[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for ftul2:ACD30798.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1woqA1.bssp"
#ERROR : Can't open dsspfile "2hoeA2.bssp"
#ERROR : Can't open dsspfile "2hoeA3.bssp"
#ERROR : Can't open dsspfile "1sz2A1.bssp"
#ERROR : Can't open dsspfile "2gupA1.bssp"
#ERROR : Can't open dsspfile "2gtdA1.bssp"
#ERROR : Can't open dsspfile "2ch5A2.bssp"
#ERROR : Can't open dsspfile "2aa4A2.bssp"
#ERROR : Can't open dsspfile "1z05A3.bssp"
#ERROR : Can't open dsspfile "2aa4A1.bssp"
#ERROR : Can't open dsspfile "1nmnA.bssp"
#ERROR : Can't open dsspfile "1xc3A1.bssp"
#ERROR : Can't open dsspfile "2ap1A2.bssp"
#ERROR : Can't open dsspfile "2gupA2.bssp"
#ERROR : Can't open dsspfile "1q18A1.bssp"
#ERROR : Can't open dsspfile "2ewsA1.bssp"
#ERROR : Can't open dsspfile "1g99A2.bssp"
#ERROR : Can't open dsspfile "1xc3A2.bssp"
#ERROR : Can't open dsspfile "1z05A2.bssp"
#ERROR : Can't open dsspfile "1iv0A.bssp"
#ERROR : Can't open dsspfile "2ch5A1.bssp"
#ERROR : Can't open dsspfile "2ap1A1.bssp"
#ERROR : Can't open dsspfile "1zc6A1.bssp"
#ERROR : Can't open dsspfile "1hjrA.bssp"
#ERROR : Can't open dsspfile "1woqA2.bssp"
#ERROR : Can't open dsspfile "1q18A2.bssp"
#ERROR : Can't open dsspfile "2i7nA2.bssp"

## Summary of PDB Search
:268
    2e-19  27%  1woqA1 [c.55.1.10] INORGANIC POLYPHOSPHATE/ATP-GLUCOMANNOKINASE
    1e-16  21%  2hoeA2 [c.55.1.10] N-ACETYLGLUCOSAMINE KINASE A:200 -- 368
    2e-15  22%  2hoeA3 [c.55.1.10] N-ACETYLGLUCOSAMINE KINASE A:72 -- 199
    1e-14  15%  1sz2A1 [c.55.1.7] GLUCOKINASE A:3 -- 321
    1e-14  23%  2gupA1 [c.55.1.10] ROK FAMILY PROTEIN A:1 -- 114
    2e-14  11%  2gtdA1 [c.55.1.13] TYPE III PANTOTHENATE KINASE A:4 -- 121
    4e-14  13%  2ch5A2 [c.55.1.5] NAGK PROTEIN A:1 -- 117
    5e-14  16%  2aa4A2 [c.55.1.10] PUTATIVE N-ACETYLMANNOSAMINE KINASE A:120 -- 289
    5e-14  18%  1z05A3 [c.55.1.10] TRANSCRIPTIONAL REGULATOR, ROK FAMILY A:81 --
    5e-14  19%  2aa4A1 [c.55.1.10] PUTATIVE N-ACETYLMANNOSAMINE KINASE A:1 -- 119
    2e-13  13%  1nmnA  [c.55.3.8] HYPOTHETICAL PROTEIN YQGF
    1e-12  18%  1xc3A1 [c.55.1.10] PUTATIVE FRUCTOKINASE A:1 -- 118
    3e-12  27%  2ap1A2 [c.55.1.10] PUTATIVE REGULATOR PROTEIN A:1 -- 117
    7e-12  22%  2gupA2 [c.55.1.10] ROK FAMILY PROTEIN A:115 -- 289
    3e-11  12%  1q18A1 [c.55.1.7] GLUCOKINASE A:2 -- 111
    1e-10  15%  2ewsA1 [c.55.1.14] PANTOTHENATE KINASE A:1 -- 267
    1e-10   9%  1g99A2 [c.55.1.2] ACETATE KINASE A:198 -- 398
    3e-10  14%  1xc3A2 [c.55.1.10] PUTATIVE FRUCTOKINASE A:119 -- 294
    5e-10  23%  1z05A2 [c.55.1.10] TRANSCRIPTIONAL REGULATOR, ROK FAMILY A:209 --
    6e-10  12%  1iv0A  [c.55.3.8] HYPOTHETICAL PROTEIN
    3e-09  20%  2ch5A1 [c.55.1.5] NAGK PROTEIN A:118 -- 344
    4e-09  18%  2ap1A1 [c.55.1.10] PUTATIVE REGULATOR PROTEIN A:118 -- 303
    3e-07  20%  1zc6A1 [c.55.1.5] PROBABLE N-ACETYLGLUCOSAMINE KINASE A:8 -- 121
    2e-05  17%  1hjrA  [c.55.3.6] HOLLIDAY JUNCTION RESOLVASE (RUVC)
    4e-05  20%  1woqA2 [c.55.1.10] INORGANIC POLYPHOSPHATE/ATP-GLUCOMANNOKINASE
    9e-05  20%  1q18A2 [c.55.1.7] GLUCOKINASE A:112 -- 321
    2e-04   7%  2i7nA2 [c.55.1.14] PANTOTHENATE KINASE 1 A:382 -- 593
:268

