[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for ftul2:ACD30912.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1pwxA.bssp"
#ERROR : Can't open dsspfile "1xg5A.bssp"
#ERROR : Can't open dsspfile "1zemA1.bssp"
#ERROR : Can't open dsspfile "1a27A.bssp"
#ERROR : Can't open dsspfile "1ahhA.bssp"
#ERROR : Can't open dsspfile "1bdbA.bssp"
#ERROR : Can't open dsspfile "1fjhA.bssp"
#ERROR : Can't open dsspfile "2gdzA1.bssp"
#ERROR : Can't open dsspfile "1c14A.bssp"
#ERROR : Can't open dsspfile "1ae1A.bssp"
#ERROR : Can't open dsspfile "1spxA.bssp"
#ERROR : Can't open dsspfile "1h5qA.bssp"
#ERROR : Can't open dsspfile "1n5dA.bssp"
#ERROR : Can't open dsspfile "1nasA.bssp"
#ERROR : Can't open dsspfile "1dohA.bssp"
#ERROR : Can't open dsspfile "1yb1A.bssp"
#ERROR : Can't open dsspfile "2ag5A1.bssp"
#ERROR : Can't open dsspfile "1dhrA.bssp"
#ERROR : Can't open dsspfile "1w6uA.bssp"
#ERROR : Can't open dsspfile "1snyA.bssp"
#ERROR : Can't open dsspfile "1bvrA.bssp"
#ERROR : Can't open dsspfile "1o5iA.bssp"
#ERROR : Can't open dsspfile "1zbqA1.bssp"
#ERROR : Can't open dsspfile "1yxmA1.bssp"
#ERROR : Can't open dsspfile "2bgkA1.bssp"
#ERROR : Can't open dsspfile "2c54A1.bssp"
#ERROR : Can't open dsspfile "1x74A1.bssp"
#ERROR : Can't open dsspfile "2zqnA1.bssp"
#ERROR : Can't open dsspfile "1u9jA.bssp"
#ERROR : Can't open dsspfile "1xseA.bssp"
#ERROR : Can't open dsspfile "2fr0A1.bssp"
#ERROR : Can't open dsspfile "1vhcA.bssp"
#ERROR : Can't open dsspfile "1jr2A.bssp"
#ERROR : Can't open dsspfile "1a4uA.bssp"
#ERROR : Can't open dsspfile "1nytA1.bssp"
#ERROR : Can't open dsspfile "1di6A.bssp"
#ERROR : Can't open dsspfile "1hdoA.bssp"
#ERROR : Can't open dsspfile "1u7uA.bssp"
#ERROR : Can't open dsspfile "1h2iA.bssp"
#ERROR : Can't open dsspfile "2bd0A1.bssp"
#ERROR : Can't open dsspfile "1vlwA.bssp"
#ERROR : Can't open dsspfile "1yo6A1.bssp"
#ERROR : Can't open dsspfile "1lu9A1.bssp"
#ERROR : Can't open dsspfile "1e5lA2.bssp"
#ERROR : Can't open dsspfile "2bkaA1.bssp"
#ERROR : Can't open dsspfile "1qycA.bssp"
#ERROR : Can't open dsspfile "2ib0A1.bssp"
#ERROR : Can't open dsspfile "1qp8A1.bssp"
#ERROR : Can't open dsspfile "1ujmA.bssp"
#ERROR : Can't open dsspfile "1b8pA1.bssp"
#ERROR : Can't open dsspfile "1a9yA.bssp"
#ERROR : Can't open dsspfile "1rkxA.bssp"
#ERROR : Can't open dsspfile "2auwA2.bssp"
#ERROR : Can't open dsspfile "2a35A1.bssp"
#ERROR : Can't open dsspfile "1a4iA1.bssp"
#ERROR : Can't open dsspfile "1bw3A.bssp"
#ERROR : Can't open dsspfile "1c3vA1.bssp"
#ERROR : Can't open dsspfile "1e1cA2.bssp"
#ERROR : Can't open dsspfile "1i24A.bssp"
#ERROR : Can't open dsspfile "1vm6A3.bssp"
#ERROR : Can't open dsspfile "1qorA2.bssp"
#ERROR : Can't open dsspfile "2hjsA1.bssp"
#ERROR : Can't open dsspfile "1adeA.bssp"
#ERROR : Can't open dsspfile "1gu7A2.bssp"
#ERROR : Can't open dsspfile "1eq2A.bssp"
#ERROR : Can't open dsspfile "2gdtA1.bssp"
#ERROR : Can't open dsspfile "2joeA1.bssp"
#ERROR : Can't open dsspfile "1pjqA1.bssp"
#ERROR : Can't open dsspfile "1d0iA.bssp"
#ERROR : Can't open dsspfile "1edzA1.bssp"
#ERROR : Can't open dsspfile "1db3A.bssp"
#ERROR : Can't open dsspfile "1sb8A.bssp"
#ERROR : Can't open dsspfile "1cjcA1.bssp"
#ERROR : Can't open dsspfile "1vl0A.bssp"
#ERROR : Can't open dsspfile "1aorA1.bssp"
#ERROR : Can't open dsspfile "1bxkA.bssp"
#ERROR : Can't open dsspfile "2b69A1.bssp"
#ERROR : Can't open dsspfile "1orrA.bssp"

## Summary of PDB Search
:235
    1e-45  23%  1pwxA  [c.2.1.2] HALOHYDRIN DEHALOGENASE
    6e-43  32%  1xg5A  [c.2.1.2] ARPG836
    6e-38  32%  1zemA1 [c.2.1.2] XYLITOL DEHYDROGENASE A:3 -- 262
    6e-37  22%  1a27A  [c.2.1.2] 17-BETA-HYDROXYSTEROID-DEHYDROGENASE
    3e-36  30%  1ahhA  [c.2.1.2] 7 ALPHA-HYDROXYSTEROID DEHYDROGENASE
    7e-36  22%  1bdbA  [c.2.1.2] CIS-BIPHENYL-2,3-DIHYDRODIOL-2,3-DEHYDROGENASE
    1e-35  30%  1fjhA  [c.2.1.2] 3ALPHA-HYDROXYSTEROID DEHYDROGENASE/CARBONYL
    6e-35  26%  2gdzA1 [c.2.1.2] NAD+-DEPENDENT 15-HYDROXYPROSTAGLANDIN A:3 -- 256
    8e-34  20%  1c14A  [c.2.1.2] ENOYL REDUCTASE
    2e-33  29%  1ae1A  [c.2.1.2] TROPINONE REDUCTASE-I
    6e-33  26%  1spxA  [c.2.1.2] SHORT-CHAIN REDUCTASE FAMILY MEMBER (5L265)
