[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for ftul2:ACD30738.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1fxoA.bssp"
#ERROR : Can't open dsspfile "1fwyA2.bssp"
#ERROR : Can't open dsspfile "1tzfA.bssp"
#ERROR : Can't open dsspfile "1qwjA.bssp"
#ERROR : Can't open dsspfile "1jv1A.bssp"
#ERROR : Can't open dsspfile "2cu2A2.bssp"
#ERROR : Can't open dsspfile "1yp2A2.bssp"
#ERROR : Can't open dsspfile "1e5kA.bssp"
#ERROR : Can't open dsspfile "1w77A1.bssp"
#ERROR : Can't open dsspfile "1w55A1.bssp"
#ERROR : Can't open dsspfile "1jykA.bssp"
#ERROR : Can't open dsspfile "1h3mA.bssp"
#ERROR : Can't open dsspfile "1vpaA.bssp"

## Summary of PDB Search
:287
    1e-50  27%  1fxoA  [c.68.1.6] GLUCOSE-1-PHOSPHATE THYMIDYLYLTRANSFERASE
    8e-34  24%  1fwyA2 [c.68.1.5] UDP-N-ACETYLGLUCOSAMINE PYROPHOSPHORYLASE A:3 --
    4e-32  15%  1tzfA  [c.68.1.13] GLUCOSE-1-PHOSPHATE CYTIDYLYLTRANSFERASE
    4e-29  13%  1qwjA  [c.68.1.13] CYTIDINE MONOPHOSPHO-N-ACETYLNEURAMINIC ACID
    4e-26  10%  1jv1A  [c.68.1.5] GLCNAC1P URIDYLTRANSFERASE ISOFORM 1: AGX1
    6e-26  18%  2cu2A2 [c.68.1.20] PUTATIVE MANNOSE-1-PHOSPHATE GUANYLYL A:1 -- 268
    2e-24  22%  1yp2A2 [c.68.1.6] GLUCOSE-1-PHOSPHATE ADENYLYLTRANSFERASE SMALL
    5e-24  11%  1e5kA  [c.68.1.8] MOLYBDOPTERIN-GUANINE DINUCLEOTIDE BIOSYNTHESIS
    7e-24  10%  1w77A1 [c.68.1.13] 2C-METHYL-D-ERYTHRITOL 4-PHOSPHATE A:75 -- 300
    2e-21  16%  1w55A1 [c.68.1.13] ISPD/ISPF BIFUNCTIONAL ENZYME A:3 -- 207
    4e-20  24%  1jykA  [c.68.1.13] CTP:PHOSPHOCHOLINE CYTIDYLYTRANSFERASE
    5e-15  15%  1h3mA  [c.68.1.13] 2-C-METHYL-D-ERYTHRITOL 4-PHOSPHATE
    4e-09  12%  1vpaA  [c.68.1.13] 2-C-METHYL-D-ERYTHRITOL 4-PHOSPHATE
:287