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxNRTVVGVDIGGTKVNAGRVCGENLLDSYLSKIPPDAEHNAQSVIDVVINTIAKVFTSEVEGI
1woqA1          --------NAPLIGIDIGGTGIKGGIVDGKLLGERF--RVPTPQPATPESVAEAVALVVAELSARAGSPV
2hoeA2          ----------------------------------------------------------------------
2hoeA3          -----------VLGIEVTRDEIAACLIDASXNILAH-EAHPLPSQSDREETLNVXYRIIDRAKDSKLSAL
1sz2A1          ---------KYALVGDVGGTNARLALCDIAGEISQAKTYSGLDYPSLEAVIRV-----YLEEHKVEVKDG
2gupA1          ----------TIATIDIGGTGIKFASLTPDKILDKTSISTP----ENLEDLLAWLDQRLSE---QDYSGI
2gtdA1          ------------LLVDVGNTHSVFSITEDGKTFRRW--RLSTGVFQTEDELFSHLHPLLGDA---MREIK
2ch5A2          --------AAIYGGVEGGGTRSEVLLVSEDKILAEADGLSTNHWLIGTDKCVERINEMVNRAK----RKA
2aa4A2          ----------------------------------------------------------------------
1z05A3          -----------FLSMRLGRGYLTIALHELGG--EVLIDTKIDIHEIDQDDVLARLLFEIEEFFQDRVTSI
2aa4A1          -----------TLAIDIGGTKLAAALIGADQIRDRR--ELPTPASQTPEALRDALSALVSPLQ-AHAQRV
1nmnA           ---------GTLLAFDFGTKSIGVAVGQRITGTARPLPAIKAQD-------GTPDWNIIERLLKEQPDEI
1xc3A1          -----------LGGIEAGGTKFVCAVGREDTIIDRIEFPTKMPDETIEKVIQYFSQFSLQ---AIGIGSF
2ap1A2          -----------YYGFDIGGTKIALGVFDRRLQWEKRVPTPHTSYSAFLDAVCELVEEADQRF--GVKGSV
2gupA2          ----------------------------------------------------------------------
1q18A1          ---------KYALVGDVGGTNARLALCDIAGEISQAKTYSGLDYPSLEAVIRVYL-----EEHKVEVKDG
2ewsA1          ------------VGIDAGGTLIKIVQEQDNQRTFKTELTKNIDQV-------------------------
1g99A2          ----------------------------------------------------------------------
1xc3A2          ----------------------------------------------------------------------
1z05A2          ----------------------------------------------------------------------
1iv0A           -----------VGALDVGEARIGLAVGEEGVPL---ASGRGYLVRKTLEEDVEALLDFVRR---EGLGKL
2ch5A1          ----------------------------------------------------------------------
2ap1A1          ----------------------------------------------------------------------
1zc6A1          -----------LIGVDGGGTGTRIRLHDGTPLAEGGASALSQGIAKSWQAVLSTLEAAFQQAAPASACAI
1hjrA           ----------IILGIDPGSRVTGYGVIRQVGRQLSYLGSGVDDLPSRLKLIYAGVTEIITQ---FQPDYF
1woqA2          ----------------------------------------------------------------------
1q18A2          ----------------------------------------------------------------------
2i7nA2          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           GVGIPSVADREKGIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDNDANCFAIGQRLYGKGKQYENFVXXX
1woqA1          GVTFPGIIQHGVVHSAAN-VDKSWLNTDIDALLTARLGRPVEVINDADAAGLAEARYGAGA---------
2hoeA2          ----------------------------------------------------------------------
2hoeA3          TVAAPGPIDTERGIIIDPR-NFPLSQIPLANLLKEKYGIEVWVENDADXGAVGEKWYTK-----------
1sz2A1          CIAIACPITGDWVAXTNHTWAFSI-----AEXKKNLGFSHLEIINDFTAVKEHLIQFGGAEPVEGKPIAV
2gupA1          AXSVPGAVNQETGVIDGFSAVPYIHGFSWYEALS-SYQLPVHLENDANCVGLS-----------------
2gtdA1          GIGVASVVPTQNTVI--ERFSQKYFHISPIWVKAKNGCVKWNVKNPSEVGADRVANVVAFVKE-------
2ch5A2          GVDPLVPLRSLGSLSGGDQEDAGRILIEELRDRFPYLSESYLITTDAAGSIAT-----------------
