18   9%  1vjzA  [c.1.8.3] ENDOGLUCANASE
    5e-18  21%  1eh9A1 [b.1.18.2] GLYCOSYLTREHALOSE TREHALOHYDROLASE A:1 -- 90
    3e-17  22%  2fhbA1 [b.1.18.2] PULLULANASE A:288 -- 402
    5e-17  10%  1tg7A5 [c.1.8.14] BETA-GALACTOSIDASE A:41 -- 394
    3e-16   6%  1rh9A1 [c.1.8.3] ENDO-BETA-MANNANASE A:30 -- 399
    4e-16  10%  1bqcA  [c.1.8.3] PROTEIN (BETA-MANNANASE)
    7e-16  10%  1edgA  [c.1.8.3] ENDOGLUCANASE A
    2e-15  21%  1z0mA1 [b.1.18.21] 5'-AMP-ACTIVATED PROTEIN KINASE, BETA-1 SUBUNIT
    6e-15  15%  1aqhA1 [b.71.1.1] ALPHA-AMYLASE A:355 -- 448
    1e-14  18%  2hq4A1 [d.342.1.1] HYPOTHETICAL PROTEIN PH1570 A:1 -- 152
    8e-14  15%  2qlvB1 [b.1.18.21] PROTEIN SIP2 B:161 -- 247
    9e-13  15%  1bvzA2 [b.71.1.1] PROTEIN (ALPHA-AMYLASE II) A:503 -- 585
    3e-11  17%  1izjA2 [b.71.1.1] AMYLASE A:555 -- 637
    1e-10   9%  1gviA2 [b.71.1.1] MALTOGENIC AMYLASE A:506 -- 588
    1e-10   7%  1t92A  [d.24.1.3] GENERAL SECRETION PATHWAY PROTEIN G
    3e-10  15%  1m53A1 [b.71.1.1] ISOMALTULOSE SYNTHASE A:521 -- 598
    1e-09   8%  1tg7A2 [b.18.1.27] BETA-GALACTOSIDASE A:667 -- 848
    3e-09  23%  1wzaA1 [b.71.1.1] ALPHA-AMYLASE A A:437 -- 515
    4e-09  26%  1uokA1 [b.71.1.1] OLIGO-1,6-GLUCOSIDASE A:480 -- 558
    8e-08  10%  1ntfA  [d.151.1.2] SALIVARY NITROPHORIN
    6e-07  17%  1cwyA  [c.1.8.1] AMYLOMALTASE
    1e-05  11%  1pz2A1 [b.71.1.2] ALPHA-L-ARABINOFURANOSIDASE A:5 -- 17 A:385 --
    1e-04  12%  2aamA1 [c.1.8.15] HYPOTHETICAL PROTEIN TM1410 A:28 -- 312
    4e-04  12%  1fhlA  [c.1.8.3] BETA-1,4-GALACTANASE
    7e-04  11%  1wu4A1 [a.102.1.2] XYLANASE Y A:6 -- 381
:640

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxKHIYAYEFMGAHKACEEGIEGIRFTTWAPNAKSICVIGDFNYWQV
2fhbA5          --------------------------------------------EGWDGLTMPHAQKTKADLAKMTIHES
1gjuA2          ----------------------------------------------------------------------
1m7xA3          ----------------------------------------------------------------------
1eh9A3          ----------------------------------------------------------------------
1a47A4          ----------------------------------------------------------------------
1bvzA3          ----------------------------------------------------------------------
1h3gA3          ----------------------------------------------------------------------
1iv8A2          ----------------------------------------------------------------------
1c7sA3          ----------------------------------------------------------------------
1g5aA2          ----------------------------------------------------------------------
1bliA2          ----------------------------------------------------------------------
1wzaA2          ----------------------------------------------------------------------
1lwhA2          ----------------------------------------------------------------------
1amyA2          ----------------------------------------------------------------------
1bf2A3          ----------------------------------------------------------------------
1r7aA2          ----------------------------------------------------------------------
1m53A2          ----------------------------------------------------------------------
1gcyA2          ----------------------------------------------------------------------
1mwoA2          ----------------------------------------------------------------------
1m7xA2          ----------------------------------------------------------------------
1bagA2          ----------------------------------------------------------------------
1aqhA2          ----------------------------------------------------------------------
2aaaA2          ----------------------------------------------------------------------
1uuqA           ----------------------------------------------------------------------
1nouA1          ----------------------------------------------------------------------
1px8A2          ----------------------------------------------------------------------
1m7xA1          --------------------------HLRPYETLGAHADTMDGVTGTRFSVWAPNARRVSVVGQFNYWD-
1ktbA2          ----------------------------------------------------------------------
1bhwA           ------------------------------------------SFGLWTVGWQARDAFGDATRTALDPVEA
1zy9A2          ----------------------------------------------------------------------
1hp4A1          ----------------------------------------------------------------------
2ot9A1          ----------------------------------------------------------------------
2c0hA1          ----------------------------------------------------------------------
1r8lA           ----------------------------------------------------------------------
1cz1A           ----------------------------------------------------------------------
1qnoA           ----------------------------------------------------------------------
1chkA           ----------------------------------------------------------------------
1bf2A1          ---------------------------------LGASYDAQQA--NITFRVYSSQATRIVLY-LYSAGQE
1eceA           ----------------------------------------------------------------------
2bhuA1          -------------------------TQHDPRTRLGAT--PLPGGAGTRFRLWTSTARTVAVRVNGTEHV-
1vjzA           ----------------------------------------------------------------------
1eh9A1          ---------------------------------FAYK----IDGNEVIFTLWAPYQKSVKLKVLEKGLYE
2fhbA1          ---------------------------------YGAQLTDS----GVTFRVWAPTAQQVLVIYSADKKV-
1tg7A5          ----------------------------------------------------------------------
1rh9A1          ----------------------------------------------------------------------
1bqcA           ----------------------------------------------------------------------
1edgA           ----------------------------------------------------------------------
1z0mA1          ---------------------------------------------PTVFR-WTGGGKEVYLSGSFNNW--
1aqhA1          ----------------------------------------------------------------------
2hq4A1          ---------------------------------------CEEKLE---VFENGFKDEKFNVEVKFYGND-
2qlvB1          ---------------------------------------------PVEIR-WQQGGSKVYVTGSFTKWR-
1bvzA2          ----------------------------------------------------------------------
1izjA2          ----------------------------------------------------------------------
1gviA2          ----------------------------------------------------------------------
1t92A           ----------------------------------------------------------------------
1m53A1          ----------------------------------------------------------------------
1tg7A2          ----------------------------------------------------------------------
1wzaA1          ----------------------------------------------------------------------
1uokA1          ----------------------------------------------------------------------
1ntfA           ----------------------------------------------------------------------
