[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for ftul2:ACD31053.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1do0A.bssp"
#ERROR : Can't open dsspfile "1jb0D.bssp"
#ERROR : Can't open dsspfile "1qhbA.bssp"
#ERROR : Can't open dsspfile "1ksfX3.bssp"
#ERROR : Can't open dsspfile "1qzmA.bssp"
#ERROR : Can't open dsspfile "1sxjA2.bssp"
#ERROR : Can't open dsspfile "1um8A.bssp"
#ERROR : Can't open dsspfile "1n25A.bssp"
#ERROR : Can't open dsspfile "1g8pA.bssp"
#ERROR : Can't open dsspfile "1oz4A2.bssp"
#ERROR : Can't open dsspfile "1hqcA2.bssp"
#ERROR : Can't open dsspfile "1a5tA2.bssp"
#ERROR : Can't open dsspfile "1l8qA2.bssp"
#ERROR : Can't open dsspfile "1s9hA.bssp"
#ERROR : Can't open dsspfile "1ksfX2.bssp"
#ERROR : Can't open dsspfile "1vkpA.bssp"
#ERROR : Can't open dsspfile "1sxjE2.bssp"
#ERROR : Can't open dsspfile "1d2nA.bssp"
#ERROR : Can't open dsspfile "1lw7A2.bssp"
#ERROR : Can't open dsspfile "1jqjC2.bssp"
#ERROR : Can't open dsspfile "2aplA1.bssp"
#ERROR : Can't open dsspfile "1heiB1.bssp"
#ERROR : Can't open dsspfile "2gnoA2.bssp"
#ERROR : Can't open dsspfile "1rkbA.bssp"
#ERROR : Can't open dsspfile "1ny5B2.bssp"
#ERROR : Can't open dsspfile "1e6cA.bssp"
#ERROR : Can't open dsspfile "1e2hA.bssp"
#ERROR : Can't open dsspfile "1grqA.bssp"
#ERROR : Can't open dsspfile "1fnnA2.bssp"
#ERROR : Can't open dsspfile "1qvrA2.bssp"
#ERROR : Can't open dsspfile "1yr6A1.bssp"
#ERROR : Can't open dsspfile "1eg7A.bssp"
#ERROR : Can't open dsspfile "1a3qA2.bssp"
#ERROR : Can't open dsspfile "1ckeA.bssp"
#ERROR : Can't open dsspfile "1jr3A2.bssp"
#ERROR : Can't open dsspfile "2bdtA1.bssp"
#ERROR : Can't open dsspfile "1iqpA2.bssp"
#ERROR : Can't open dsspfile "1zp6A1.bssp"
#ERROR : Can't open dsspfile "2axpA1.bssp"

## Summary of PDB Search
:455
    9e-46  59%  1do0A  [c.37.1.20] PROTEIN (HEAT SHOCK LOCUS U)
    2e-15   9%  1jb0D  [d.187.1.1] PHOTOSYSTEM 1 REACTION CENTRE SUBUNIT II
    3e-12   9%  1qhbA  [a.111.1.2] HALOPEROXIDASE
    4e-11  21%  1ksfX3 [c.37.1.20] ATP-DEPENDENT CLP PROTEASE ATP-BINDING SUBUNIT
    1e-10  20%  1qzmA  [c.37.1.20] ATP-DEPENDENT PROTEASE LA
    1e-10  13%  1sxjA2 [c.37.1.20] ACTIVATOR 1 95 KDA SUBUNIT A:295 -- 547
    1e-09  41%  1um8A  [c.37.1.20] ATP-DEPENDENT CLP PROTEASE ATP-BINDING SUBUNIT
    2e-09  14%  1n25A  [c.37.1.20] LARGE T ANTIGEN
    9e-09  23%  1g8pA  [c.37.1.20] MAGNESIUM-CHELATASE 38 KDA SUBUNIT
    1e-08  25%  1oz4A2 [c.37.1.20] TRANSITIONAL ENDOPLASMIC RETICULUM ATPASE
    2e-08  24%  1hqcA2 [c.37.1.20] RUVB A:5 -- 242
    2e-08   8%  1a5tA2 [c.37.1.20] DELTA PRIME A:1 -- 207
    2e-08  15%  1l8qA2 [c.37.1.20] CHROMOSOMAL REPLICATION INITIATOR PROTEIN DNAA
    4e-08  18%  1s9hA  [c.37.1.20] REP 40 PROTEIN
    2e-07  27%  1ksfX2 [c.37.1.20] ATP-DEPENDENT CLP PROTEASE ATP-BINDING SUBUNIT
    3e-07  10%  1vkpA  [d.126.1.6] AGMATINE IMINOHYDROLASE
    3e-07  11%  1sxjE2 [c.37.1.20] ACTIVATOR 1 40 KDA SUBUNIT E:4 -- 255