2aa4A2          --------------------------------------------------------------ITDMVFIT
1z05A3          AITLPGLVNSEQGIVL-QMPHYNVKNLALGPEIYKATGLPVFVANDTRAWALAEKLFGHSQ---------
2aa4A1          AIASTGIIRDGSLLALNPHNLGGLLHFPLVKTLEQLTNLPTIAINDAQAAA-------------------
1nmnA           IVGLP-------LNMDGTEQPLTARARKFANRIHGRFGVEVKLHDERLSTVGKVDSASAVIILESY----
1xc3A1          GPVDNDKTSQTYGTITATPKA-GWRHYPFLQTVKNEMKIPVGFSTDVNAAALGEFLFGEAK---------
2ap1A2          GIGIPGMPETEDGTLYAA-NVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAW--------------
2gupA2          ---------------------------------------------------------------ENAACVV
1q18A1          CIAIACPITGDWVAXTNHTWAFS-----IAEXKKNLGFSHLEIINDFTAVSXA-----------------
2ewsA1          -------VEWLNQQQIEKLCLTGGNAGVIAENI--NIPAQIFVEFDAASQGLGILLKEQGHDLADYIFAN
1g99A2          ----------------------------------------------------------------------
1xc3A2          --------------------------------------------------------------LDSCLYIT
1z05A2          --------------------------------------------------------------VDNSVLIS
1iv0A           VVGLPLRTDLKESAQ--------AGKVLPLVEALRARGVEVELWDERF----------------------
2ch5A1          ----------------------------------------------------------------------
2ap1A1          ----------------------------------------------------------------------
1zc6A1          GLGLSGVHNRQWAGEFE---------------SQAPGFARLSLATDGYTTLLG-----------------
1hjrA           AIEQVFMAKNADSA------LKLGQARGVAIVAAVNQELPV-FEYAARQ--VKQTVVGIGS---------
1woqA2          ----------------------------------------------------------------------
1q18A2          ----------------------------------------------------------------------
2i7nA2          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           XXXXXXXXXXNKGSLLKDSNCGAGEFGMLPYLDGILEDYCSGQFFIKKIGVEGVEILKRARNNDKDTINI
1woqA1          ----------------------------------------------------------------------
2hoeA2          ------------GELYRGENGYAGEIGYTRVFNGFLEDVCNENVVLKHVLSXGFSLAEARDSGDVRVKEY
2hoeA3          ----------------------------------------------------------------------
1sz2A1          YGAGTGLGVAHLVHVDKRWVSLPGEGGHVDFAHVSAERVLSGRAIVKADNRLPEITERALADSCTDCRRA
2gupA1          ----------------------------------------------------------------------
2gtdA1          ----------------------------------------------------------------------
2ch5A2          ----------------------------------------------------------------------
2aa4A2          VSTGVGGGVVSGCKLLTGPGGLAGHIGHTLADPHGPVCGCGRTGCVEAIGADAKTIFTRAGQGDEQAQQL
1z05A3          ----------------------------------------------------------------------
2aa4A1          ----------------------------------------------------------------------
1nmnA           ----------------------------------------------------------------------
1xc3A1          ----------------------------------------------------------------------
2ap1A2          ----------------------------------------------------------------------
2gupA2          IGTGIGGAXIINGRLHRGRHGLGGEFGYXTTLLNNWSQLASTGNXVRHTDWDGRKIYQEAAAGNILCQEA
1q18A1          ----------------------------------------------------------------------
2ewsA1          VGTGTSLHYFDGQSQRRVGGIGTGG-GMIQGL-GYLLSQITDYKQLTDMAQHGDFGHVLHHLDADFTPSV
