[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for ftul2:ACD30665.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1g8tA.bssp"
#ERROR : Can't open dsspfile "2o3bA1.bssp"

## Summary of PDB Search
:354
    8e-59  32%  1g8tA  [d.4.1.2] NUCLEASE SM2 ISOFORM
    2e-53  32%  2o3bA1 [d.4.1.2] NUCLEASE A:35 -- 274
:354

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1g8tA           ----------------------------------------------------------------------
2o3bA1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxCHGFLAYGNPSYGVTDGLGQANL
1g8tA           ----------------------------------------------------AVGCPTGG------SSNV
2o3bA1          -----------------------------------------------ISVHLLLGNPSGATPTKLTPDNY


                         +         .         .         .         .         *         .:210
query           YLCRDGYVVGYNYQTKEASWVAFELTKSKVANHLKRDDRFKEDSDVPFVYRATLDDYSRSGYDRGHLASY
1g8tA           SIVRHAYTLNNNSTTKFANWVAYHITKDTPAS--GKTRNWKTDPALNPADTLAPADYTGANVDRGHQAPL
2o3bA1          LMVKNQYALSYNNSKGTANWVAWQLNSSWLGN-AERQDNFRPDKTLPAGWRVTPSMYSGSGYARGHIAPS


                         .         .         .         +         .         .         .:280
query           ASMDFSKKSADQSFLLSNMSPQKAGLNRQGWERLETDERIWANMYDSIYVYTGPIYKKQKIHKTIGDNKI
1g8tA           ASLAGV-SDWESLNYLSNITPQKSDLNQGAWARLEDQERKLIDRADSVYTVTGPLYER-DMGKLPGTQKH
2o3bA1          ADRTKTTEDNAATFLMTNMMPQTPDNNRNTWGNLEDYCRELVSQGKELYIVAGPNGS----LGKPLKGKV


                         .         *         .         .         .         .         +:350
query           AVPDYFFKIIYVPSKNQAIAFVMPNARVEKTKIANYRVSIKDIEQCTGLHFLTNISNRDAVINSxxxxxx
1g8tA           TIPSAYWKVIFIPAVNHYAAFLFDQNTPKGADFCQFRVTVDEIEKRTGLIIWAGLPDVQASLKS------
2o3bA1          TVPKSTWKIVVVLDSPRVIAVNIPNDPELNNDWRAYKVSVDELESLTGYDFLSNVSNIQTSI--------


                         .         .         .         .         *         .         .:420
query           xxxx
1g8tA           ----
2o3bA1          ----