[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for ftul2:ACD30613.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1ea0A2.bssp"
#ERROR : Can't open dsspfile "2p3pA1.bssp"
#ERROR : Can't open dsspfile "1dorA.bssp"
#ERROR : Can't open dsspfile "2a4aA1.bssp"
#ERROR : Can't open dsspfile "1d3gA.bssp"
#ERROR : Can't open dsspfile "1j2wA.bssp"
#ERROR : Can't open dsspfile "1jcjA.bssp"
#ERROR : Can't open dsspfile "1xrsB1.bssp"
#ERROR : Can't open dsspfile "1p0kA.bssp"
#ERROR : Can't open dsspfile "1znnA1.bssp"

## Summary of PDB Search
:528
    7e-53  29%  1ea0A2 [c.1.4.1] GLUTAMATE SYNTHASE [NADPH] LARGE CHAIN A:423 --
    3e-40  12%  2p3pA1 [d.383.1.1] HYPOTHETICAL PROTEIN A:66 -- 262
    7e-13  13%  1dorA  [c.1.4.1] DIHYDROOROTATE DEHYDROGENASE A
    3e-09   8%  2a4aA1 [c.1.10.1] DEOXYRIBOSE-PHOSPHATE ALDOLASE A:3 -- 258
    9e-09  11%  1d3gA  [c.1.4.1] DIHYDROOROTATE DEHYDROGENASE
    1e-08  15%  1j2wA  [c.1.10.1] ALDOLASE PROTEIN
    9e-07  15%  1jcjA  [c.1.10.1] DEOXYRIBOSE-PHOSPHATE ALDOLASE
    8e-06  13%  1xrsB1 [c.23.6.1] D-LYSINE 5,6-AMINOMUTASE BETA SUBUNIT B:102 --
    5e-05  23%  1p0kA  [c.1.4.1] ISOPENTENYL-DIPHOSPHATE DELTA-ISOMERASE
    3e-04  10%  1znnA1 [c.1.2.6] PLP SYNTHASE A:18 -- 271
:528

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1ea0A2          ----------------------------------------------------------------------
2p3pA1          ----------------------------------------------------------------------
1dorA           ----------------------------------------------------------------------
2a4aA1          ----------------------------------------------------------------------
1d3gA           ----------------------------------------------------------------------
1j2wA           ----------------------------------------------------------------------
1jcjA           ----------------------------------------------------------------------
1xrsB1          ----------------------------------------------------------------------
1p0kA           ----------------------------------------------------------------------
1znnA1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxDEIET
1ea0A2          -----------------------------------------------------------------DLLEL
2p3pA1          ----------------------------------------------------------------------
1dorA           ----------------------------------------------------------------------
2a4aA1          ----------------------------------------------------------------------
1d3gA           -----------------------------------------------------------------DSDML
1j2wA           ----------------------------------------------------------------------
1jcjA           ----------------------------------------------------------------------
1xrsB1          ----------------------------------------------------------------------
1p0kA           ----------------------------------------------------------------------
1znnA1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           RVKIGGSDCKQPYMASHLNISAMSFGALSANAVMALNKGAKLGGFYQCTGEGGLTKYHLQGGDLVFQIGT
1ea0A2          RSTKAPVPVDEVESITAIITPGMSMGALSPEAHGTLNVAMNRIGAKSDSGEGGEDPARFRPDKAIKQVAS
2p3pA1          --------------------------AGELERC-FLAXPESVLPIVTXEERNDLCRRAGHSGFTHTASLE
1dorA           NTTFANAKFANPFM-----NASGVHCMTIEDLEELKASQAGAYITKSSTLEKREGNPLDLELGSINSMGL
2a4aA1          ----------------------------------------------------------------------
1d3gA           EVRVLGHKFRNPVG-----IAAGFDKHGEAVDGYKMGFGFVEIGSVTPKPQEGNPRPRVFDQAVINRYGF
1j2wA           ----------------------------------------------------------------------
1jcjA           ----------------------------------------------------------------------
1xrsB1          ----------------------------------------------------------------------
1p0kA           ----------------------------------------------------------------------
1znnA1          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           GYFGCRTDDGKFSAEKFVEKANLDSVKMIEIKLSQGAKPSHGGVLPAAKITPEIAEIRGVSMGKDVLSPP
1ea0A2          GRFGVTAEY-------------LNQCRELEIKVAQGAKPGEGGQLPGFKVTEMIARLRHSTPGVMLISPP
2p3pA1          SSLGGTVTF-------------LLNRNFIRIQTSTVGE-----------VFXRILPFSDSSSVICVVTTV
1dorA           PNLGFDYYLDY-------VLKNQKENAQEGPIFFSIAGMSAAENIAMLKKIQESDFSGITELNLSCPNVP
2a4aA1          --------------------------NPFKPKIACVINFPYGTDSMEKVLNDTEKALDDGADEIDLVINY
1d3gA           NSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTA
1j2wA           --------------------------PHAPFRLVTVVGFPLGYQEKEVKLEAALACARGADE-VDMVLHL
1jcjA           -----------------IARKTLKEQGTPEIRIATVTNFPHGNDDIDIALAETRAAIAYGADEVDVVFPY
1xrsB1          -----------------------EILSMEETDEYIKENIGRKIVVVGASTGTD-----------------
1p0kA           ----------------------------------------------------------------------
1znnA1          --------------------ADPTVIEEVAVSIPVMAKVRIGHYVEARVLEALGVDYIDE-SEVLTPADE