    1e-32  28%  1h5qA  [c.2.1.2] NADP-DEPENDENT MANNITOL DEHYDROGENASE
    7e-32  19%  1n5dA  [c.2.1.2] CARBONYL REDUCTASE/20BETA-HYDROXYSTEROID
    4e-31  17%  1nasA  [c.2.1.2] SEPIAPTERIN REDUCTASE
    6e-31  22%  1dohA  [c.2.1.2] TRIHYDROXYNAPHTHALENE REDUCTASE
    9e-31  24%  1yb1A  [c.2.1.2] 17-BETA-HYDROXYSTEROID DEHYDROGENASE TYPE XI
    2e-30  26%  2ag5A1 [c.2.1.2] DEHYDROGENASE/REDUCTASE (SDR FAMILY) MEMBER 6 A:1
    2e-29  16%  1dhrA  [c.2.1.2] DIHYDROPTERIDINE REDUCTASE
    1e-28  25%  1w6uA  [c.2.1.2] 2,4-DIENOYL-COA REDUCTASE, MITOCHONDRIAL
    5e-28  18%  1snyA  [c.2.1.2] SNIFFER CG10964-PA
    8e-26  19%  1bvrA  [c.2.1.2] PROTEIN (ENOYL-ACYL CARRIER PROTEIN (ACP)
    2e-25  30%  1o5iA  [c.2.1.2] 3-OXOACYL-(ACYL CARRIER PROTEIN) REDUCTASE
    1e-24  26%  1zbqA1 [c.2.1.2] 17-BETA-HYDROXYSTEROID DEHYDROGENASE 4 A:3 -- 304
    4e-24  28%  1yxmA1 [c.2.1.2] PEROXISOMAL TRANS 2-ENOYL COA REDUCTASE A:7 -- 303
    5e-24  22%  2bgkA1 [c.2.1.2] RHIZOME SECOISOLARICIRESINOL DEHYDROGENASE A:11 --
    5e-23  11%  2c54A1 [c.2.1.2] GDP-MANNOSE-3', 5'-EPIMERASE A:13 -- 374
    6e-23   8%  1x74A1 [c.123.1.1] 2-METHYLACYL-COA RACEMASE A:2 -- 360
    7e-22   9%  2zqnA1 [b.42.2.1] 29-KDA GALACTOSE-BINDING LECTIN A:131 -- 260
    9e-22  11%  1u9jA  [c.2.1.2] HYPOTHETICAL PROTEIN YFBG
    1e-20  18%  1xseA  [c.2.1.2] 11BETA-HYDROXYSTEROID DEHYDROGENASE TYPE 1
    6e-20  14%  2fr0A1 [c.2.1.2] ERYTHROMYCIN SYNTHASE, ERYAI A:1657 -- 1915
    4e-19  10%  1vhcA  [c.1.10.1] PUTATIVE KHG/KDPG ALDOLASE
    5e-19  10%  1jr2A  [c.113.1.1] UROPORPHYRINOGEN-III SYNTHASE
    7e-19  17%  1a4uA  [c.2.1.2] ALCOHOL DEHYDROGENASE
    8e-19  14%  1nytA1 [c.2.1.7] SHIKIMATE 5-DEHYDROGENASE A:102 -- 271
    2e-18   7%  1di6A  [c.57.1.1] MOLYBDENUM COFACTOR BIOSYTHETIC ENZYME
    2e-18  16%  1hdoA  [c.2.1.2] BILIVERDIN IX BETA REDUCTASE
    4e-18  10%  1u7uA  [c.72.3.1] COENZYME A BIOSYNTHESIS BIFUNCTIONAL PROTEIN
    6e-17   7%  1h2iA  [d.50.1.3] DNA REPAIR PROTEIN RAD52 HOMOLOG
    6e-17  21%  2bd0A1 [c.2.1.2] SEPIAPTERIN REDUCTASE A:2 -- 241
    2e-16  10%  1vlwA  [c.1.10.1] 2-DEHYDRO-3-DEOXYPHOSPHOGLUCONATE ALDOLASE/4-
    4e-15  20%  1yo6A1 [c.2.1.2] PUTATIVE CARBONYL REDUCTASE SNIFFER A:1 -- 250
    5e-15  14%  1lu9A1 [c.2.1.7] METHYLENE TETRAHYDROMETHANOPTERIN DEHYDROGENASE
    9e-15  13%  1e5lA2 [d.81.1.2] SACCHAROPINE REDUCTASE A:125 -- 391
    3e-14  12%  2bkaA1 [c.2.1.2] TAT-INTERACTING PROTEIN TIP30 A:5 -- 236
    2e-13  10%  1qycA  [c.2.1.2] PHENYLCOUMARAN BENZYLIC ETHER REDUCTASE PT1
    3e-12  11%  2ib0A1 [a.25.1.9] CONSERVED HYPOTHETICAL ALANINE RICH PROTEIN A:17
    1e-11  17%  1qp8A1 [c.2.1.4] FORMATE DEHYDROGENASE A:83 -- 263
    1e-11  15%  1ujmA  [c.2.1.2] ALDEHYDE REDUCTASE II
    2e-11  10%  1b8pA1 [c.2.1.5] PROTEIN (MALATE DEHYDROGENASE) A:3 -- 158
    5e-11  14%  1a9yA  [c.2.1.2] UDP-GALACTOSE 4-EPIMERASE
    6e-11  16%  1rkxA  [c.2.1.2] CDP-GLUCOSE-4,6-DEHYDRATASE
    6e-11  26%  2auwA2 [d.331.1.1] HYPOTHETICAL PROTEIN NE0471 A:4 -- 87
    7e-11  13%  2a35A1 [c.2.1.2] HYPOTHETICAL PROTEIN PA4017 A:4 -- 215
    9e-11   8%  1a4iA1 [c.2.1.7] METHYLENETETRAHYDROFOLATE DEHYDROGENASE / A:127 --
    2e-10  15%  1bw3A  [b.52.1.2] BARWIN, BASIC BARLEY SEED PROTEIN
    2e-10   7%  1c3vA1 [c.2.1.3] DIHYDRODIPICOLINATE REDUCTASE A:501 -- 605 A:715
    4e-10   9%  1e1cA2 [c.23.6.1] METHYLMALONYL-COA MUTASE ALPHA CHAIN A:561 -- 728
    2e-09   9%  1i24A  [c.2.1.2] SULFOLIPID BIOSYNTHESIS PROTEIN SQD1
    1e-08   9%  1vm6A3 [c.2.1.3] DIHYDRODIPICOLINATE REDUCTASE A:1 -- 96 A:183 --
    7e-07   8%  1qorA2 [c.2.1.1] QUINONE OXIDOREDUCTASE A:113 -- 291
    8e-07  21%  2hjsA1 [c.2.1.3] USG-1 PROTEIN HOMOLOG A:3 -- 129 A:320 -- 336
    1e-06   8%  1adeA  [c.37.1.10] ADENYLOSUCCINATE SYNTHETASE
    1e-06   7%  1gu7A2 [c.2.1.1] 2,4-DIENOYL-COA REDUCTASE A:161 -- 349
    1e-06   7%  1eq2A  [c.2.1.2] ADP-L-GLYCERO-D-MANNOHEPTOSE 6-EPIMERASE
    1e-06  13%  2gdtA1 [d.346.1.1] LEADER PROTEIN P65 HOMOLOG NSP1 (EC 3.4.22.-)
    1e-06   9%  2joeA1 [d.371.1.1] HYPOTHETICAL LIPOPROTEIN YEHR A:2 -- 131
    3e-06  12%  1pjqA1 [c.2.1.11] SIROHEME SYNTHASE A:1 -- 113
