[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for ftul2:ACD30919.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1a8rA.bssp"
#ERROR : Can't open dsspfile "1zl0A1.bssp"

## Summary of PDB Search
:206
    5e-60  44%  1a8rA  [d.96.1.1] GTP CYCLOHYDROLASE I
    8e-04  14%  1zl0A1 [c.8.10.1] HYPOTHETICAL PROTEIN PA5198 A:170 -- 307
:206

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxSKLGKSVQEHLIKLGLEQPREFNLDNDNKITIITKAYRQILDALGLYTDEFEKTPFRVARMF
1a8rA           --------SKEAALVHEALVARGLETPLRHEMDNETRKSLIAGHMTEIMQLLNLADDSLMETPHRIAKMY
1zl0A1          -----------------------------------------------------LVLEDVGEPYYRLERSL


                         .         .         *         .         .         .         .:140
query           TQEIFNGLDYANFPACALYENEFNYTGVLTQKNITIMSFCEHHFVPFEGTAEVSFIPKNNNIIGLCRINS
1a8rA           VDEIFSGLDYANFPKITLIENKMKVDEMVTVRDITLTSTCESHFVTIDGKATVAYIP-KDSVIGLSKINR
1zl0A1          WQRQLGAICLGSFTDCPRKEVAHSLERIFGEYEVPLYHSGQNRAWPYGKTAVLEG---------------


                         +         .         .         .         .         *         .:210
query           ICDFFSRRPQIQERMTAQIFEALKFILSTEDVSVKIKAKHACVSLRGVNNQNSQTYTQMVGGVFxx
1a8rA           IVQFFAQRPQVQERLTQQILIALQTLLGTNNVAVSIDAVHYCVKARGIRDATSATTTTSLGGLF--
1zl0A1          ------------------------------------------------------------------