1cwyA           ----------------------------------------------------------------------
1pz2A1          ----------------------------------------------------------------------
2aamA1          ----------------------------------------------------------------------
1fhlA           ----------------------------------------------------------------------
1wu4A1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           EDKNYMEPITDAGLWSVFIPNAKNGDKYKFVVTNKDTNNYVYKSDPYAFFSELRPNTASIITTETQYTWS
2fhbA5          HI----------RDLSAWDQTVPAELRGKYLALTAQ-ESNMVQHLKQLSASGVTHIELLP----VFDLAT
1gjuA2          ---------KATGKRIYAVPKLWIPGFFKKFDEKSGR----CFVDPYELGAEITDWILNQSREWDYSQPL
1m7xA3          ----------------------------------------------------------------------
1eh9A3          --------------------------------------------------------------------FN
1a47A4          ---------------------------------------------------------ASDTAVSNVVNYS
1bvzA3          ----------------------------------------------------------------TPEWAK
1h3gA3          ----------------------------------------------------------------------
1iv8A2          ----------------------------------------------------------------------
1c7sA3          ------------------------------------------------------------IFLDVARNFH
1g5aA2          ----------------------------------------------------------------------
1bliA2          ----------------------------------------------------------------------
1wzaA2          ----------------------------------------------------------------------
1lwhA2          ----------------------------------------------------------------------
1amyA2          ----------------------------------------------------------------------
1bf2A3          ----------------------------------------------------------------------
1r7aA2          ----------------------------------------------------------------------
1m53A2          ----------------------------------------------------------------------
1gcyA2          ------------------------------------------------------------------AGKS
1mwoA2          ----------------------------------------------------------------------
1m7xA2          ----------------------------------------------------------------------
1bagA2          ----------------------------------------------------------------------
1aqhA2          ----------------------------------------------------------------------
2aaaA2          --------------------------------------------------------------------WR
1uuqA           ---------------------------------------------------------------EHFVRVN
1nouA1          ----------------------------------------------------------------------
1px8A2          ----------------------------------------------------------------------
1m7xA1          GRRHPMRLRKESGIWELFIPGAHNGQLYKYEMIDAN-GNLRLKSDPYAFEAQMRPETASLIC--------
1ktbA2          ----------------------------------------------------------------------
1bhwA           VHKYGITFHDDDLVPFGSDAQTRDGIIAGFKKALDETGLIVPMVTTNLFTHPVFKDGGFTSNDRSVRRYA
1zy9A2          ----------------------------------------------------------------------
1hp4A1          ----------------------------------------------------------------------
2ot9A1          ----------------------------------------------------------------------
2c0hA1          -----------------------------------------------------------------RLSVS
1r8lA           ----------------------------------------------------------------------
1cz1A           --------------------------------------------------------------------PY
1qnoA           ----------------------------------------------------------------------
1chkA           ----------------------------------------------------------------------
1bf2A1          SATYTLSPAGS-GVWAVTVPVSSIAVYYGYRAWGPNWPYASNWGKGSQAGFVSDVDANGDRFNPNKLLLD
1eceA           ------------------------------------------------------------------WHTS
2bhuA1          -----MTSLGG-GIYELELP-VGPGARYLFVLDGV------PTPDPYARFLPDGVHGEAEV---------
1vjzA           ----------------------------------------------------------------------
1eh9A1          MERD------EKGYFTITLNNVKVRDRYKYVLDDAS-----EIPDPASRYQPEGVHGPSQII--------
2fhbA1          IASHPMTRDSASGAWSWQGGSDLKGAFYRYAMTVYHPVEQYEVTDPYAHSLSTNSEYSQV------VDLN
1tg7A5          ----------------------------------------------------------------------
1rh9A1          ----------------------------------------------------------------------
1bqcA           ----------------------------------------------------------------------
1edgA           ----------------------------------------------------------------------
1z0mA1          -SKLPLTR--SQNNFVAILDLPEGEHQYKFFVDGQWT---HDPSEPIVTSQLGTVNNIIQVK--------
1aqhA1          ----------------------------------------------------------------------
2hq4A1          -----ARKVLLAMIYELYLPEYGREYVYPFECAKEFWN---IYLEGEEIQDQLKP---------------
2qlvB1          KMIGLIPDSDNNGSFHVKLRLLPGTHRFRFIVDNELRVS---DFLPTATDQMGNFVNYIEV---------
1bvzA2          ----------------------------------------------------------------------
1izjA2          ----------------------------------------------------------------------
1gviA2          ----------------------------------------------------------------------
1t92A           ----------------------------------------------------------------------
1m53A1          ----------------------------------------------------------------------
1tg7A2          ----------------------------------------------------------------------
1wzaA1          ----------------------------------------------------------------------
1uokA1          ----------------------------------------------------------------------
1ntfA           ----------------------------------------------------------------------
1cwyA           ----------------------------------------------------------------------
1pz2A1          ----------------------------------------------------------------------
2aamA1          ----------------------------------------------------------------------
1fhlA           ----------------------------------------------------------------------
1wu4A1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           DDKWLEKRAKTNYYDNPMNVYELHLASWKTKNGKFLTYDELNETLPQYIKEMGYTHVEFMPLHEHPLDAS
2fhbA5          VNEFSDKVADIQQPFSRLCEVNSAVKSSEFAGYCDSGSTEEVLTQLKQNDSKDNPQVQALNTLVAQTDSY
1gjuA2          SFLKGEKTPDW---IKRSVVYGSLPRTTAAYNHEAGTFFKMMLLLP-FVKSLGADAIYLLPVSRKKGDAP
1m7xA3          ---QTEERKKANQFDAPISIYEVHLGSWRRHTDNWLSYRELADQLVPYAKWMGFTHLELLPINEHPFDGS
1eh9A3          NETFLKKE--------DLIIYEIHVGTFTPEG----TFEGVIRKLD-YLKDLGITAIEIMPIAQFPGKRD
1a47A4          TDVIYQRFVDGNTSNNPTGDLYDPTHTSLKKYFGG-DWQGIINKINDYLTGMGVTAIWISQPVENIYAVL
1bvzA3          EAVIYQRFANGDPSNDPPGTEQWAKDARPRHDSFYGGDLKGVIDRLPYLEELGVTALYFTPIFASPSH--
1h3gA3          -----------------------------------------------YIAGLGFTQLWPTPLVENDAAAY