                         .         *         .         .         .         .         +:350
query           AHSAFSTPIEFCYFIKQLRDLSNGKPIGFKLCIGSHVEFLAICKAMLETGIRPDFITVXXXXXXXXXXPL
1ea0A2          PHHDIYSIEDLAQLIYDLKQINPDAKVTVKLVSRSGIGTIAAGVAKAN----ADIILISGNSGGTGASPQ
2p3pA1          LHPVADSRIDFYEWKPLKTDRFWQQPRIEDFFLPHTDRQ-SYAYQAIYASLTPSYXQVLSEESDTLSIRQ
1dorA           GKPQLAYDFEATEKLLKEVFTFFTKPLGVKLPPYDLVHFDIMAEILNQFPL--TYVNSVNSIGNGLFIDP
2a4aA1          KKIIENTDEGLKEATKLTQSVLTNKILKVIIEVGTEDLIIKTTLAVLNGNADFIKTS-----------TG
1d3gA           GLGKAELRRLLTKVLQERDGLRRRPAVLVKIAPDLTSQDEDIASVVKELGI--DGLIVTNTTVSRPAGLQ
1j2wA           GRAKAGDLDYLEAEVRAVREAVPQAVLKVILETGSPEEIARLAEAAIRGGA--DFLKT------------
1jcjA           RALMAGNEQVGFDLVKACKEACAAANVLLKVIIEDEALIRKASEISIKAGA--DFIKTSTGKVAVNATPE
1xrsB1          ----------------------------------------------------------------------
1p0kA           ---------------------------------------------------------------------I
1znnA1          EFVPFVCGCRDLGEARRIAEGASMLRTKGEPGTGNIVEAVRHMRKVNAQIRKVVNMSED-----------


                         .         .         .         .         *         .         .:420
query           EFSNHIGMPLEDSLIFVHNALVGCGLRDEIRIIASSKVATGFDMVRLFAMGADTCNSARAMMLAIGCIQS
1ea0A2          TSIKFAGLPWEMGLSEVHQVLTLNRLRHRVRLRTDGGLKTGRDIVIAAMLGAEEFGIGTASLIAMGCIMV
2p3pA1          TVTETLAEE--------EKPLAAIFLSPEPLVWQSGRF--------------------------------
1dorA           EAESVVIKPKDGFGGIGGAYIKPTALANEIQIIGTGGIETGQDAFEHLLCGATMLQIGTALH--------
2a4aA1          KVQINATPSSVEYIIKAIKEYIKNEKNNKIGLKVSGGISDLNTASHYILLARRFLSDNFRIGSSSLVIKL
1d3gA           GALRSETGGLSGKPLRDTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVG
1j2wA           ----STGFGPRGASLEDVALLVRV-AQGRAQVKAAGGIRDRETALRMLKAGASRLGTSSGVALV------
1jcjA           SARIMMEVIRD------------MGVEKTVGFLPAGGVRTAEDAQKYLAIADELFDWADARHYRFG----
1xrsB1          ----------------------------------------------------------------------
1p0kA           SFFNSWGISTAASLAEIRSEF------PASTMIASGGLQDALDVAKAIALGASCTGMAGHFLKAL-----
1znnA1          ---ELVAEAKQLGAPVEVLREIKRLGRLPVVNFAAGGVTTPADAALMMHLGADGVFVGSGIF--------


                         .         .         +         .         .         .         .:490
query           RQCNNNTCPVGVATQNPRLEKALVVEDKMYRVYNFHKATIQSCLEIIGAMGLISTDDxxxxxxxxxxxxx
1ea0A2          RQCHSNTCPVGVCVQDDKLRQKFVGTPEK--VVNLFTFLAEEVREILAGLGFRSLNE-------------
2p3pA1          ----------------------------------------------------------------------
1dorA           ----------------------------------------------------------------------
2a4aA1          RKVIS-----------------------------------------------------------------
1d3gA           KVKRELLKEQGFGGV-------------------------------------------------------
1j2wA           ----------------------------------------------------------------------
1jcjA           ----------------------------------------------------------------------
1xrsB1          ----------------------------------------------------------------------
1p0kA           ----------------------------------------------------------------------
1znnA1          ----KSENPEKYAR---AIVEATTHYEDYELIAHL-----------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1ea0A2          --------------------------------------
2p3pA1          --------------------------------------
1dorA           --------------------------------------
2a4aA1          --------------------------------------
1d3gA           --------------------------------------
1j2wA           --------------------------------------
1jcjA           --------------------------------------
1xrsB1          --------------------------------------
1p0kA           --------------------------------------
1znnA1          --------------------------------------