    2e-05  11%  1d0iA  [c.23.13.1] TYPE II 3-DEHYDROQUINATE HYDRATASE
    3e-05  11%  1edzA1 [c.2.1.7] 5,10-METHYLENETETRAHYDROFOLATE DEHYDROGENASE A:149
    3e-05  17%  1db3A  [c.2.1.2] GDP-MANNOSE 4,6-DEHYDRATASE
    4e-05  16%  1sb8A  [c.2.1.2] WBPP
    4e-05   8%  1cjcA1 [c.3.1.1] PROTEIN (ADRENODOXIN REDUCTASE) A:107 -- 331
    6e-05  19%  1vl0A  [c.2.1.2] DTDP-4-DEHYDRORHAMNOSE REDUCTASE, RFBD ORTHOLOG
    2e-04   9%  1aorA1 [a.110.1.1] ALDEHYDE FERREDOXIN OXIDOREDUCTASE A:211 --
    5e-04  30%  1bxkA  [c.2.1.2] PROTEIN (DTDP-GLUCOSE 4,6-DEHYDRATASE)
    6e-04  17%  2b69A1 [c.2.1.2] UDP-GLUCURONATE DECARBOXYLASE 1 A:4 -- 315
    6e-04  21%  1orrA  [c.2.1.2] CDP-TYVELOSE-2-EPIMERASE
:235

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSNRIVLITGATKRIGLATSLYLNNQGWQVIGIARSYIDNFPGELFLCDLANEEQTASTLIQINEIHGCP
1pwxA           ------IVTNVKHFGGMGSALRLSEAGHTVACHDESFLEAFAETYPQLKPMSEQEPAELIEAVTSAYGQV
1xg5A           --DRLALVTGASGGIGAAVARALVQQGLKVVGCARTVIEELAAECYRCDLSNEEDILSMFSAIRSQHSGV
1zemA1          FNGKVCLVTGAGGNIGLATALRLAEEGTAIALLASVREKGVEARSYVCDVTSEEAVIGTVDSVVRDFGKI
1a27A           -ARTVVLITGCSSGIGLHLAVRLASDPSQSFKVYATACPPGSLETLQLDVRDSKSVAAARERV--TEGRV
1ahhA           ---KCAIITGAGAGIGKEIAITFATAGASVVVSDINEIQQLGGQAFACDITSEQELSALADFAISKLGKV
1bdbA           LKGEAVLITGGASGLGRALVDRFVAEGAKVAVLDKSHGDNVLGIVGDSLEDQKQAASRCVARFGKIDTLI
1fjhA           ----IIVISGCATGIGAATRKVLEAAGHQIVGIDIR------DAEVIADLSTAEGRKQAIADVAKCSKGM
2gdzA1          VNGKVALVTGAAQGIGRAFAEALLLKGAKVALVDWNLHEQFEPQFIQCDVADQQQLRDTFRKVVDHFGRL
1c14A           LSGKRILVTGVASSIAYGIAQAMHREGAELAFTYQNAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKF
1ae1A           LKGTTALVTGGSKGIGYAIVEELAGLGARVYTCSRNEKELDECLEIWCDLLSRTERDKLMQTVAHVDGKL
1spxA           -AEKVAIITGSSNGIGRATAVLFAREGAKVTITGRHAERLEETRQQILAAGVSEQNVNSVVADVTTDAGQ
1h5qA           FVNKTIIVTGGNRGIGLAFTRAVAAAGANVAVIYRSVGKEFGVKTYQCDVSNTDIVTKTIQQIDADLGPI
1n5dA           -NTRVALVTGANKGIGFAIVRDLCRQFAGDVVLTARDVARLSPRFHQLDIIDLQSIRALCDFLRKEYGGL
1nasA           LGCAVCVLTGASRGFGRALAPQLARLLSPGSVMLVSARSESMLRQLKTEAGVQRLLSAVRELPRPEGLQR
1dohA           LEGKVALVTGAGRGIGREMAMELGRRGCKVIVNYANSTESAEAACVKANVGVVEDIVRMFEEAVKIFGKL
1yb1A           VTGEIVLITGAGHGIGRLTAYEFAKLKSKLVLWDINKGLGAKVHTFVVDCSNREDIYSSAKKVKAEIGDV
2ag5A1          LDGKVIILTAAAQGIGQAAALAFAREGAKVIATDINELQELEKYPGIQTRVLDVTKKKQIDQFANEVERL
1dhrA           --ARRVLVYGGRGALGSRCVQAFRARNWWVASIDVVASASVIVKMTDSFTEQADQVTAEVGKLLGDQKVD
1w6uA           FQGKVAFITGGGTGLGKGMTTLLSSLGAQCVITAEQISSQTGNKVHACDVRDPDMVQNTVSELIKVAGHP
1snyA           ----SILITGCNRGLGLGLVLNLPQPPQHLFTTCRNAKNHSNIHILEIDLRNFDAYDKLVADIEGVTKDQ
1bvrA           LDGKRILVSGIISSIAFHIARVAQEQGAQLVLTGFDRLRLILLELDVQNEEHLASLAGRVTEAIGAGNKL
1o5iA           IRDKGVLVLAASRGIGRAVADVLSQEGAEVTICARNEELLKRSGHRYVVCDLRKDLD----LLFEKVKEV
1zbqA1          ---RVVLVTGAGAGLGRAYALAVNDLGGDFKGVGKGSADKVVEEIAVANYDSVEEGEKVVKTALDAFGRI
1yxmA1          LQGQVAIVTGGATGIGKAIVKELLELGSNVVIASRKPTKQARVIPIQCNIRNEEEVNNLVKSTLDTFGKI
2bgkA1          LQDKVAIITGGAGGIGETTAKLFVRYGAKVVIADIAIGSPDVISFVHCDVTKDEDVRNLVDTTIAKHGKL
2c54A1          SENLKISITGAGGFIASHIARRLKHEGHYVIASDWKKDEFHLVDLRVMENCLKVTEGVDHVFNLAADMGG
1x74A1          ---GLRVVELAGIGPGPHAAMILGDLGADVVRIDR----PISRDAMLRNRRIVTADLKSDQGLELALKLI
2zqnA1          ----------------------------------------------------------------------
1u9jA           ---TRVLILGVNGFIGNHLTERLLREDHYEVYGLDIFLNHPHFHFVEGDISIHSEWIEYHVKKCDVVLPL
1xseA           LQGKKVIVTGASKGIGREIATARSKEALQKVVARCLELGAASAHYIAGSMEDMTFAEEFVAEAGNLMGGL
2fr0A1          -----VLVTGGTGGVGGQIARWLARRGAPHLLLVSRELEALGARTAACDVTDRESVREL-LGGIGDDVPL
1vhcA           -LKIVPVIALDNADDILPLADTLAKNGLSVAEITFRSANRPDFLIAAGTVLTAEQVVLAKSSGADFVVTP
1jr2A           PEDYGGLIFTSPRAVEAAELCLEQNNKTEVWEVGNATASLVSKIGLDTEGETCGNAEKLAYICSRESSAL
1a4uA           LTNKNVIFVAALGGIGLDTSRELVKRNLKNFVILDRVENVNITFHTYDVTVPVAESKKLLKKIFDQLKTV
1nytA1          -----ILLIGAGG-ASRGVLLPLLSLDCAVTITNRTVSRAE----ELAKLFAHTGSIQALSMDELEGHEF
1di6A           -----LVSISDRDKGIPALEEWLTSALTTPFELET------------RLIPDEQAIIEQTLCELVDEMSC
1hdoA           MAVKKIAIFGATGQTGLTTLAQAVQAGYEVTVLVRDSEGPRPAHVVVGDVLQAADVDKTVAGQDAVIVL-
1u7uA           LKHLNIMITAGPTREPLDPVRYISDHSSGKMGFAIAAAAARRGTPPFVKRVDVMTALEMEAAVNASVQQQ