1iv8A2          ----------------ISATYRLQL-------NKNFNFGDVIDNLW-YFXDLGVSHLYLSPVLMASPGSN
1c7sA3          KKDAVLRL-----------LDQMAAYKLNKFHFHLSDDEGWRIEIP-GLPELTEVGGQRCHDLSETTC--
1g5aA2          -------YSQRNSSLKDIDIARENNPDWILSNKQVGDLKGLKDKIP-YFQELGLTYLHLMPLFKCPEGKS
1bliA2          -------------------LNGTLMQYFEWYMPNDGHWKRLQNDSA-YLAEHGITAVWIPPAYKGTSQAD
1wzaA2          -------------------YYEIFVRSFYDSDGDGIGDDYLNDGDPETIADLGVNGIWLMPIFKSPSY--
1lwhA2          -----------------MIGYQIYVRSFRDGNLDGVDFRGLKNAVS-YLKELGIDFVWLMPVFSSISF--
1amyA2          -------------------LFQGFNWESWKHNGG--WYNFLMGKVD-DIAAAGITHVWLPPASQSVAE--
1bf2A3          ---TQSTGTKPTRAQKDDVIYEVHVRGFTEQDTSIPTYYGAGLKAS-YLASLGVTAVEFLPVQETQNDNY
1r7aA2          -------------------KNKVQLITYADRLGDG-TIKSMTDILR-TRFDGVYDGVHILPFFTPFDGAD
1m53A2          -------------------FYQIYPRSFKDTNDDGIGDIRIIEKLD-YLKSLGIDAIWINPHYDSP-NTD
1gcyA2          PNAVR---------YHGGDEIILQGFHWNVVREAPNDWYNILRQQAATIAADGFSAIWMPVPWRDFSSWS
1mwoA2          -------------------IMQAFYWDVPGGGIWW---DHIRSKIP-EWYEAGISAIWLPPMGYDPYDYF
1m7xA2          ----------------------------------------------------------------------
1bagA2          ----------------PSIKSGTILHAWN------WSFNTLKHNMK-DIHDAGYTAIQTSPINQVKEGNQ
1aqhA2          ------------------PTTFVHLFEWN--------WQDVAQECEQYLGPKGYAAVQVSPPNEHITGSQ
2aaaA2          TQSIYFLLTDRFGRTDNSTTATCNTGNEIYC---GGSWQGIIDHLD-YIEGMGFTAIWISPITEQLPQAY
1uuqA           GGHFELQ-------GKPYVITGVNMWYAAYLGAPNVGDRDRLAKELDNLKAIGVNNLRVLAVSEKSEINS
1nouA1          ----------------------------------YLPVKIILKTLD-AMAFNKFNVLHWHIVDDQSFPYQ
1px8A2          -------------------------------------QKEYIETLKYVKENIDFKYIRGHGLLCDDVGIY
1m7xA1          ----------------------------------------------------------------------
1ktbA2          --------------------CREDPRQCISEMLF--------MEMADRIAEDGWRELGYKYINIDDCWAA
1bhwA           IRKVLRQMDLGAELGWGGREGAEYDSAKDVSAALDRYREALNLLAQYSEDRGYGLRFAIEPKPNEPRGDI
1zy9A2          ----------------VPKHTPTGWCSWYHYFLDL-TWEETLKNLK-LAKNFPFEVFQIDDAYEKDIG-D
1hp4A1          -----------------------WRSAMLDVSRHFFGVDEVKRYID-RVARYKYNKLHLHLSDDQGRIAI
2ot9A1          -----------------------------------------------------------QPSTTYKFELN
2c0hA1          GTNLNYNGHHIFLSG--ANQAWVNYARDFGHNQYSKGKSTFESTLS-DMQSHGGNSVRVWLHIEGESTPE
1r8lA           -------------------------------GVAFYNESGKKQDIFKTLKEAGVNYVRVRI--------W
1cz1A           MTPSLFEPFQNGNDQSGVPVDEYHWTQTLGKELQKHWSTWITEQDFKQISNLGLNFVRIPIGYWAFQLLD
1qnoA           ------------------DGKVGYFAGTNCYWCSFLTNHADVDSTFSHISSSGLKVVRVWGFNDVNTQIW
1chkA           ------------------------------------DMLELVQHYT-DLEPGNILAKYLPALKKVNGSAS
1bf2A1          PYAQ--EVSQDPLNPSNQNGNVFASGASY-----------------------------------------
1eceA           GREILDAN------NVPVRIAGINWFGFETCNYVVHGLWRDYRSMLDQIKSLGYNTIRLPYSDDILKTMP
2bhuA1          ----------------------------------------------------------------------
1vjzA           ----------------------------------------------LWXAQWDFNFVRIPXCHLLWSDRG
1eh9A1          ----------------------------------------------------------------------
2fhbA1          DSAL------------------------------------------------------------------
1tg7A5          -------------------------------HPYRLPVASLYIDIFEKVKALGFNCVSFYVDWALLEGNP
1rh9A1          NNFVYTDGTHFALNGKS--LYINGFNAYWLMYIAYPSTRIKVTNTFQQASKYKMNVARTWAFSHGGSRPL
1bqcA           ----------------------------------------------------------------------
1edgA           ------GLRLGWNLGNTFDAFNGTNITNELDYETSWSGIKTTKQMIDAIKQKGFNTVRIPVSWHPHVSGS
1z0mA1          ----------------------------------------------------------------------
1aqhA1          ----------------------------------------------------------------------
2hq4A1          ----------------------------------------------------------------------
2qlvB1          ----------------------------------------------------------------------
1bvzA2          ----------------------------------------------------------------------
1izjA2          ----------------------------------------------------------------------
1gviA2          ----------------------------------------------------------------------
1t92A           --DRQKVVSDLVALEGALDMYKLDNSRYPTSAPSAEPHARNYPEGG-YIRRLPQDPWGSDYQLLSP-GQH
1m53A1          ----------------------------------------------------------------------
1tg7A2          ----------------------------------------------------------------------
1wzaA1          ----------------------------------------------------------------------
1uokA1          ----------------------------------------------------------------------
1ntfA           ----------------------------------------------------------------------
1cwyA           -------------------------------------------------------YALFMALKGAHGGLP
1pz2A1          ----------------------------------------------------------------------
2aamA1          ----------------------------------------------------------------------
1fhlA           --------------------------------YSYKNLNGQTQALETILADAGINSI-RQRVWVNPSDGS
1wu4A1          --------------------LALFFASWGDGDEQPFNYSEQARKLLHTCVHNGEGGPGHPMW---NRDNK


                         .         .         .         +         .         .         .:280
query           WGYQPTGFYSVNSRHGDIIGLKRLVDKLHNNDIGVILDWVPGHFCKDQHGLIYFDGSPCYEYQEPTKAIN
2fhbA5          WGYDPFHYTVPEGSYATDPEGTARIKEFQDLGMNVIMDVVYNHTNAARTSVLDKIVPWYYQRLNETTGSV
1gjuA2          SPYSVKNPMELLEPFKVDEEFKAFVEACHILGIRVILDFIPRTAARDSDLIREHPDWFYWIKVEELTPPR
1m7xA3          WGYQPTGLYAPTRRFGTRDDFRYFIDAAHAAGLNVILDWVPGHFPTDDF-----------ALAEFDGTNL
1eh9A3          WGYDGVYLYAVQNSYGGPEGFRKLVDEAHKKGLGVILDVVYNHVGPEGNYMVKLGPYFSQKYKTPWGLTF
1a47A4          HGYWARDFKRTNPYFGSFTDFQNLINTAHAHNIKVIIDFAPNHTSPASEDPTYAENGRLYDNGTLLGGYT
1bvzA3          HKYDTADYLAIDPQFGDLPTFRRLVDEAHRRGIKIILDAVFNHAGDQFFAFRDVLQKGEQSRYKDWFFIE
1h3gA3          HGYAATDHYRIDPRYGSNEDFVRLSTEARKRGXGLIQDVVLSHIGKQHHRVAVQDPYAAQADSENFTKGW
1iv8A2          HGYDVIDHSRINDELGGEKEYRRLIETAHTIGLGIIQDIVPNHMAVNSLNWRLMD-----VLXMGXXSXY
1c7sA3          LLPQYGQGPDVYGGFFSRQDYIDIIKYAQARQIEVIPEIDMPAHAMEARYKKLHAAGKEQEANEFRLVDQ
1g5aA2          GGYAVSSYRDVNPALGTIGDLREVIAALHEAGISAVVDFIFNHTSNEHEREIFPDQHPGGFSQLEDGRWV
1bliA2          VGYEFHQKGTVRTKYGTKGELQSAIKSLHSRDINVYGDVVINHKGGADAEDVTAVEVDPADRNRVISGEH
1wzaA2          HGYDVTDYYKINPDYGTLEDFHKLVEAAHQRGIKVIIDLPINHTSDTDTKETKLDGGRVWHYSPTGMYYG
1lwhA2          HGYDVVDFYSFKAEYGSEREFKEMIEAFHDSGIKVVLDLPIHHTGFLTWFQKALKGDPHYRDYYVWANKE
1amyA2          QGYMPGRLYDDASKYGNKAQLKSLIGALHGKGVKAIADIVINHRTAEHKHMICRDDRPYADGTGNPDTGA
1bf2A3          WGYMTENYFSPDRRYGPTAEFQAMVQAFHNAGIKVYMDVVYNHTAEGGTWTSGLDNATYYELTSGNQYFY
1r7aA2          AGFDPIDHTKVDERLGSWDDVAELSKTHNIMVDAIVNHMSWESKQEDLAGIYRPRPGLPFTHYKFAGKTR
1m53A2          NGYDISNYRQIMKEYGTMEDFDSLVAEMKKRNMRLMIDVVINHTSDQPNNYPSFFGGSAWQKDAKSGQYY
1gcyA2          KSGGGEGYFNKNGRYGSDAQLRQAASALGGAGVKVLYDVVPNHMNRGEINLPAGQGFWRNDCADPGNYPN
1mwoA2          DLGEYYQKGTVETRFGSKEELVRLIQTAHAYGIKVIADVVINHRAGGDLEWNPFVGDYTWTDFSKVASGK
1m7xA2          ----------------------------------------------------------------------