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKIRKAVFPVAGWGTRFLPATKSCPKEMLTVVDKPLIQYAVEEAIEAGCKEIIFVTSSNKKSLEDHFDRN
1fxoA           ---RKGIILAGGSGTRLHPATLAISKQLLPVYDKPMIYYPLSTLMLAGIREILIISTPQDTPRFQQ----
1fwyA2          ----SVVILAAGKGTRM---YSDLPKVLHTLAGKAMVQHVIDAANELGAAHVHLVYGHGGDLLKQALKDD
1tzfA           MAS-KAVILAGGLGVK--------PKPMVEIGGKPILWHIMKMYSVHGIKDFIICCGYKGYVIKEYFANY
1qwjA           ----AALVLARGGSKGIPL------KNIKRLAGVPLIGWVLRAALDAGVFQSVWVSTDHDEIENVAKQFG
1jv1A           QNKVAVLLLAGGQGTRLGVAYPKGMYDVGLPSRKTLFQIQAERILKLQQVAEKYYGNKCIIPWYIMTSGR
2cu2A2          MKT-YALVMAGGRGERLWPLSRDRPKPFLPLFEKTLLEATLERLAPLVPPERTLLVRRDQEAVARPYADG
1yp2A2          ----DASRSVLGIILRLYPLTKKRAKPAVPLGNYRLIDIPVSNCLNSNISKIYVLTQFNSASLNRHLSRA
1e5kA           MTTITGVVLAGGKARRMGGV----DKGLLELNGKPLWQHVADALMTQLSHVVVNANRHQEIYQASGLKVI
1w77A1          KSV-SVILLAGGSM----------PKQYIPLLGQPIALYSFFTFSRMPEVKEIVVVCDPFFRDIFEEYEE
1w55A1          ----SLIMLAAGNSTRF---NTKVKKQFLRLGNDPLWLYATKNLSSFYPFKKIVVTSSNITYMKKFT---
1jykA           ----KAIILAAGLGTRLRPLTENTPKALVQVNQKPLIEYQIEFLKEKGINDIIIIVGYLKEQF-DYLKEK
1h3mA           LDV-CAVVPAAC------------PKQYLSIGNQTILEHSVHALLAHPRVKRVVIAISP----GDSRFAQ
1vpaA           -----AILLAAGKGERM---SENVPKQFLEIEGRMLFEYPLSTFLKSAIDGVVIVTRREW---FEVVEKR


                         .         .         *         .         .         .         .:140
query           FELEYSLEKKQKYELLDLVKNIIPKDVSFFFVRQPEALGLGHAVLCAKPLVGIEDFAVILPDDLIYNHDC
1fxoA           -----------------LLGDGSNWGLDLQYAVQPSPDGLAQAFLIGESFIGNDLSALVLGDNLYYGHD-
1fwyA2          N---------------------------LNWVLQAEQLGTGHAMQQAAPFFADDEDILMLYGDVPLISV-
1tzfA           FLHMSDVTFHMAENRME-VHHKRVEPWNVTLVDTGDSSMTGGRLKRVAEYVKDDEAFLFTYGDGVADLD-
1qwjA           AQV-----------------HRRSSETS------KDSSTSLDAIVEFLNYHNEVDIVGNIQATSPCLHP-
1jv1A           T-----------MESTKEFFTKHKYFGLKKENVIFFQQGMLPAMSFDGKIILEEKNKVSMAPDGNGGLYR
2cu2A2          ----------------------------IRLLLEPLGRDTAGAVLVAEALEGAERLLVLPADHYVGDDEA
1yp2A2          YAEGFVLAAQQSPE------------------NPDWFQGTADAVRQYLWLFETVLEYLILAGDHLYRMD-
1e5kA           E------------------------------DSLADYPGPLAGMLSVMQQEAGEWFLFCPCDTPYIPPD-
1w77A1          -------------------------SIDVDLRFAIPGKERQDSVYSGLQEIDVNSELVCIHDSARPLVN-
1w55A1          ----------------------------KNYEFIEGGDTRAESLKKALELIDSEFVMVSDVARVLVSKN-
1jykA           Y------------------------GVRLVFNDKYADYNNFYSLYLVKE--ELANSYVIDADNYLF----
1h3mA           LPLAN----------------------HPQITVVDGGDERADSVLTGLKAAGDAQWVLVHDAARPCLHQ-
1vpaA           VFHE------------------------KVLGIVEGGDTRSQSVRSALEFLESPSYVLVHDSARPFLRK-