1h2iA           -----------------------------------------------RMAGGGQKVCYIEGHRVINLANE
2bd0A1          ---HILLITGAGKGIGRAIALEFARAARHHPDFEPVLVLSSRTATITADISDMADVRRLTTHIVERYGHI
1vlwA           KHKIVAVLRANSVEEAKEKALAVFEGGVHLIEITFTFLKEKGAIIGAGTVTSVEQCRKAVESGAEFIVSP
1yo6A1          MSPGSVVVTGANRGIGLGLVQQLVKDKNIRHIIATARDVEKATELKSIKDSRVHVTFVSKVGEIVGSDGL
1lu9A1          ------VVLAGTGPVGMRSAALLAGEGAEVVLCGRKVNKRFKVNVTAAETADDASRAEAVKGAHFVFT--
1e5lA2          -------------------------------------------------------------EVHAAGGKI
2bkaA1          MQNKSVFILGASGETGRVLLKEILEQGLFSKVTLIGRRKLTFDEEAYKNVNQEVVDFEKLDDYASAFQGH
1qycA           -SRSRILLIGATGYIGRHVAKASLDLGHPTFLLVREEKAQLLESFKASGANIVHGSIDDHASLVEAVKNV
2ib0A1          ---TIYGYGIVSALSPPGVNFLVADALKQHRHRRDDVIVAAAGYQLPMQVSSAADAARLAVRMENDGATA
1qp8A1          IQGEKVAVLGLG-EIGTRVGKILAALGAQVRGFSRTPKEGPWRFTNSCALPLNKHTRGLVKYQHLALXAE
1ujmA           -EGSLVLVTGANGFVASHVVEQLLEHGYKVRGTARSASKLANLQK-RWDAKYPGRFETAVVEDXLKQGAY
1b8pA1          -TPMRVAVTGAAGQICYSLLFRIANGDMLGKDQLEIPNEKAQKALQGVMMEIDDCAFPLLAGMTAHADPM
1a9yA           -----VLVTGGSGYIGSHTCVQLLQNGHDVIILDNLRLGGKHPTFVEGDIRNEALMTEILHDHAIDTVIH
1rkxA           -QGKRVFVTGHTGFKGGWLSLWLQTMGATVKGYSLTARVADGMQSEIGDIRDQNKLLESIREFQPEIVFH
2auwA2          ----------------------------------------------------------------------
2a35A1          -TPKRVLLAGATGLTGEHLLDRILSEPTLAKVIAPARKALAEHPRLDNPVGPLAELLPQLDGSIDTAFCC
1a4iA1          IAGRHAVVVGRSKIVGAPMHDLLLWNNATVTTCHSKTAHTGQPEMVKGEWIKPGAIVIDCGINYKVVGDV
1bw3A           --HYYRPAQNNWDLGAPAVSAYCATWDASKPLSWRSKYGGQAACGKCLRVTNPATGAQITARIVDANGGL
1c3vA1          -----VGVLGAKGKVGTTMVRAVAAADDLTLSAELGDPLSLLTDGNEVVIDFTHPDVVMGNLEFLIDNGI
1e1cA2          PRILLAKMGQDGHDRGQKVATAYADLGFDVDVGPLFQEADVHVVGVSSLAGGHLTLVPALRKELDKLGRP
1i24A           ---SRVMVIGGDGYCGWATALHLSKKNYEVCIVDNLESLTPIASIHDRISRWKALTGKSIELYVGDICDF
1vm6A3          -----YGIVGYSGRMGQEIQKVFSEKGHELVLKVDVNGVEELDSPDVVIDFSSPEALPKTVDLCKKYRA-
1qorA2          KPDEQFLFHAAAGGVGLIACQWAKALGAKLIGTVGTAQKAQSALKAGAWQVINYRE--EDLVERLKEITG
2hjsA1          --PLNVAVVGATGSVGEALVGLLDERDFPLHRLHLL----------------------------------
1adeA           -----KAIGTTGRGIGPAYEDKVARRGLRVGDLFDEYHNFQLVNYYKAEAVDYQKVLDDTMAVADIMVVD
1gu7A2          ------------------------------------------------------------------GGEA
1eq2A           ----MIIVTGGAGFIGSNIVKALNDKGITDILVVDNLKDGTKFVNLVDLNIADYMDKEDFLIQIMAGEEF
2gdtA1          LQVRDVLVRGFGDSVEEALSEAREHLKCGLVELEKGVLPQLEQPYVFIKRSDALSTNHGHKVVELVAEMD
2joeA1          --------------ESKKFSANLNGTEIAITYVYKGQSSETKIQFASIGATTKEDAAKTLEPLSAKYKNI
1pjqA1          LRDRDCLIVGGG-DVAERKARLLLEAGARLTVNALTEGMLTLVEDSCWLAIAATDDDTVNQRVSDAAESR
1d0iA           -NAPIMILNGPNLNL-------LGQRQPEIYGSDTLLCVKAAAAHGGFRQSNHEGELVDWIH-EARLNHC
1edzA1          LYGKKCIVINRSEIVGRPLAALLANDGATVYSVDVNGESLKLNKHHVEDLGEYSEDLLKKCSLDSDVVIT
1db3A           --SKVALITGVTGQDGSYLAEFLLEKGYEVHGIKRPKFHLHY-----GDLSDTSNLTRILREVQPDEVYN
1sb8A           --PKVWLITGVAGFIGSNLLETLLKLDQKVVGLATGHQRNLDSEKQWSNFKFIQGDIRNLDDCNNACAGV
1cjcA1          --CDTAVILGQGN-VALDVARILLTPPDHLEKTDITQSRVKTVWIVGRRGPLQVAFTIKELREMIQLPGT
1vl0A           -----ILITGANGQLGREIQKQLKGKNVEVIPTDVQDLD-------ITNVLAVNKF------FNEKK--P
1aorA1          ---QTGVYPYAYEQSGEAMAAKYLVRNKPCYACPIG----------------------------------
1bxkA           -----ILITGGAGFIGSALVRYIINETSDAVVV----VDKLTYAGNLMSLAPVAQ---------------
2b69A1          -----ILITGGAGFVGSHLTDKLXXDGHEVTVVDNF--FTGRKRNVEHWIGHENFELINHDVVEPLYIEV
1orrA           -----LLITGGCGFLGSNLASFALSQGIDLIVFDNLSRKGATDNLHWL----------------------


                         .         .         *         .         .         .         .:140
query           DAIINNVGIAIPEPLGKISISALNDVYNLNVRSAVQVSQFFIEKMKLKEQCKIVNIASRAIFGVKNRTSY
1pwxA           DVLVSNDIFAPEQPIDKYAVEDYRGAVEALQIRPFALVNAVASQMKKRKSGHIIFITSATPFPWKELSTY
1xg5A           DICINNAGLARPDTLLSGSTSGWKDMFNVNVLALSICTREAYQSMKERNVDDIININSHRVLPLSVTHFY
1zemA1          DFLFNNAGYQGAAPVQDYPSDDFARVLTINVTGAFHVLKAVSRQMITQNYGRIVNTASMAVKGPPNMAAY
1a27A           DVLVCNAGLGLLGPLEALGEDAVASVLDVNVVGTVRMLQAFLPDMKRRGSGRVLVTGSVGLMGLPFNDVY
1ahhA           DILVNNAGGGGPKPFDM-PMADFRRAYELNVFSFFHLSQLVAPEMEKNGGGVILTITSMAAEKNINMTSY