1bagA2          WLYQPTSYQIGNRYLGTEQEFKEMCAAAEEYGIKVIVDAVINHTTFDYAAISNENTQIKNWSDRWDVTQN
1aqhA2          WTRYQPVSYELQSRGGNRAQFIDMVNRCSAAGVDIYVDTLINHMAFPIYSPQDFHESCTINNSDYGNDRY
2aaaA2          HGYWQQKIYDVNSNFGTADNLKSLSDALHARGMYLMVDVVPDHMGYAGNDYSVFDPFDSSSYFHPYCLIT
1uuqA           AVKPAVTNGFGNYDETLLQGLDYLLVELAKRDMTVVLYFNNFWQWSGGMQYMAWIEGEPVQDPNVTNEWE
1nouA1          FPELSNKGSYSLSHVYTPNDVRMVIEYARLRGIRVLPEFDTPGHTLSWG----------KGQKDLLTPCY
1px8A2          REDVVGDEVKPFYNFTY---IDRIFDSFLEIGIRPFVEIGFMPKKLASGTQTVFYWEGNVTPPKDYEKWS
1m7xA1          ----------------------------------------------------------------------
1ktbA2          KQRDAEGRLVPD-PERFPRGIKALADYVHARGLKLGIYGDLGRLTCGGYPGTTLDRVEQDAQTFAEWGVD
1bhwA           LLPTAGHAIAFVQELERPELFGINPETGNEQMSNLNFTQGIAQALWHKKLFHIDLNGQHGPKFDQDLVFG
1zy9A2          WLVTR----------GDFPSVEEXAKVIAENGFIPGIWTAPFSVSETSDVFNEHPDWVVKENGEPKXAYR
1hp4A1          DSWPRLATYGGSTEVGGGPGYKEIVRYAASRHLEVVPEIDMPGHTNAALA---SYAELNCDGVAPPLYTG
2ot9A1          LTDLDRGVYSVKQTIARHPSETEERXTVRLLAYAFWYNEQLAFGRGLSDVDEVLHWIEVGQPDADRLTWC
2c0hA1          FDNNGYVT---GIDNTLISDMRAYLHAAQRHNILIFFTLWNGAVKQSTHY---RLNGLMVDTRKLQSYID
1r8lA           NDPYDANGNGYGGGNNDLEKAIQIGKRATANGMKLLADFHYSDFWADPAKQKAPKAWANLNFEDKKTALY
1cz1A           NDPY---------VQGQVQYLEKALGWARKNNIRVWIDLHGAPGSQNGFDNSGLRDSYNFQNGDNTQVTL
1qnoA           FQKLSATGSTINTGADGLQTLDYVVQSAEQHNLKLIIPFVNNWSDYGGINAYVNAFGGNATTWYTNTAAQ
1chkA           TAAKDTVFQQAQNDERDRVYFDPAVSQAKADGLRALGQFAYYDAIVMHG---PGNDPTSFGGIRKTAMKK
1bf2A1          ----------------------------------------------------------------------
1eceA           NSINFYQMNQDLQGLTSLQVMDKIVAYAGQIGLRIILDRHRPD--------CSGQSALWYTSSVSEATWI
2bhuA1          ----------------------------------------------------------------------
1vjzA           NPFII--------REDFFEKIDRVIFWGEKYGIHICISLHRAPGYSVNKEVEEKTNLWKDETAQEAFIHH
1eh9A1          ----------------------------------------------------------------------
2fhbA1          ----------------------------------------------------------------------
1tg7A5          GHYSAEGIF----------DLQPFFDAAKEAGIYLLARPGPYINAEVSGGGFPG----------------
1rh9A1          QSAPGV------YNEQMFQGLDFVISEAKKYGIHLIMSLVNNWDAFGGKKAVQRGQKLTSDDDFFTNPMV
1bqcA           NTVRVVLSNGVRWSKNGPSDVANVISLCKQNRLICMLEVHDTTGYGEQSGASTLDQAVDYWIELKSVLQG
1edgA           DYKI---------SDVWMNRVQEVVNYCIDNKMYVILNTHHDVD--------------KVKGYFPSSQYM
1z0mA1          ----------------------------------------------------------------------
1aqhA1          ----------------------------------------------------------------------
2hq4A1          ----------------------------------------------------------------------
2qlvB1          ----------------------------------------------------------------------
1bvzA2          ----------------------------------------------------------------------
1izjA2          ----------------------------------------------------------------------
1gviA2          ----------------------------------------------------------------------
1t92A           GQVDIF-SLGPDGVPESNDDIGNWTI--------------------------------------------
1m53A1          ----------------------------------------------------------------------
1tg7A2          -------------------------------------AWTSADHAYTNNSAHSLQTPTSLFASDYGYHTG
1wzaA1          ----------------------------------------------------------------------
1uokA1          ----------------------------------------------------------------------
1ntfA           ----------------------------------------------------------------------
1cwyA           WNRWPLPLRKREEALAEEVAWGALKAEAEALGIRIIGDMPPEWFHLDEEGRPTVVGVP----PDYFSETG
1pz2A1          ----------------------------------------------------------------------
2aamA1          -GFEIAVIDYSKDGSESGEYSPEEIKIXVDAGVVPVAYVNIGQAYRFYWKESWYTNTPEWLGEE-----D
1fhlA           YDLD---------------YNLELAKRVKAAGMSLYLDLHLSDTWADPSDQTTPSGWSTTDLGTLKWQLY
1wu4A1          LIKFIPEVEFSDPSYHLPHFYELFSLWANEEDRVFWKEAA------------------------------


                         .         *         .         .         .         .         +:350
query           KGWGTHNFDLGRNEVKCFLISNAMYWINEFHIDGLRVDAVSNILYLNYDREDGQWIPNIYGGHENLEGIA
2fhbA5          ESATCSDSAPEHRMFAKLIADSLAVWTTDYKIDGFRFDLMLYHQILSAWERIKALNPDIYFFGEGWDSNQ
1gjuA2          AEELPFKVPDEDELEIIYNKENVKRHLKKFTLPPNLIDPQKWEKIKREEGNILELIVKEFITPPGFSDLI
1m7xA3          YEHSTLIYNYGRREVSNFLVGNALYWIERFGIDALRVDAVASMIY--------------RGGRENLEAIE
1eh9A3          NFDDA-----ESDEVRKFILENVEYWIKEYNVDGFRLDAVHAIIDTSPKHILEEIADVVHKYNRIVIAES
1a47A4          NDTNGYFHHYGGTDFSSYEDGIYRNLFDLADLNQQN-STIDSYLKSAIKVWLDMGIDGIRLDAVKHMPFG
1bvzA3          DFPVSKTSRTNYETFAVQVPAMPKLRTENPEVKEYLFDVARFWMEQGIDGWRLDVANEVD--------HA
1h3gA3          FVEGXPDLNQTNPLVANYLIQNNIWWIEYAGLSGLRIDTYGYSDG------------------------A
1iv8A2          YTY----FDFFPEDDKIRLPILGEDLDTVISKGLLKIVKDGDEYFLEYFKWKLTEVGNDIYDTLQKQNYT
1c7sA3          TDTSNTYLNPCLDSSQRFVDKVIGEIAQMHKEAGQPIKTWHNIRLGAGYTDKAKPEPGKGIIDQSNEDKP
1g5aA2          WTTFNWDLNYSNPWVFRAMAGEMLFLAN-LGVDILRMDAVAFIWKQMGTSCENLPQAHA-----------
1bliA2          LIKAWTHFHFPGRGSTYSDFKWHWYHFDGTDWDESRKL----NRIYKFQGKAWDWEVSNEFGNYDYLMYA
1wzaA2          YFWGMPDLNYNNPEVQEKVIGIAKYWL-KQGVDGFRLDGAMHIFPPAQYDKNFTWWEKFRQEIEEVKPVY
1lwhA2          TDLDERREW--DGEKIWHPLEDGRFYRGLFGPFSPDLNYDNPQVFDEMKRLVLHLLDMGVDGF-RFDAAK
1amyA2          DFGAAPDIDHLNLRVQKELVEWLNWLKADIGFDGWRFDFA-----------KGYSADVAKIYIDRSEPSF
1bf2A3          DNTGIANFNTYNTVAQNLIVDSLAYWANTMGVDGFRFDLASVLGNSCLNGAYTASAPNCPNGGYNFDAAD
1r7aA2          LVWVSFTPQQDSDKGWEYLMSIFDQMA-ASHVSYIRLDAVGYGAK--EAGTSCFMTPKTFKLISRLREEG
1m53A2          LHYFARDLNWDNPKVREDLYAMLRFWLD-KGVSGMRFDTVATYSFPNLTPEQQKNFAEQYTMGPNIH--R
1gcyA2          DCGGDADLNTGHPQVYGMFRDEFTNLRSQYGAGGFRFDFVRGYAPERVNSWMTDSADN------------
1mwoA2          YTANYLDFHPNELHCCDEGTFGGFPDICHHKEWDQYWLWKSNESYAA-------YLRSIGFDGWRFDYVK
1m7xA2          ----------------------------------------------------------------------
1bagA2          SLLGLYDWNTQNTQVQSYLKRFLERALN-DGADGFRFDAAKHIELPDDGSYGSQFWPNITNTSAEFQYGQ
1aqhA2          RVQGLADLDTASNYVQNTIAAYINDLQ-AIGVKGFRFDASKHVAASDIQSLMAKVNGSPVVFQEVIDQGG
2aaaA2          DWDNLTMLDTTETAVRTIWYDWVADLVSNYSVDGLRIDSVLEVQFPGYNKASGVYCVGEIDNGNPASDCP
1uuqA           AFMAKSASFYRSEKAQQEYRKTLEKIITRVNSINGKAYVDDATIMSWQLANEPRPGNSQTTAEEKQIYID
1nouA1          SLDSFGPINPTLNTTYSFLTTFFKEISEVFPDQFIHLGGDEVEFKCSNPKIQDFMRQKGFGTDFKKLESF
1px8A2          DLVKAVLHHFI-SRYGIEEVLKWPFEIWNEPNLKEFWKDADEKEYFKLYKVTAKAIKEVNENLKVGGPAI
1m7xA1          ----------------------------------------------------------------------
1ktbA2          MLKLDGCYS------------SGKEQAQGYPQMARALNATGRPIVYSCSWPAYQGGLPPKVNYTLLGEIC
1bhwA           HGDLLNAFSLVDLLENGPDGAPAYDGPRHFDYKPSRTED-----YDGVWESAKANIRMYLLLKERAKAFR
1zy9A2          NWNKKIYALDLSKDEVLNWLFDLFSSLRKXGYRYFKIDFLFAGAVPGERKKNITPIQA------------
1hp4A1          TKVGFSSLCVDKDVTYDFVDDVIGELAALTPGRYLHIGGDEAHSTPKADFVA------------------
2ot9A1          SRRTERTSLLAYGSLRVWEGKVIPAIKNLKNVNIAAVPQDVLEVLAKDXPRVIKWDVXISEGTVFVTDDR