                         +         .         .         .         .         *         .:210
query           GTGTLKQMVKAVEGTDIRGCIATQQVKREKTNSYGIVAKDNDNLIKAIVEKPAPEKAPSTNAVVGRYLLP
1fxoA           ----FHELLGSASQRQTGASVFAYHV--LDPERYGVVEFDQGGKAISLEEK--PLEPKSNYAVTGLYFYD
1fwyA2          --ETLQRLRDAKP----QGGIGLLTVKLDDPTGYGRITRENGK-VTGIVEHKDATDEQRQIQEIGILIAN
1tzfA           ----IKATIDFHKAHGKKATL----TATFPPGRFGALDIQAGQ-VRSFQEKP---KGDGAMINGGFFVLN
1qwjA           --TDLQKVAEMIREE---GYDSVFSVVRRHQFRWSEIQKGVREVTEPLNLNPA--KRPRRQDWDGELYEN
1jv1A           AQNIVEDMERGIWSIHVYCGAKVVEKTNPTEPVGVVCRVDGVYQVVEYSEI--SLATAQKRSSDGRLLFN
2cu2A2          YREALATMLEAAE----EGFVVAGLRPTRPETEYGYIRLGPRERGEGFVEKPSYAEALEYIWNGGVFAFP
1yp2A2          ----YEKFIQAHRETDADITVAALPMDEKRATAFGLMKIDEEGRIIEFAEKPQGEQLQAFIASMGIYVIS
1e5kA           ---LAARLNHQRKDAPV--VWVH--DGERDHPTIALVNRAIEPLLLEYLQAGERRVMVFMRLAGGHAVDF
1w77A1          -TEDVEKVLKDGSAVGA-AVLGVPAKAT-----IKEVNSDSLVVTLWEMQTPQVI---------------
1w55A1          ---LFDRLIENLDKADCITPA----LKVADTTLFDNEALQREKIK--LIQTPQISKT-------------
1jykA           KNXFRNDLTRS----------TYFSVYREDCTNEWFLVYGDDYKVQDIIVDS------------------
1h3mA           --DDLARLLALSETSRTGGILAAPVRDTMK------RAEPGKNAIAHTVDRNGLWHALT-----PQFFPR
1vpaA           --KHVSEVLRRARETG-AATLALKNSDALVRVENDRIEYIPRKGVYRILT--------------------


                         .         .         .         +         .         .         .:280
query           NKIFRCLESTSEGAGGEIQLTDAIAKLLDQDEKILSYEFKGTRYDCGSKLGFLIANYEIALQHQELGHKx
1fxoA           QQVVDIARDLKPSPRGELEITDVNRAYLERGQ--LSVEIMGRGYDTGTHDSLLEAGQFIATLENRQGLK-
1fwyA2          GADMKLAKLTNNNAQGEYYITDIIALAYQEGREIVAVHPQR-----------------------------
1tzfA           PSVIDLIDNDATTWEQEPLMTLA------QQGELMAFEHPGFWQPMDTLRDKVYLEGLWEKGKAPWK---
1qwjA           GSFY------------FAKRHLIEMGYLQGGKMAYYEMRAEHSVDIDVDIDWPIAEQRVLRF--------
1jv1A           AGNIANHFFTVPFLRDVVNVYEPQLQHHVAQKKIPYVDTQGQLIKP------------------------
2cu2A2          ATMAELFRRHLPSHHEALERLLAGASVMEKAERVRVVLGRFPWDDVGNWRALERVF--------------
1yp2A2          KDVMLNLLRDKFPGANDF-GSEVIPGATSLGMRVQAYLYDGYWEDIGTIEAFYNANLGI-----------
1e5kA           SDHKDAF---------------------------------------------------------------
1w77A1          -KPELLKKGFELVKSEGLEVTDVS-IVEYLKHPVYVSQGSYTNIKVTTPDDLLLAERILS----------
1w55A1          -------KLLKKALDQNLEFTDDSTAIAAMGGKIWFVEGEENARKLTFKEDLKKLDLPTP----------
1jykA           ----------------------------------------------------------------------
1h3mA           ELLHDCLT---RALNEGATITDEASALEYCGFHPQLVEGRADNIKVTRPEDLALAEFYLT----------
1vpaA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxx
1fxoA           -------
1fwyA2          -------
1tzfA           -------
1qwjA           -------
1jv1A           -------
2cu2A2          -------
1yp2A2          -------
1e5kA           -------
1w77A1          -------
1w55A1          -------
1jykA           -------
1h3mA           -------
1vpaA           -------