1bdbA           PAGIWDYSTALVDLPEESLDAAFDEVFHINVKGYIHAVKACLPALVASRGNVIFTISNAGFYPNGGGPLY
1fjhA           DGLVLCAGLGPQTKV-------LGNVVSVNYFGATELMDAFLPALKKGHQPAAVSVASAHLAFDKNPLAY
2gdzA1          DILVNNAGVNNEKNWEKT--------LQINLVSVISGTYLGLDYMSKQNGGEIINMSSLAGLPVAQQPVY
1c14A           DGFVHSIGFAPGDQLDGDYVNAVTRAHDISSYSFVAMAKACR--SMLNPGSALLTLSYGAERAIPNYNVM
1ae1A           NILVNNAGVVIHKEAKDFTEKDYNIIMGTNFEAAYHLSQIAYPLLKASQNGNVIFLSIAGFSALPSVSLY
1spxA           DEILSTTLGKFGKLDILVNNAGQSDATLNLNLRSVIALTKKAVPHLSSTKGEIVNISSIALHATPDFPYY
1h5qA           SGLIANAGVSVVKPATELTHEDFAFVYDVNVFGVFNTCRAVAKLWLQKQQKGSIVVTSSMSSQIINQSSY
1n5dA           DVLVNNAAIAFQLDNPTPFHIQAELTMKTNFMGTRNVCTELLPLI--KPQGRVVNVSSEGVRALNECSPE
1nasA           LLLINNAATLSKGFLNVNDLAEVNNYWALNLTSMLCLTSGTLNAFQDSPGLSVVNISSCALQPYKGWGLY
1dohA           DIVCSNSGVVSFGHVKDVTPEEFDRVFTINTRGQFFVAREAYKHLEIGGRLILMGSITGQAKAVPKHAVY
1yb1A           SILVNNAGVVYTSDLFATQDPQIEKTFEVNVLAHFWTTKAFLPAMTKNNHGHIVTVASAAHVSVPFLLAY
2ag5A1          DVLFNVAGFVHHGTVLDCEEKDWDFSMNLNVRSMYLMIKAFLPKMLAQKSGNIINMSSSSVKGVVNRCVY
1dhrA           AILCVAGGWAGGNAKSKSLFKNCDLMWKQSIWTSTISSHLATKHLK-EGGLLTLAGAKAALDGTPGMIGY
1w6uA           NIVINNAAGNFISPTERLSPNAWKTITDIVLNGTAFVTLEIGKQLIKAQKGAAFLSITTIYAETGSVVPS
1snyA           GLNVLFNNAGIAPKSARVRSQELLDTLQTNTVVPIXLAKACLPLLKKAAKANESQPXGVQGNTDGGXYAY
1bvrA           DGVVHSIGFMPQTGMGINPFFDAPYADHISAYSYASMAKALLPIMNPGGSIVGMDF--DPSRAMPAYNWM
1o5iA           DILVLNAGGPKAGFFDELTNEDFKEAIDSLFLNMIKIVRNYLPAMKEKGWGRIVAITSFSVIPIENLYTS
1zbqA1          DVVVNNAGILRDRSFARISDEDWDIIHRVHLRGSFQVTRAAWEHMKKQKYGRIIMTSSASGIGNFGQANY
1yxmA1          NFLVNNGGGQFLSPAEHISSKGWHAVLETNLTGTFYMCKAVYSSWMKEHGGSIVNIIVPTKAGFPLAVHS
2bgkA1          DIMFGNVGVLSTTSILEAGNEDFKRVMDINVYGAFLVAKHAARMIPAKKGSIVFTASISSFTAGGVSHVY
2c54A1          MGFIQSNHSVIMYNNTMISFNMIEAARINGIKRFFYASSACIYPEF-KQLETTNVSLKESAWPAEPQDAY
1x74A1          AKADVLIEGYRPGVTERLGLGPEECAKVNDRLIYARMTGWGQTGPRSQQAGHDINYISLNILHAIGRGDE
2zqnA1          -----------------------------FYIKSELNGKVLDIEGQNPAPGSKIITWDKKGPTAVNQLWY
1u9jA           VAIATPIEYRNPLRVFELDFEENLRIIRYCVKYRKRIIFPSTYGMCSDKYFDEDHSNLIVGPVNKPRWIY
1xseA           DMLILNHVLYNRLTFFHGEIDNVRKSMEVNFHSFVVLSVAAMPMLMQSQGSIAVVSSVAGKITYPLIAPY
2fr0A1          SAVFHAAATLDDGTVDTLTGERIERASRAKVLGARNLHELTRELD-LTAFVLFSSFAS--AFGAPGLGGY
1vhcA           GLNPKIVKLCQDLNFPITPGVNNPXAIE-----------IALEXGISAVKFFPAEASGVKXIKALLGPYA
1jr2A           PLLFPCGNLKREILPKALKDKGIAMVAHPGIQGNLNSYYSQQGVPASITFFSPSGLTYSLHIQELSGDNI
1a4uA           DILINGAGILDDHQIERTIAINFTGLVNTTTA----ILDFWDKRKGGPGGIIANICSVTGFNAIHQVPVY
1nytA1          DLIINATSSGISGDIPAIPSSLIHPGIYCYDMFYQKGKTPFLAWCEQRGSKRNADGLGMLVAAAHAFLLW
1di6A           HLVLTTGGTGPARR--DVTPDATLAVADREMPGFGEQMRQISLHFVPTAILSRQVGVIRKQAL--ILNLP
1hdoA           ---------------------LGTRNDLSPTTVMSEGARNIVAAMKAHGVDKVVACTS--AFLLWDPTKV
1u7uA           NIFIGCAAVADYRAALTIKMVKNPDIVAGVAALKDH--RPYVVGFAAETNNVEEYARQKRIRNLDLICAN
1h2iA           MFGYNGWAHSIT-QQNVDFVDLNNGKFYVGVCAFVRVQLKDGSYHEDVGYGVSEGLKSALSLEKARKEAV
2bd0A1          DCLVNNAGVGRFGALSDLTEEDFDYTMNTNLKGTFFLTQALFALMERQHSGHIFFITSVAATKAFRHSSI
1vlwA           HLDEEISQFCKEKGVFYMPGVMTPTELVKAMKLGHTILKLFPGEVVGPQFVKFPNVKFVPGVNLDNVCEW
1yo6A1          SLLINNAGVLLSYTNTEPNRAVIAEQLDVNTTSVVLLTQKESGDQLSVSRAAVITISSGLGSITDNTSGY
1lu9A1          ---AGAIGLELLPQAAWQNESSIEIVADYNAQPPLGIGGIDATDKGKEYGGKRAF-GALGIGGLKCIAKL
1e5lA2          KTFLSYCGGL---PAPESSDNPLGYKFSWSSRGVLLALRNAASFYK---DGKVTNVAGPELM-ATAKPYF
2bkaA1          DVGFCCLGTTRG-----------KAGAEGFVRVDRDYVLKSAELAKAGGCKHFNLLSSKGADKSSNFLYL
1qycA           DVVISTVGSLQIESQVNIIKAIKEVGTVKRFFPSEFGNDVDNVHAVEPAKSVFEV---------------
2ib0A1          RAVVEHAETADDRVFAALTESAVMATRWNRVLGAWPITAAF-----------------------------
1qp8A1          DAVFVNVGRAEVLDRDGVLRILKERPQFIFASDVWWGRNDFAKDAEFFSLPNVVATPWVA----------
1ujmA           DEVIKGAAGVAHIASVVSFSNKYDEVVTPAIGGTLNALRAAAATPSVKRFVLTLDEKSWNLESIQKSLWV
1b8pA1          TAFKDADVALLVGARPRGPGMERKDLLEANAQIFTVQGKAIDAVA--SRNIKVLVVGNPANTNAYMKSAP
1a9yA           FAGLKAVGESVQKPL-EYYDNNVNGTLRLISAMRAANVKNFIFSSAATVYGDQPKIPYESFPTGTPQSPF
1rkxA           MAAQPLVRLSYSEPVETYSTNVMGTVYLLEAIRHVGGVKAVVNITSDKCYDNKEWIWGRENEAMGGYDPY
