[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for ftul2:ACD30867.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2v8qE1.bssp"
#ERROR : Can't open dsspfile "1o50A3.bssp"
#ERROR : Can't open dsspfile "2rc3A1.bssp"
#ERROR : Can't open dsspfile "2yzqA1.bssp"

## Summary of PDB Search
:196
    4e-05  10%  2v8qE1 [d.37.1.1] 5'-AMP-ACTIVATED PROTEIN KINASE SUBUNIT GAMMA-1
    3e-04   9%  1o50A3 [d.37.1.1] CBS DOMAIN-CONTAINING PREDICTED PROTEIN TM0935
    3e-04  15%  2rc3A1 [d.37.1.1] CBS DOMAIN A:23 -- 149
    7e-04  16%  2yzqA1 [d.37.1.1] PUTATIVE UNCHARACTERIZED PROTEIN PH1780 A:123 --
:196

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLDSPALDVFRDYKEHDALVVKADVNLKDVKTKLIDNHK
2v8qE1          --------------------------------MSKSLEEL-QIGTYANIAMVRTTTPVYVALGIFVQHRV
1o50A3          -----------------------------------------CKLISLKPTVVEEDTPIEEIVDRILEDPV
2rc3A1          -----------------------------------------------TVVAIGPDDSVFNAMQKMAADNI
2yzqA1          -----------------------------------------EPYYQRYVSIVWEGTPLKAALKALLLSNS


                         .         .         *         .         .         .         .:140
query           DFILVTDGEDKVIGSIALHYIQSQALNERARSSGTKPADLIANDIMLPIAKANVVSFSIIENSKIGHVVN
2v8qE1          SALPVVDEKGRVVDIYSKFDVINLAAETYNNLDVSVTKALQHRSHYFE----GVLKCY--LHETLEAIIN
1o50A3          TRTVYVARDNKLVGMIPVMHLLKVSGFHFFFIPSMKRLIAKNASEIMLDPV------YVHMDTPLEEALK
2rc3A1          GALLVMKDEKLVGILTERDF------SRKSYLLDKPVKDTQVKEIMTR----QVAYVD--LNNTNEDCMA
2yzqA1          MALPVVDSEGNLVGIVDETDL--------LRDSEIVRPNKPVAEIMTR----DVI--VATPHMTVHEVAL


                         +         .         .         .         .         *         .:210
query           TLINSDYHHIIVYDKDKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2v8qE1          RLVEAEVHRLVVVDEH----------------------------------------
1o50A3          LMIDNNIQEMPVVDEK----------------------------------------
2rc3A1          LITEMRVRHLPVLDDGK---------------------------------------
2yzqA1          KMAKYSIEQLPVIRGE----------------------------------------