[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for ftul2:ACD30829.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1vs5F1.bssp"
#ERROR : Can't open dsspfile "1cqmA.bssp"
#ERROR : Can't open dsspfile "1vmbA.bssp"
#ERROR : Can't open dsspfile "2j5aA1.bssp"

## Summary of PDB Search
:111
    3e-27  58%  1vs5F1 [d.58.14.1] 30S RIBOSOMAL PROTEIN S6 F:1 -- 100
    7e-27  27%  1cqmA  [d.58.14.1] RIBOSOMAL PROTEIN S6
    3e-25  23%  1vmbA  [d.58.14.1] 30S RIBOSOMAL PROTEIN S6
    2e-21  33%  2j5aA1 [d.58.14.1] 30S RIBOSOMAL PROTEIN S6 A:3 -- 108
:111

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKHYEVVLMIHPDQSDQLDAMLGKYRGIIEEKGGKIHRFEDWGRRQLAYPIEKLHKAHYVLFNIECPTES
1vs5F1          MRHYEIVFMVHPDQSEQVPGMIERYTAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQEV
1cqmA           MRRYEVNIVLNPNLDSQLALEKEIIQRALENYGARVEKVAILGLRRLAYPIAKDPQGYFLWYQVEMPEDR
1vmbA           ERIYESMFIIAPNVPEERENLVERVKKIIEERVKKIDKVERMGMRKFAYEIKKFNEGDYTVIYFRCDGQN
2j5aA1          LRYYETVFAVKPTLSEEMKKKFEQVKEFIKQKGGEILYEEDWGMRQLAYPIQKFNNARYFLVQFKTENPQ


                         .         .         *         .         .         .         .:140
query           LEKLQESLRYNDAILRRLVIATKEAITEPSVMMxxxxxxxx
1vs5F1          IDELETTFRFNDAVIRSMVMRTKHAVTEAS-----------
1cqmA           VNDLARELRIRDNVRRVMVVKSQEPF---------------
1vmbA           LQELENFYRVTPEIIRWQTFRRFDLEKKERKAQ--------
2j5aA1          LNELDFQLKIDEDVIRWLNIQIKESEVKKN-----------