2auwA2          ----------------------------------------------------------------------
2a35A1          LGTTI----------------KEAGSEEAFRAVDFDLPLAVGKRALEMGARHYLVVSA-LGADAKSSIFY
1a4iA1          AYDEAKERASFITPVPGGVGPMTVAMLMQSTVESAK----------------------------------
1bw3A           DLDWDTVFTKIDT----NGIGYQQGHLNVNYQF-------------------------------------
1c3vA1          HAVVGTTGFTAERFQQVESWLVAKPNTSVLIAPNFTSFVPGVLLAVRRIAERPGLTVG------------
1e1cA2          DILITVGGVIPEQDFDELRKDGAVEIYTPGTVIPESAISL------------------------------
1i24A           EFLAESFKSFEPDSVVHFGEQRSAPYSVYTQHNNVIGTLNVLFAIKEFGEECHLVKLGTMEYGTPNIDIE
1vm6A3          GLVLGTTALKEEHLQMLRELSKEVPVRTVFAIGALKAAEFLVGKDPGMYSFEEVIF--------------
1qorA2          GKKVRVVYDSVGRDTWERSLDCLQRRGLMVSFGNSSGAVTGVNLGLNQKGSLYVTRPSQGYITTREELTE
2hjsA1          ----------------------------------------------------------------------
1adeA           VSDLLDQARQRGDF-----------VMFEGAQGTLLDIDHGTYPYVTSSNTTAGGVATGSLGPRYVDYVL
1gu7A2          KLALNCVGGKSSTGI-ARKLNNNGLMLTYGGMSFQPVTIPTSLYIFKNFTSAGFWVTELLKNN---KELK
1eq2A           GDVEAIFHEGAXSSTTEWDGKYMMDNNYQYSKELLHYCLEREIPFLYASSAATYGGRTSDFIESREYEKP
2gdtA1          GIQYGRSGITLGVPHVGETPIAYRNVLRKN----------------------------------------
2joeA1          AGVEEKLTYAQENVTIDMEKVDFKALQGISGINVSAEDAKKGITMA------------------------
1pjqA1          RIFCNVVDAPKAASF-------------------------------------------------------
1d0iA           GIVINPAAYSHTSVADALNTCDGLPVVEVHISNI-----HQREPFRHHSYVSQRADGVVAGCGVQG---Y
1edzA1          GVPSENY------KFPTEYIKEGAVCINFACTKNFSDDVKEKASLY-VPMTGKVTIA-------------
1db3A           LGAMSHVAVSFESPEYTADVDAMGTLRLLEAFLGLEKKTRFYQASTSELYGLVQEIPQKETTPFYPRSPY
1sb8A           DYVLHQAALG--------SVPRSINDPITSNATNIDGFLNMLIAARDAKVQSFTYAASSSTYGGKPLSPY
1cjcA1          RPMLDPADFLGLQDRIKEAARPRKRLMELLLRTA------------------------------------
1vl0A           NVVINCAAHTAVDK----CEEQYDLAYKINAIGPKN-----LAAAAYSVGAEIVQISTDYVFDGEAKEPI
1aorA1          ----------------------------------------------------------------------
1bxkA           ----------------------------------------------------------------------
2b69A1          DQIYHLASPASP----------------------------------------------------------
1orrA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           SAAKSALVGCTKTWALELAKYGICVNAIAPGPVDTELFRKTRPIGSSEEKEVLDSIPMMRIGKPEEIAAT
1pwxA           TSARAGACTLANALSKELGEYNIPVFAIGPNYLHSEDFYPTEPWKTNPEAHVKKVTALQRLGTQKELGEL
1xg5A           SATKYAVTALTEGLRQELAQTHIRATCISPGVVETQFAFKLH------DKDPEKAAATYECLKPEDVAEA
1zemA1          GTSKGAIIALTETAALDLAPYNIRVNAISPGYMGPGFMWERQVVGSQYFQQMIGSVPMRRYGDINEIPGV
1a27A           CASKFALEGLCESLAVLLLPFGVHLSLIECGPVHTAFMEKVLGSPEEQYLAHSKQVFREAAQNPEEVAEV
1ahhA           ASSKAAASHLVRNMAFDLGEKNIRVNGIAPGAILTDALKSV--ITPEIEQKMLQHTPIRRLGQPQDIANA
1bdbA           TAAKHAIVGLVRELAFELAPYVR-VNGVGSGGINSDLRGPSSL--GPLADMLKSVLPIGRMPEVEEYTGA
1fjhA           AGSKNALTVAVRKRAAAWGEAGVRLNTIAPGAFVP---------------------PMGRRAEPSEMASV
2gdzA1          CASKHGIVGFTRSAALNLMNSGVRLNAICPGFVNTAILESIEKMGQYIEYKIKDMIKYYGILDPPLIANG
1c14A           GLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKD-FRKMLAHCEAVTPIRRTVTIEDVGNS
1ae1A           SASKGAINQMTKSLACEWAKDNIRVNSVAPGVILQK----------EEIDNFIVKTPMGRAGKPQEVSAL
1spxA           SIAKAAIDQYTRNTAIDLIQHGIRVNSISPGLVATGFY--------STMATMKECVPAGVMGQPQDIAEV
1h5qA           NSSKAACSNLVKGLAAEWASAGIRVNALSPGYVNTDQTAHMDKKIRDHQASN---IPLNRFAQPEEMTGQ
1n5dA           LQQKFKSETITEEELVGLAGDKILLNACCPGWVRTDMGGPKAP----KSPEVGAETPVYLALLPSDAEGP
1nasA           CAGKAARDMLYQVLAAE--EPSVRVLSYAPGPLDNDMQQLARETSKDPRSKLQKLKSDGALVDCGTSAQK
1dohA           SGSKGAIETFARCMAIDMADKKITVNVVAPGGIKTDMYHAVCRNEEVDEYAAVQWSPLRRVGLPIDIARV
1yb1A           CSSKFAAVGFHKTLTDELAALGVKTTCLCPNFVNTGFIKN-------------PSTSLGPTLEPEEVVNR
2ag5A1          STTKAAVIGLTKSVAADFIQQGIRCNCVCPGTVDTPSLQERIQARGNPEEARLKRQKTGRFATAEEIAML
1dhrA           GMAKGAVHQLCQSLAGKNMPSGAAAIAVLPVTLDTPMNRKSMPE-----------ADFSSWTPLEFLVET
1w6uA           ASAKAGVEAMSKSLAAEWGKYGMRFNVIQPGPIKTLDPTGTFEK------EMIGRIPCGRLGTVEELANL
1snyA           RTSKSALNAATKSLSVDLYPQRIXCVSLHPGWVKT------------------DXGGSSAPLDVPTSTGQ
1bvrA           TVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTLAMSAIVGIQLLEEGWDQRAPIGWNMKDATPVAKT