2c0hA1          HALKPMANALKNEALGGWDIMNEPEGEIKPGESSSEPCFDTRHLSGSGAGWAGHLYSAQEIGRFVNWQAA
1r8lA           QYTKQSLKAMKAADIGMVQVGNETNGGLAGETDWAKMSQLFNAGSQAVRETDSNIL--------------
1cz1A           NVLNTIFKKYGGN--EYSDVVIGIELLNEPLGPVLNMDKLKQFFLDGYNSLRQTGSVTPVIIHDAFQVFG
1qnoA           TQYRKY-VQAVVSRYANSTAIFAWELGNEPRCNGCSTDVIVQ-WATSVSQYVKSLDSNHLVTLGDEGLGL
1chkA           ARTPAQGGDETTYLNGFLDARKAQRVFLKAGNLDLNPPLKWKT---------------------------
1bf2A1          ----------------------------------------------------------------------
1eceA           SDLQALAQRYKGNPTVVGFDLHNEPHDPACWGCGDPSIDW---------------------RLAAERAGN
2bhuA1          ----------------------------------------------------------------------
1vjzA           WSFIARRYKGISSTHLSFNLINEPPFPDPQIXSVEDHNSLIKRTITEIRKIDPERLIIIDGLGYGNIPVD
1eh9A1          ----------------------------------------------------------------------
2fhbA1          ----------------------------------------------------------------------
1tg7A5          --WLQRVDGILRTSDEAYLKATDNYASN-------IAATIAKAQITNGGPIILYQPENEYSGACCGYNGF
1rh9A1          KGFYKNNVKVVLTRVNTITKVAYKDDPTILSWELINEPRCPSDLSGKTFQNWVLEMAGYLKSIDSNHLLE
1bqcA           EEDYVLINIGNEPYGNDSATVAAWATDTSAAIQRLRAAGFEHTLVVDAPNWGQDWTNTMRNNADQVYASD
1edgA           ASSKKYITSVWAQIAARFAN-YDEHLIFEGMNEPRLVGHANEWWPELTNSDVVDSINCINQLNQDF-VNT
1z0mA1          ----------------------------------------------------------------------
1aqhA1          ----------------------------------------------------------------------
2hq4A1          ----------------------------------------------------------------------
2qlvB1          ----------------------------------------------------------------------
1bvzA2          ----------------------------------------------------------------------
1izjA2          ----------------------------------------------------------------------
1gviA2          ----------------------------------------------------------------------
1t92A           ----------------------------------------------------------------------
1m53A1          ----------------------------------------------------------------------
1tg7A2          ALLFRGHFTANGKETFFVQTKGGTAYGHSIWINETYVGSWAGTSINDNNNATYTLPTLQSGKNYVITVVI
1wzaA1          ----------------------------------------------------------------------
1uokA1          ----------------------------------------------------------------------
1ntfA           ----------------------------------------------------------------------
1cwyA           QRWGNPLYRWDVLER-----EGFSFWIRRLLFHLVRIDGFEAYWEIPATAVEGRWVK--APGEKLFQ--K
1pz2A1          ----------------------------------------------------------------------
2aamA1          PAWGNYFVKYWYNEWKEIVFSYLDRV-IDQGFKGIYLDRI------------------------------
1fhlA           NYTLEVCNTFAENDIDIEIIS-------------------------------------------------
1wu4A1          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           FLKELNGVLKHTCKGVITIAEESSSWPDISTPVEKGGLGFDFKWNMGWMNDTLRYISLDPVYRKYHHNLI
2fhbA5          FSDRLRDAVRGGGPFDSGDALRQNQGVGSGAGVLPNELTTLSDDQARHLAVLIDKDGAVKRGSEIDYNGA
1gjuA2          NDPQPTWDDVTFLRLYLDHPEASKRFLDPNQPPYVLYDVIKASKFPGKEPNRELWEYLAGVIPHYQKKYG
1m7xA3          FLRNTNRILGEQVSGAVTMAEESTDFPGVSRPQDMGGLGFWYKWNLGWMHDTLDYMKLDPVYRQYHHDKL
1eh9A3          DLNDPRVVNPKEKCGYNIDAQWVDDFHHSIHAYERQGYYTDFGNLDDIVKSYKDVFVYDGKYSNFRRKTH
1a47A4          WQKNFMDSILSYRPVFTFGEWFLGTNEIDVNNTYFANESGMSLLDFRFSQKVRQVFRDNTDTMYGLD---
1bvzA3          FWREFRRLVKSLNPDALIVGEIWHDASG-----WLMGDQFDSVMNYLFRESVIRFFATGEIHAERFDA-E
1h3gA3          FLTEYTRRLXAEYPRLNXVGEEWSTRVPVVARWQRGKANFDGYTSHLPSXDFPLVDAXRNALSKTGEENG
1iv8A2          LMSWKNPPSYRRFFDVNTLIGVNVEXDHVFQESHSXILDLDVD---GYRIDHIDGLYDPEKYINDLRSII
1c7sA3          WAKSQVCQTMIKEGKVADMEHLPSYFQEVSKLVKAHGIDRMQAWQDGLKDAESSKAFATSRVGVNFWDTL
1g5aA2          LIRAFNAVMRIAAPAVFFKSEAIVHPDQVVQYIGQDECQIGYTREVNLLHQALTYRHNLPEHTAWSHDDI
1bliA2          DIDYDHPDVAAEIKRWGTWYANELQLDGFRLDAVKHIKFSFLRDWVNHVREKTGKLHYQFHAASTQGGGY
1wzaA2          LVGE--------------------VWDISETVAPYFKYGFDSTFNFKLAEAVIATAKAGFPFGFNKKAKH
1lwhA2          HMRDTIEQNVRFWKYFLSDLKGLAEIWAEARMVDEHGRIFGYMLNFDTSHCIKEAVWKENTRVLIESIER
1amyA2          AVAEIWTSLAYGGDGKPNLNQDQHRQELVNWVDKVGGKGPATTFDF-TTKGILNVAVEGELWRLRGTDGK
1bf2A3          SNVAINRILREFTVRPAAGGSGLEPWAIGGNSYQLGGFPQGWSEWNGLFRDSLRQAQNELGSMTIYVTQD
1r7aA2          VKRGLEILIEVHSYYKKQVEIASKVDRVYDFALPPLLLHALSTGHVEPVAHWTDIRPNNAVTVLDTHDGI
1m53A2          YIQEMNRKVLS-RYDVATAGEIFGVPLDR---SSQFFDRRRHELNMAFMFDLIRLD--RDSNERWRHKSW
1gcyA2          ---------------SFCVGELWKGPSEYPNWDWRNTASWQQIIKD--WSDRAKCPVFDFALKERMQNGS
1mwoA2          GYGAWVVRDWLNWWGGWAVGEYWDTNVDALLSWAYE--SGAKVFDFPLYYKMDEAFDNNNIPALVYALQN
1m7xA2          ----------------------------------------------------------------------
1bagA2          I-----------LQDSASRDAAYANYMDVTASNYGHSIRSALKNRNLGVSNISHYASDVSADKLVTWV--
1aqhA2          --------------EAVGASEYLSTGLVTEFKYSTELGNTFRNGSLAWLSNFGEGWGFMPSSSAVVFV--
2aaaA2          YQKVLDGVLNYP---------------------------IYWQLLYAFESSSGSISNLYNMIKSVASDCS
1uuqA           WVHAAAAYIKTLDAHHLVMGSVNDMQVFIDAHATPDIDYLTYHMWIRNWSWFDKTKPAETWPSAWEKAQN
1nouA1          YIQKVLDIIATINKGSIVWQEVFDDKAKLAPGT------IVEVWKDSAYPEELS----------------
1px8A2          CGDFLNFCYEENVPVDFVSRHAYTSKQGEYTPHLIYQEIMPSEYMLNEFKTVREIIKNSHFPNLPFHITE
1m7xA1          ----------------------------------------------------------------------
1ktbA2          NLWRNYDDIQDSWDSVLSIVDWFFTNQDVLQPFAGPGHWNDPDMLIIGNFGL-----SYEQSRSQMALWT
1bhwA           ADPEVQEALAASKVAELKTPTLNPGEGYAELLAD------------------------------------
1zy9A2          FRKGIETIRKAVGEDSFILGCGSPLLP-----------AVGCVDGXRIGPDTAPFWGEHIEDNGAPAARW
1hp4A1          FMKRVQPIVAKYGKTVVGWHQLAGAEPVEG------------ALVQYWGLDRTGDAEKAEVAEAARNGTG
2ot9A1          GQHE------------------------------------------------------------------
2c0hA1          AIKEVDPGAMVTVGSWNMKADTDAMGFHNLYSDHCLVKAGGKQSGTLSFYQVHTYDWQNHFGNESPFKHS
1r8lA           ----------VALHFTNPETSGRYAWIAETLHRHHVDYDVFASSYYPFWHGTLKNLTSVLTSVADTYGKK
1cz1A           YWNNFLTVAEGQWNVVVDHHHYQVFSGGELSRNINDHISVACNWGWDAKKESHWNVAGEWSAALTDC---
1qnoA           STGDGAYPYTYGEGTDFAKNVQIKSLDFGTFHLYPDSWGTNYTWGNGWIQTHAAACLAAGKPCVFEEYGA
1chkA           ----------------------------------------------------------------------
1bf2A1          ----------------------------------------------------------------------
1eceA           AVLSVNPNLLIFVEGVQSYNGDSYWWGGNLQGAGQYPVVLNVPNRLVYSAHDYATSVYPQTWFSDPTFPN
2bhuA1          ----------------------------------------------------------------------
1vjzA           DLTIENTVQSCRGYIPFSVTHYKAEWVDSKDFPVPEWPNGWHFGEYWNREKLLEHYLTWIKLRQKGIEVF
1eh9A1          ----------------------------------------------------------------------
2fhbA1          ----------------------------------------------------------------------
1tg7A5          PDGSYMQYIEDHARDAGIVVPFISNDAWAAGHNAPGTGAGAVDIYGHDSYPLGFDCANPSTWPSGNLPTY
1rh9A1          IGLEGFYGNDMRQYNPNSYIFGTNFISNNQVQGIDFTTIHMYPNQWLPGLTQEAQDKWASQWIQVHIDDS