1g99A2          ------------GKSVETSMGFTPLEGLAMGTPAIVPFLMEKEGLVSGLSNDFRDLDEAASKGNRKAELA
1xc3A2          IGTGIGAGAIVEGRLLQGLS--HPEMGHIYIRRHPDDVYQGKCPYHGDCGPAIEARWGKKAADLSDIAQV
1z05A2          IHHGLGAGIVLDGRVLQGRHGNIGELGHIQINYGCLETVASSQRIQAGEPSCLADICAAAADGDPLAVDV
1iv0A           ----------------------------------------------------------------------
2ch5A1          ----------------------------VPDRLGILTH-LYRDFDKCRFAGFCRKIAEGAQQGDPLSRYI
2ap1A1          ---------------------------------GCIENYLSGRGFAWLYQLQAPEIIALWEQGDEQAHAH
1zc6A1          ----------------------------------------------------------------------
1hjrA           ----------------------------------------------------------------------
1woqA2          ----------------------NAELGHLEIDGHDAETKASA----------------VARERDGLS---
1q18A2          ---------------------------------VSAERVLSGRAIVKADNRLPEDITERAADSCTDCRRA
2i7nA2          ------------------------------------------------------EKRDSISKEDL-ARAT


                         .         .         .         +         .         .         .:280
query           YKQFGKHLGVAIKSIMYTLDPEVIIIAGSIISAREFFEKAMWDEIKTFAFINQLKKLK
1woqA1          ----------------------------------------------------------
2hoeA2          FDDIARYFSIGLLNLIHLFGISKIVIGGFFKELGENFLKKIKIEVETHL---------
2hoeA3          ----------------------------------------------------------
1sz2A1          LSLFCVIXGRFGGNLALNLTFGGVFIAGGIVPRFLEFFKA------------------
2gupA1          ----------------------------------------------------------
2gtdA1          ----------------------------------------------------------
2ch5A2          ----------------------------------------------------------
2aa4A2          IHRSARTLARLIADIKATTDCQCVVVGGSVGLAEGYLALVE-TYLAQEPAAFHVD---
1z05A3          ----------------------------------------------------------
2aa4A1          ----------------------------------------------------------
1nmnA           ----------------------------------------------------------
1xc3A1          ----------------------------------------------------------
2ap1A2          ----------------------------------------------------------
2gupA2          IERXNRNLAQGLLNIQYLIDPGVISLGGSISQNPDFIQG-------------------
1q18A1          ----------------------------------------------------------
2ewsA1          IGVVGEVVTTMAITVAREFKTENIVYIGSSFHNNALLRKVVEDYTV------------
1g99A2          LEIFAYKVKKFIGEYSAVLGADAVVFTAGIGENSASIRKRILTGLDGIGI--------
1xc3A2          WELEGYYIAQALAQYILILAPKKIILGGGVMQQKQVFSY-------------------
1z05A2          IQQLGRYLGAAIAIVINLFNPEKILIGGVINQAKSILYPSIEQCIREQSLPVYHQDLK
1iv0A           ----------------------------------------------------------
2ch5A1          FRKAGEMLGRHIVAVLPEIDPVLILCVGSVWKSWELLKEGFLLALTQGRAQNFFSSFT
2ap1A1          VERYLDLLAVCLGNILTIVDPDLLVIGGGLSNFTAITTQLA-ERLPRHLLP-------
1zc6A1          ----------------------------------------------------------
1hjrA           ----------------------------------------------------------
1woqA2          WDEYSVLLQRYFSHVEFLFSPELFIVGGGISKRADEYLPNL-----------------
1q18A2          LSLFCVIXGRFGGNLALNGTFGGVFIAGGIVPR-------------------------
2i7nA2          LVTITNNIGSIARMCALNENIDRVVFVGNFLRINMVSMKLLAYAMDFWSKGQ------