1o5iA           NSARMALTGFLKTLSFEVAPYGITVNCVAPGWTETERVKELLS--EEKKKQVESQIPMRRMAKPEEIASV
1zbqA1          SAAKLGLLGLANSLAIEGRKSNIHCNTIAPNAGSRMTQTVMP-------------EDLVEALKPEYVAPL
1yxmA1          GAARAGVYNLTKSLALEWACSGIRINCVAPGVIYSQTAVENYGSWGQFFEGSFQKIPAKRIGVPEEVSSV
2bgkA1          TATKHAVLGLTTSLCTELGEYGIRVNCVSPYIVASPLLTDVFGVDSSRELAHQAANLKGTLLRAEDVADA
2c54A1          GLERLATEELCKHYNKDFGIECRIGRFHNIYGPFGTWKGGREKAPAAFCRKQTSTDRFEMWG--------
1x74A1          RPVPPLNLVGDFGGGSMFLLVGILAALWERQSSGKGQVVDAAMVDGSSMRATGMWTDTRGANMLDGGAPY
2zqnA1          TDQQGVIRSKLNDFAIDASHEQIETQPFDPNNPKRAWI---VSGNTIAQLSDRDIVLDIIKSDKEAGAHI
1u9jA           SVSKQLLDRVIWAYGEKEGLQFTLFRPFNWMGPRLDNLNAARIVEGSPIKLIDGGKQKRCFTDIRDGIEA
1xseA           SASKFALDGFFSTLRSEFLVNKVSITLCILGLIDTETAIKATS-----------GIYLGPASPKEECALE
2fr0A1          APGNAYLDGLAQQRRSDGLPATAVAWGTWAGSGMAEGPVADRFR-----------RHGVIEMPPETACRA
1vhcA           QLQIXPTGGIGLHNIRDYLAIPNIVACGGSWFVEKKLIQSNNWDEIGRLREVIDII--------------
1jr2A           DQIKFAAIGPTTAR--ALAAQGLPVSCTAESPTPQALATGIRK---------------------------
1a4uA           SASKAAVVSFTNSLAKLAPITGVTAYSINPGITRTPLVHTFNSWLDVEPR--VAELLLSHPTQTSEQCGQ
1nytA1          HGVLPDVEPVIKQLQEELS---------------------------------------------------
1di6A           GQPKSIKETLEGVKDAEGNVVVHGIFASVPYCIQLLEGPYVET---------------------------
1hdoA           PPRLQAVTDDHIRMHKVLRESGLKYVAVMPPHIGDQPLTGAYTV-------TLDGRGPSRVISKHDLGHF
1u7uA           SDNNALHLFWQDGDKV------------------------------------------------------
1h2iA           TDGLKRARSFGNALGNCILDK-DYLRSLNKLPRQLPLEVDLTK---AKRQDLEPSVEEARYNSC------
2bd0A1          YCMKFGQRGLVETMRLYARKCNVRITDVQPGAVYTPMWGK------------VDDEMQALMMMPEDIAAP
1vlwA           FKAGVLAVG-VGSALVKGTPDEVREKAKAFV---------------------------------------
1yo6A1          RMSKAAINMFGRTLAVDLKDDNVLVVNFCPGWVEQSTAELISSF--NKLDNSHNGRFFMRNLKPYE----
1lu9A1          FESSEGVFDAEEIYKLEMA---------------------------------------------------
1e5lA2          IYPGFAFVAYPNRDSTPYKEQIPEADNIVRGTLRYQGFPQFIKVLVDIGFLSDEEQPFLEAIPWKEATQK
2bkaA1          QV-------KGEVEAKVEELKFDRYSVFRPGVLLCDRSRPGEWLVRKFFGSLPDSWASGHSVPVVTVVRA
1qycA           ---KAKVRRAIEAEGIPYTYVSSNCFAGYFLRSLAQAGL--TAPPRDKVVILGDGNARVVFVKEEDIGTF
2ib0A1          ----------------------------------------------------------------------
1qp8A1          ----------------------------------------------------------------------
1ujmA           YAASKTEAELAAWKFXDENKPHFTLNAVLPNYTIGTIFDPETQSGSTEVSPALALXPPQYYVSAVDIGL-
1b8pA1          SLPAKNFTA-------------------------------------------------------------
1a9yA           GKSKLMVEQILTDLQKAQPDWSIALLRYFNPVGAHPSGD-MGEDPQGIPNNLMPYIAQVAVGRRDSLAIF
1rkxA           SNSKGCAELVTSSYRNSFFNPANYGQHGTAVAT-------------------------------------
2auwA2          --------------------------------------------------------FFPKLTAVEALAPY
2a35A1          NRVKGELEQALQEQ------GWPQLTIARPSLL----------FGPREEFRLAEILAAPIAGKYHGIEA-
1a4iA1          ----------------------------------------------------------------------
1bw3A           ----------------------------------------------------------------------
1c3vA1          ----------------------------------------------------------------------
1e1cA2          ----------------------------------------------------------------------
1i24A           EGYITITHNGRTDTLPYPKQASSFYHL-------------------------------------------
1vm6A3          ----------------------------------------------------------------------
1qorA2          ASNELF----------------------------------------------------------------
2hjsA1          ----------------------------------------------------------------------
1adeA           GILKAYSTRVGA----------------------------------------------------------
1gu7A2          TSTLNQIIAWYE----------------------------------------------------------
1eq2A           LNVYGYSKFLFDEYVRQILPANSQIVGFRYFNVYGPREGHKGSMASVAFHLNTQLNNKRDFVYVGDVADV
2gdtA1          ----------------------------------------------------------------------
2joeA1          ----------------------------------------------------------------------
1pjqA1          ----------------------------------------------------------------------