1bqcA           PTGNTVFSIHMYYSQASTITSYLEHFVNAGLPLIIGEFGHDHSDGNPDEDTIMAEAERLKLGYISGNGGG
1edgA           VRATGGKNASRYLMCPGYVASPDGATNDYFRMPNDISGNNNKIIVSVHAYCPWNFAGLAMADGGTNAWNI
1z0mA1          ----------------------------------------------------------------------
1aqhA1          ----------------------------------------------------------------------
2hq4A1          ----------------------------------------------------------------------
2qlvB1          ----------------------------------------------------------------------
1bvzA2          ----------------------------------------------------------------------
1izjA2          ----------------------------------------------------------------------
1gviA2          ----------------------------------------------------------------------
1t92A           ----------------------------------------------------------------------
1m53A1          ----------------------------------------------------------------------
1tg7A2          DNMGLDEDWTI--------GSEDMKNPRGIIQYSSGQEASAISW--------------------------
1wzaA1          ----------------------------------------------------------------------
1uokA1          ----------------------------------------------------------------------
1ntfA           --------SKKDDPSDFLFWIGDLNVRVETNATHAKSLVDQNNIDGLMAFDQLKKAKEQKLFDGWTEPQV
1cwyA           IQEVFG--------EVPVLAEDLGVITP------------------------------------------
1pz2A1          ----------------------------------------------------------------------
2aamA1          ----------------------------------------------------------------------
1fhlA           ----------------------------------------------------------------------
1wu4A1          ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           TFSMVYHYSEKFILSISHDEVVHGKKSLINKMWGDLWNKYAGLRLYMSYMIGHPGKKLIFMGSEFVQFVE
2fhbA5          PGGYAADPTEVVNYVSKHDNQTLWDMSYKAAQEADLDTRVRMQAVSLATVMLGQGIAFDQQGSELLRSKS
1gjuA2          IDGARLDMGHALPKELLDLIIKNVKEYPAFVMIAEELDMEKDKASKEAGYDVILGSSWYFAGRVEEIGKL
1m7xA3          TFGILYNYTENFVLPLSHDEVVHGKKSILDRMPGDAWQKFANLRAYYGWMWAFPGKKLLFMGNEFAQGRE
1eh9A3          GEPVGELDGCNFVVYIQNHDQVGN---RGKGERIIKLVDRESYKIAAALYLLSPYIPMIFMGEEYGEENP
1a47A4          --SMIQSTASDYNFINDMVTFIDNHDMDRFYNGGSTRPVEQ----ALAFTLTSRGVPAIYYGTEQYMTGN
1bvzA3          LTRARMLYPEQAAQGLWNLLDSHDTERFLTSCGGNEAKF----RLAVLFQMTYLGTPLIYYGDEIGMAGA
1h3gA3          LNEVYETLSLDYLYPEPQNLVLFGGNHDXARXFSAAGEDFDRWRXNLVFLXTXPRIPQFYSGDEIDFPGG
1iv8A2          ----------------------------------------------------------------------
1c7sA3          YWGGWANKGYEVVVSNPDYVYMDFPYEVNPDERGYYWGRFSDERKVFSFAPDNMPQNAETSVDRDGNHFN
1g5aA2          GWTFADEDAAYLGISGTGDCRVSGTAAALVGLAQDDPHAVDRIKLLYSIALSTGGLPLIYLGDEVGTDSR
1bliA2          DMRKLLNGTVVSKHPLKSVTFVDNHDTQPGQSLESTVQTWFKPLAYAFILTRESGYPQVFYGDMYGTKGD
1wzaA2          IYGVYDREVGFGNYIDAPFLTNHDQNRILDQLGQDRNKA----RVAASIYLTLPGNPFIYYGEEIGMRGQ
1lwhA2          AVIAKDYLPVNFTSNHDMS----------RLASFEGGFSKEKIKLSISILFTLPGVPLVFYGDELGMKGV
1amyA2          APGMIGWWPAKAVTFVDNHD--------TGSTQHMWPFPSDRVMQGYAYILTHPGTPCIFYDHFFDWGLK
1bf2A3          ANDFSGSPWNSINFIDVHDGMTLKDVYSCNGGTGAAVDQRRAARTGMAFEMLSAGTPLMQGGDEYLRTLQ
1r7aA2          GVIDIGSDDRSLKGLVPDEDVDNLVNTIHANTHGESQAATGAYIAARAVQFFLPGVPQVYYVGALAGKND
1m53A2          SLSQFRQIISKMDVTVGKYGWNTFFLDNHDNPFGDDRPQWASAKALATITLTQRATPFIYQGSELGMTNY
1gcyA2          IADWKHGLNGNPDPRWREVAVTFVDNHDTGYSPGHWALQDGLIRQAYAYILTSPGTPVVYWDHMYDWGYG
1mwoA2          GQTVVSRDPFKAVTFVANHDTDI----------------IWNKYPAYAFILTYEGQPVIFYRDFEEWLNK
1m7xA2          ----------------------------------------------------------------------
1bagA2          ---------------ESHDTYAND------DEESTWMSDDDIRLGWAVIASRSGSTPLFFSRPEGGGNGV
1aqhA2          ---------------DNHDQRGHGGAGNVITFEDGRLYDLANVFMLAYPY----GYPKVMSSYDFHGDTD
2aaaA2          DPTLLGNFIE------NHD----------NPRFAKYTSDYSQAKNVLSYIFLSDGIPIVYAGEEQHYAGG
1uuqA           YMRAHIDVAKQLNKPLVLEEFGLDRDMGSYAMDSTTEYRDNYFRGVFELMLASLEQGEPSAGYNIWAWNG
1nouA1          -----RVTASGFPVILSAPWYLDL------ISYGQDWRKYYKVEPL--DFGGTQKQKQLFIGGEACLWGE
1px8A2          YNTSYSPQNPVHDTPFNAAYIARILSEGGDYVDSFSYWTFSDVFERDVPRSQFHGGFGLVA---------
1m7xA1          ----------------------------------------------------------------------
1ktbA2          IMAAPLLMSTDLRTISPSA---------------------------------------------------
1bhwA           ----------------------------------------------------------------------
1zy9A2          ALRNAITRYFXHDRFWLNDPDCLILREEKTDLTQKEKELYSYTCGVLDNXIIESDDLSLVRDHGKKVLKE
1hp4A1          LILSPA------------DRTYLDMKYTKDTPLGLSWAGYVEVQRSYDWDYLPGAPADAVRGVEAPLWTE
2ot9A1          ----------------------------------------------------------------------
2c0hA1          FSNFRLKK------PMVIGEFNQEHGA--GMSSESMFEWAYTKGYSGAWTWSRTDVSWNNQLRGMQHLKS
1r8lA           VMVAETSYTYTAED-GDGHGNTAPKNGQTLNNPVTVQGQANAVRDVIQAVSDVGEAGIGVFYWEPAWIPV
1cz1A           -----AKWLNGVNRGARYEGAYDNAPYIGSCQPLLDISQWSDEHKTDTRRYIEAQLDAFEYTGGWVFW-S
1qnoA           QQNPCTNEAPWQTTSLTTRGMGGD----MFWQWGDTFANGAQSNSDPYTVWYNSSN--------------
1chkA           ----------------------------------------------------------------------
1bf2A1          ----------------------------------------------------------------------
1eceA           NMPGIWNKNWGYLFNQNIAPVWLGEFGTTLQSTTDQT----WLKTLVQYLRPTAQYGADSFQWTFWSWNP
2bhuA1          ----------------------------------------------------------------------
1vjzA           CGEXGAYNKTPHDVVLKWLE-DLLEIFKTLNIGFALWNFRGPFGILDSERKDVE----------------
1eh9A1          ----------------------------------------------------------------------
2fhbA1          ----------------------------------------------------------------------
1tg7A5          FHTSHEQQSPSTPYSLVEFQGGAFDPWGGVGFAKCAALLNHEFERVFYKNDFSFGVAFLNLYMIFGGTNW
1rh9A1          KMLKKPLLIAEFGKSTKTPGYTV-------------AKRDNYFEKIYGTIFNCAKSGGPCGGGLFWQVLG
1bqcA           VEYLDMVYNFDGDLSPWGERIFYGPNGIASTA--------------------------------------
1edgA           NDSKDQSEVTWFMDNIYNKYTSRGIPVIIGECGAVDKNNLKTRVEYMSYYVAQAKAR--GILCILWDNNN
1z0mA1          ----------------------------------------------------------------------
1aqhA1          ----------------------------------------------------------------------
2hq4A1          ----------------------------------------------------------------------
2qlvB1          ----------------------------------------------------------------------
1bvzA2          ----------------------------------------------------------------------
1izjA2          ----------------------------------------------------------------------
1gviA2          ----------------------------------------------------------------------
1t92A           ----------------------------------------------------------------------
1m53A1          ----------------------------------------------------------------------
1tg7A2          ----------------------------------------------------------------------
1wzaA1          ----------------------------------------------------------------------
