[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for ftul2:ACD30916.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1vr4A1.bssp"

## Summary of PDB Search
:106
    2e-22  34%  1vr4A1 [d.230.5.1] HYPOTHETICAL PROTEIN APC22750 A:1 -- 103
:106

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MILTTADTLGKREIIEYKGLVTGIIVRTPTITQXXXXXXXXXXXXXXTSYTNVCKEARLHAEQEMINQAK
1vr4A1          MIVTTTSGIQGKEIIEYIDIVNGEAIMGANIVRDLFASVRDVVGGRAGSYESKLKEARDIAMDEMKELAK


                         .         .         *         .         .         .         .:140
query           ELGANAIVAIRYDSSSLGGNTSGTEVFCYGTAVVVx
1vr4A1          QKGANAIVGVDVDYEVVRD--GMLMVAVSGTAVRI-