[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for ftul2:ACD30777.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1te5A.bssp"
#ERROR : Can't open dsspfile "1ea0A3.bssp"
#ERROR : Can't open dsspfile "1q15A2.bssp"
#ERROR : Can't open dsspfile "1jgtA2.bssp"
#ERROR : Can't open dsspfile "1ct9A2.bssp"
#ERROR : Can't open dsspfile "1ao0A2.bssp"

## Summary of PDB Search
:268
    2e-22  24%  1te5A  [d.153.1.1] CONSERVED HYPOTHETICAL PROTEIN
    1e-11  13%  1ea0A3 [d.153.1.1] GLUTAMATE SYNTHASE [NADPH] LARGE CHAIN A:1 --
    8e-08  10%  1q15A2 [d.153.1.1] CARA A:2 -- 205
    9e-06  13%  1jgtA2 [d.153.1.1] BETA-LACTAM SYNTHETASE A:4 -- 209
    1e-05  24%  1ct9A2 [d.153.1.1] ASPARAGINE SYNTHETASE B A:1 -- 192
    2e-05  22%  1ao0A2 [d.153.1.1] GLUTAMINE PHOSPHORIBOSYLPYROPHOSPHATE A:1 -- 234
:268

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxQGAVPVNGDGFGVGWYTSLHKEPGVYKDPLPAWNNQN
1te5A           ---------------------------------GGGTGPHRDGWGIAFYEG--RGVRLFQDPLASVDSEV
1ea0A3          -----------------------------------------------ICSLSARSIIYKGMFLAELTTFY
1q15A2          ----------------------------------------------------------------------
1jgtA2          -------------------------------------PVLPAAFGFLASARTGG--------GPVFATR-
1ct9A2          ----------------------------------------------------------------------
1ao0A2          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           LISLAKHIKSRNFMAHVRASTIAPTSRVNCHPFTFKNHLFMHNGSIAGFDDIRQEIEQLVKPQYFKARFG
1te5A           ARLVQRFIKSETVIGHIRQANVGKVGLSNTHPFIGRYWTFAHNGQLADFQPKPGFYR----------PVG
1ea0A3          PDLLDERFESDFAIYHQRYSTNTFPTWPLAQPFRMLAHNVKGNVNWMKAHETRMEHPTHMQDLKPVIGVG
1q15A2          ------------ALSNGYLFIEQNG---HYQKCEMERGTAYLIGSLYNRTFLIGLAGV--WEGEAY---L
1jgtA2          ----GSHTDIDTPQGERSLAATLVHAPAPDRAVARSLTTAVLAGEIYNRDELLSVL-----PAGPA---P
1ct9A2          ------YASDNAILAHERLSIVDVNAGAQPLYNQQKTHVLAVNGEIYNHQALRAEYGDRYQFQ------T
1ao0A2          -----SKVKGKGAIGHVRYAT----GYENVQPLLFRSQNNAHNGNLVNATQLKQQLENQ------GSIFQ


                         +         .         .         .         .         *         .:210
query           STDSEAIFLLAVSNGLENDPKLAIVKSIEQITKIQAKNGLKESIKASIAYSNGExxxxxxxxxxxxxxxx
1te5A           ETDSEAAFCDLLNRVRRAFPEPVPVEVLLPVL-ISACDEYRKKGVFNALISDGD----------------
1ea0A3          LSDSGSLDTVFEVMVRAGRTAPMVKM--------------------------------------------
1q15A2          ANDAELLALLFTRLGANALALA------------------------------------------------
1jgtA2          EGDAELVL--------------------------------------------------------------
1ct9A2          GSDCEVILALYQEKGPE-----------------------------------------------------
1ao0A2          TSDTEVL-AHLIKRSGHFTLKDQIKNSLSML---------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1te5A           ----------------------------------------------------------
1ea0A3          ----------------------------------------------------------
1q15A2          ----------------------------------------------------------
1jgtA2          ----------------------------------------------------------
1ct9A2          ----------------------------------------------------------
1ao0A2          ----------------------------------------------------------