1uokA1          ----------------------------------------------------------------------
1ntfA           TFKPTYKFKPNTDEYDLSATPSWTDRALYKSGTGKTIQPLSYNSLTNYKQTEH-----------------
1cwyA           ----------------------------------------------------------------------
1pz2A1          ----------------------------------------------------------------------
2aamA1          ----------------------------------------------------------------------
1fhlA           ----------------------------------------------------------------------
1wu4A1          ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           WREYEQLQWQVVDQYESHKQTLHFFKKLNDLYHNETALWQCDYDHHGFRWIDADNSQQSILSFIRSSKDN
2fhbA5          FTRDSYDSGDWFNRV-DYSLQDNNYNVGMPRSSDDGSNYDIIARVKDAVATPGETELKQMTAFYQ-----
1gjuA2          PDIAEELVLP-FLASVETPDTPRIATRKYASKMKKLAPFVTYFLPNSIPYVNTGQEIGEKQPMNLGLD-T
1m7xA3          WNHDASLDWHLLEGDNWHHGVQRLVRDLNLTYRHHKAMHELDFD--------------------------
1eh9A3          FYFFSDFSDSKLIQG------------VREGRKKENGQDTDPQDESTFNASKLSWKDEEIFSFYK-----
1a47A4          GDPYNR---AMMTSFNTSTTAYNVIKKLAPLRKSNPAIA-------------------------------
1bvzA3          TDPDCRRPMI-WEEKEQNRGLFEFYKELIRLRHRLASLTR------------------------------
1h3gA3          WAGDKANAFSGAGLTSQQRAAQDLVRKLANWRKNQPVI--------------------------------
1iv8A2          ----------------------------------------------------------------------
1c7sA3          AKSDKPWPGAYGLSQLWSETQRTDPQMEYMIFPRALSVAERSWHRAGWEQDYRAGREYK-----------
1g5aA2          WAHRPRYNEQRNDPSTAAGQIYQDLRHMIAVRQSNPRF--------------------------------
1bliA2          SQREIPALKHKIEPI-------------------------------------------------------
1wzaA2          GPHYNDGFTSVEQEEKNLDSLLNHYRRLIHFRNENPVFY-------------------------------
1lwhA2          YQKP---------NTEVVLDPFPWNESMCVEGQTFWKWPAYNGPFSGISVEYQKRDPDSILSHTL-----
1amyA2          EEIDRLVSVRTRHG--------------------------------------------------------
1bf2A3          CNNNSSANWLTYSWTTDQSNFYTFAQRLIAFRKAHPALRPSSW---------------------------
1r7aA2          MELLRYYSTAEI-DENLKRPVVKALNALAKFRN-------------------------------------
1m53A2          PFRQLN-EFDDIEVKGFWQDYVQSGKVTATEFLDNVRLTSRDNSRTPFQWNDTLN---------------
1gcyA2          DFIRQLIQV-------------------------------------------------------------
1mwoA2          DKLINLIAGGSTTIVYYDNDELIFVRNGDSR---------------------------------------
1m7xA2          ----------------------------------------------GFEWLVVDDKERSVLIFVRRDKE-
1bagA2          RFPGKSQIGDRGSALFEDQAITAVNRFHNVM---------------------------------------
1aqhA2          A---------------------------------------------------------------------
2aaaA2          KVPYNREATW-LSGYDTSAELYTWIATTNAIRKLAIAA--------------------------------
1uuqA           YGRTTRANYWWQEGDD-FMGDPPQEEQGMYGVFDTDTSTI------------------------------
1nouA1          YVDATNLTPRLWPRSKDVRDMDDAYDRLTRHRCRMVERG-------------------------------
1px8A2          ----------------------------------------------------------------------
1m7xA1          ----------------------------------------------------------------------
1ktbA2          ----------------------------------------------------------------------
1bhwA           ----------------------------------------------------------------------
1zy9A2          TLELLGGRPRVQNIXSEDLRYEIVSSGTLS----------------------------------------
1hp4A1          TSDPDQLDYMAFPGVAELGWSPASTHDWDTYKVRLAAQA-PYWEAAGIDFYRSPQVP-------------
2ot9A1          ----------------------------------------------------------------------
2c0hA1          R---------------------------------------------------------------------
1r8lA           GPAHRLEKNKALWETYGSGWATSYA--AEYDPEDA-GKWFGGSAVDNQALFDFKGRPLPSLHVFQYVDTG
1cz1A           WKTENAPEW-------------------------------------------------------------
1qnoA           ----------------------------------------------------------------------
1chkA           ----------------------------------------------------------------------
1bf2A1          ----------------------------------------------------------------------
1eceA           DSGDTGGIL-KDDWQTVDTVKDGYLAPIKSSIFD------------------------------------
2bhuA1          ----------------------------------------------------------------------
1vjzA           ----------------------------------------------------------------------
1eh9A1          ----------------------------------------------------------------------
2fhbA1          ----------------------------------------------------------------------
1tg7A5          GNLGHPGGYTSYD---------------------------------------------------------
1rh9A1          QGMSSFDDG-YQVVLQESPSTSRVILLQSLRL--------------------------------------
1bqcA           ----------------------------------------------------------------------
1edgA           FSGTG-----------------------------------------------------------------
1z0mA1          ----------------------------------------------------------------------
1aqhA1          -----------------------------------------------WAVTNWWDNTNNQISFGRGSS--
2hq4A1          ----------------------------------------------------------------------
2qlvB1          ----------------------------------------------------------------------
1bvzA2          -----------------------------------------------VRSWHADK-QANLYAFVR--TVQ
1izjA2          -----------------------------------------------FMTLITDDTNK-IYSYGR--FDN
1gviA2          -----------------------------------------------VAFLTADDEVN-HLVYAKTDGN-
1t92A           ----------------------------------------------------------------------
1m53A1          -----------------------------------------------YQDLNPQD--NTVYAYTRTLGN-
1tg7A2          ----------------------------------------------------------------------
1wzaA1          -----------------------------------------------IEIINGGLN---VVAFRR--YND
1uokA1          -----------------------------------------------YDLILENN--PSIFAYVR--TYG
1ntfA           ----------------------------------------------------------------------
1cwyA           ----------------------------------------------------------------------
1pz2A1          -------------------------------FKIAGVALHPVISSPKYDSKDFTDVPYLESIAVYN-EEK
2aamA1          ----------------------------------------------------------------------
1fhlA           ----------------------------------------------------------------------
1wu4A1          ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           KQKLIFICNFTPVTYYDYHLGVPDAGSYKEVFNSDNLEFGGSGQVMATEIFSSPQSSHGFEQRITIKIPP
2fhbA5          --ELTALRKSSPL---------------------------------------------------------
1gjuA2          DPNLRKVLSPTDEFFGKLAFFDHYVLHWDSPDRGV-----------------------------------
1m7xA3          ----------------------------------------------------------------------
1eh9A3          --ILIKMRKELSIA--------------------------------------------------------
1a47A4          ----------------------------------------------------------------------
1bvzA3          ----------------------------------------------------------------------