1d0iA           VFGVERIAA-------------------------------------------------------------
1edzA1          ----------------------------------------------------------------------
1db3A           AVAKLYAYWITVNYRES---YGMYACNGILFNH-------------------------------------
1sb8A           AVTKYVNELYADVFS---RCYGFSTIGLRYFNV-------------------------------------
1cjcA1          ----------------------------------------------------------------------
1vl0A           T---------------------------------------------------------------------
1aorA1          ----------------------------------------------------------------------
1bxkA           ----------------------------------------------------------------------
2b69A1          ----------------------------------------------------------------------
1orrA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           IAFLLSNEASFITGQVICVDGGGSL
1pwxA           VAFLASGSCDYLTGQVFWLAGG---
1xg5A           VIYVLSTPAHIQIGDIQMRPTG---
1zemA1          VAFLLGDDSSFMTGVNLPIAGG---
1a27A           FLTALRAPLRYFTTERFDDPSGSNY
1ahhA           ALFLCSPAASWVSGQILTVSGGG--
1bdbA           YVFFATRDAAPATGALLNYDGG---
1fjhA           IAFLMSPAASYVHGAQIVIDGG---
2gdzA1          LITLIEDDA--LNGAIMKITTSKGI
1c14A           AAFLCSDLSAGISGEVVHVDGGFSI
1ae1A           IAFLCFPAASYITGQIIWADGG---
1spxA           IAFLADRKSSYIIGHQLVVDGGSSL
1h5qA           AILLLSDHATYMTGGEYFIDGG---
1n5dA           HGQFVTDKKVVEWGVPPESYPW---
1nasA           LLGLLQ-KDTFQSGAHVDFY-----
1dohA           VCFLASNDGGWVTGKVIGIDGGACM
1yb1A           LMHGILTEQKMI-------------
2ag5A1          CVYLASDESAYVTGNPVIIDGGWSL
1dhrA           FHDWITGNKRPNSGSLIQVVTTD--
1w6uA           AAFLCSDYASWINGAVIKFDGG---
1snyA           IVQTISKLGEKQNGGFVNYDGT---
1bvrA           VCALLSDWLPATTGDIIYADGG---
1o5iA           VAFLCSEKASYLTGQTIVVDGG---
1zbqA1          VLWLCH-ESCEENGGLFEVGAG---
1yxmA1          VCFLLSPAASFITGQSVDVDGG---
2bgkA1          VAYLAGDESKYVSGLNLVIDGG---
2c54A1          -------------------------
1x74A1          YDTYECADGRYVAVGAIE-------
2zqnA1          CAWKQHGGPNFIIE-----------
1u9jA           LYRIIENAGNRCDGEIINIGNP---
1xseA           ITALRQDEMYYVGSRWV--------
2fr0A1          LQNALDRAEVCPIVIDVRWDRF---
1vhcA           -------------------------
1jr2A           -------------------------
1a4uA           NFVKAI--EANKNGAIWKLDLG---
1nytA1          -------------------------
1di6A           -------------------------
1hdoA           MLRCLTTDE--YDGHSTYPSHQ---
1u7uA           -------------------------
1h2iA           -------------------------
2bd0A1          VVQAYLQPSRTVVEEILRPTSGD--
1vlwA           -------------------------
1yo6A1          -------------------------
1lu9A1          -------------------------
1e5lA2          IVKASSASEQDIVSTIV--------
2bkaA1          MLNNVVRPRD--KQMELLENKAI--
1qycA           TIKAVDDPRT-LNKTLYLRLPA---
2ib0A1          -------------------------
1qp8A1          -------------------------
1ujmA           -LHLGCLVLPQIERRRVYGTAGT--
1b8pA1          -------------------------
1a9yA           GNDY---------------------
1rkxA           -------------------------
2auwA2          RL-----RTTWSTGEVLEVDVGDIL
2a35A1          -------------------------
1a4iA1          -------------------------
1bw3A           -------------------------
1c3vA1          -------------------------
1e1cA2          -------------------------
1i24A           -------------------------
1vm6A3          -------------------------
1qorA2          -------------------------
2hjsA1          -------------------------
1adeA           -------------------------
1gu7A2          -------------------------
1eq2A           NLWFLENG----VSGIFNLGTGRAE
2gdtA1          -------------------------
2joeA1          -------------------------
1pjqA1          -------------------------
1d0iA           -------------------------
1edzA1          -------------------------
1db3A           -------------------------
1sb8A           -------------------------
1cjcA1          -------------------------
1vl0A           -------------------------
1aorA1          -------------------------
1bxkA           -------------------------
2b69A1          -------------------------
1orrA           -------------------------