1h3gA3          ----------------------------------------------------------------------
1iv8A2          ----------------------------------------------------------------------
1c7sA3          ----------------------------------------------------------------------
1g5aA2          ----------------------------------------------------------------------
1bliA2          ----------------------------------------------------------------------
1wzaA2          ----------------------------------------------------------------------
1lwhA2          ----------------------------------------------------------------------
1amyA2          ----------------------------------------------------------------------
1bf2A3          ----------------------------------------------------------------------
1r7aA2          ----------------------------------------------------------------------
1m53A2          ----------------------------------------------------------------------
1gcyA2          ----------------------------------------------------------------------
1mwoA2          ----------------------------------------------------------------------
1m7xA2          GNEIIVASNFTPVPRHDYRFGINQPGKWREILNTDSMHYHGSNAGNGGTVHSDEIASHGRQHSLSLTLPP
1bagA2          ----------------------------------------------------------------------
1aqhA2          ----------------------------------------------------------------------
2aaaA2          ----------------------------------------------------------------------
1uuqA           ----------------------------------------------------------------------
1nouA1          ----------------------------------------------------------------------
1px8A2          ----------------------------------------------------------------------
1m7xA1          ----------------------------------------------------------------------
1ktbA2          ----------------------------------------------------------------------
1bhwA           ----------------------------------------------------------------------
1zy9A2          ----------------------------------------------------------------------
1hp4A1          ----------------------------------------------------------------------
2ot9A1          ----------------------------------------------------------------------
2c0hA1          ----------------------------------------------------------------------
1r8lA           ----------------------------------------------------------------------
1cz1A           ----------------------------------------------------------------------
1qnoA           ----------------------------------------------------------------------
1chkA           ----------------------------------------------------------------------
1bf2A1          ----------------------------------------------------------------------
1eceA           ----------------------------------------------------------------------
2bhuA1          ----------------------------------------------------------------------
1vjzA           ----------------------------------------------------------------------
1eh9A1          ----------------------------------------------------------------------
2fhbA1          ----------------------------------------------------------------------
1tg7A5          ----------------------------------------------------------------------
1rh9A1          ----------------------------------------------------------------------
1bqcA           ----------------------------------------------------------------------
1edgA           ----------------------------------------------------------------------
1z0mA1          ----------------------------------------------------------------------
1aqhA1          ---GHMAINKEDSTLTTVQTDMAS-GQYCNVLKGELSADAKSC--------SGEVITVNSDGTINLNIGA
2hq4A1          ----------------------------------------------------------------------
2qlvB1          ----------------------------------------------------------------------
1bvzA2          DQHVGVVLNNRGEKTVLLQVPESGGKTWLDCLTGE--------------------EVHGKQGQLKLTLRP
1izjA2          VNRIAVVLNNDSVNVPVWQLSMPNGSTVTDKITGHSYTVQNGMVTV------------------------
1gviA2          -ETVMIIINRSNEAAEIPMPIDARGKWLVNLLTGE--------------------RFAAEAETLCVSLPP
1t92A           ----------------------------------------------------------------------
1m53A1          -ERYLVVVNFKEYPV---RYTLPANDAIEEVVIDT-------------------QQQAAAPHSTSLSLSP
1tg7A2          ----------------------------------------------------------------------
1wzaA1          KRDLYVYHNLVNR---PVKIKVA-SGNWTLLFNSGDKEITPVED----------------NNKLMYTIPA
1uokA1          VEKLLVIANFTAEEC-IFELPEDISYSEVELLIHNYDVENGPI--------------------ENITLRP
1ntfA           ----------------------------------------------------------------------
1cwyA           ----------------------------------------------------------------------
1pz2A1          EEVTIFAVNRDMEDALLLECDVRSFEDYRVIEHIVL----EHDNVKQTNSAQSSPDAQLSDRKVSATLPK
2aamA1          ----------------------------------------------------------------------
1fhlA           ----------------------------------------------------------------------
1wu4A1          ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           MATLVLKLIK
2fhbA5          ----------
1gjuA2          ----------
1m7xA3          ----------
1eh9A3          ----------
1a47A4          ----------
1bvzA3          ----------
1h3gA3          ----------
1iv8A2          ----------
1c7sA3          ----------
1g5aA2          ----------
1bliA2          ----------
1wzaA2          ----------
1lwhA2          ----------
1amyA2          ----------
1bf2A3          ----------
1r7aA2          ----------
1m53A2          ----------
1gcyA2          ----------
1mwoA2          ----------
1m7xA2          LATIWLVREA
1bagA2          ----------
1aqhA2          ----------
2aaaA2          ----------
1uuqA           ----------
1nouA1          ----------
1px8A2          ----------
1m7xA1          ----------
1ktbA2          ----------
1bhwA           ----------
1zy9A2          ----------
1hp4A1          ----------
2ot9A1          ----------
2c0hA1          ----------
1r8lA           ----------
1cz1A           ----------
1qnoA           ----------
1chkA           ----------
1bf2A1          ----------
1eceA           ----------
2bhuA1          ----------
1vjzA           ----------
1eh9A1          ----------
2fhbA1          ----------
1tg7A5          ----------
1rh9A1          ----------
1bqcA           ----------
1edgA           ----------
1z0mA1          ----------
1aqhA1          WDAMAIHK--
2hq4A1          ----------
2qlvB1          ----------
1bvzA2          YQGMILWNGR
1izjA2          ----------
1gviA2          YGFVLYAV--
1t92A           ----------
1m53A1          WQAGVYKL--
1tg7A2          ----------
1wzaA1          YTTIVLE---
1uokA1          YEAMVFKL--
1ntfA           ----------
1cwyA           ----------
1pz2A1          LSWNVIRLGK
2aamA1          ----------
1fhlA           ----------
1wu4A1          ----------