    6e-07  25%  1d2nA  [c.37.1.20] N-ETHYLMALEIMIDE-SENSITIVE FUSION PROTEIN
    8e-07  17%  1lw7A2 [c.37.1.1] TRANSCRIPTIONAL REGULATOR NADR A:220 -- 411
    1e-06  14%  1jqjC2 [c.37.1.20] DNA POLYMERASE III, DELTA SUBUNIT C:1 -- 211
    2e-06   9%  2aplA1 [a.258.1.1] HYPOTHETICAL PROTEIN PG0816 A:2 -- 150
    5e-06  14%  1heiB1 [c.37.1.14] HCV HELICASE B:188 -- 325
    7e-06  13%  2gnoA2 [c.37.1.20] DNA POLYMERASE III, GAMMA SUBUNIT-RELATED A:11
    7e-06  37%  1rkbA  [c.37.1.1] PROTEIN AD-004
    2e-05  30%  1ny5B2 [c.37.1.20] TRANSCRIPTIONAL REGULATOR (NTRC FAMILY) B:138
    5e-05  31%  1e6cA  [c.37.1.2] SHIKIMATE KINASE
    5e-05  13%  1e2hA  [c.37.1.1] THYMIDINE KINASE
    6e-05  26%  1grqA  [c.37.1.3] CHLORAMPHENICOL 3-O PHOSPHOTRANSFERASE
    9e-05  22%  1fnnA2 [c.37.1.20] CELL DIVISION CONTROL PROTEIN 6 A:1 -- 276
    2e-04  28%  1qvrA2 [c.37.1.20] CLPB PROTEIN A:149 -- 535[MASQUE : MEMB(X) 0 /
    2e-04  17%  1yr6A1 [c.37.1.10] ATP(GTP)BINDING PROTEIN A:1 -- 244
    3e-04  18%  1eg7A  [c.37.1.10] FORMYLTETRAHYDROFOLATE SYNTHETASE
    5e-04  16%  1a3qA2 [b.2.5.3] PROTEIN (NUCLEAR FACTOR KAPPA-B P52) A:37 -- 226
    5e-04  23%  1ckeA  [c.37.1.1] PROTEIN (CYTIDINE MONOPHOSPHATE KINASE)
    5e-04  34%  1jr3A2 [c.37.1.20] DNA POLYMERASE III SUBUNIT GAMMA A:3 -- 242
    6e-04  40%  2bdtA1 [c.37.1.25] BH3686 A:1 -- 176
    6e-04  24%  1iqpA2 [c.37.1.20] RFCS A:2 -- 232
    7e-04  31%  1zp6A1 [c.37.1.25] HYPOTHETICAL PROTEIN ATU3015 A:6 -- 181
    7e-04  34%  2axpA1 [c.37.1.1] HYPOTHETICAL PROTEIN BSU20280 A:2 -- 165
:455

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MTQIMTPKTIVHELERHIIGQNDAKKAVAIALRNRWRRMQLDNEMRQEVTPKNILMIGPTGVGKTEIARR
1do0A           ----MTPREIVSELDKHIIGQDNAKRSVAIALRNRWRRMQLNEELRHEVTPKNILMIGPTGVGKTEIARR
1jb0D           ----------------------------------------------------------------------
1qhbA           ----KNAFLKSESVFPEVDVLVEELSSILDDSNEKQNIADGDSFLLPMAFAEGSPFHPSYGSGHAVVAGA
1ksfX3          -SDRDTLKNLGDRLKMLVFGQDKAIEALTEAIKMARAGLG-----HEHKPVGSFLFAGPTGVGKTEVTVQ
1qzmA           ----------------------------------------------------------------------
1sxjA2          ----LWTVKYAPTNLQQVCGNKGSVMKLKNWLANWENSKKNSFKHAGKDVFRAAMLYGPPGIGKTTAAHL
1um8A           ---IPAPKELKAVLDNYVIGQEQAKKVFSVAVYNHYKRSNVELEHLEEVSKSNILLIGPTGSGKTLMAQT
1n25A           IMFGSTGSADIEEWMAGVAWLHCLLPKMDSVVYDFLKCMVYNIPK-----KRYWLFKGPIDSGKTTLAAA
1g8pA           ----------------AIVGQEDMKLALLLTAVDP--------------GIGGVLVFGDRGTGKSTAVRA
1oz4A2          -----------------VGGCRKQLAQIKEMVELPLRHPALFKAIGVK-PPRGILLYGPPGTGKTLIARA
1hqcA2          -----------------YIGQERLKQKLRVYLEAAKARKE---------PLEHLLLFGPPGLGKTTLAHV
1a5tA2          ---------------RWYPWLRPDFEKLVASYQAGR-------------GHHALLIQALPGMGDDALIYA
1l8qA2          ----------------NFIVGEGNRLAYEVVKEALENLGS---------LYNPIFIYGSVGTGKTHLLQA
1s9hA           LDNAGKIMSLTKTAPDYLVGQQPVEDISSNRIYKILELNGYDPQYAASVFRNTIWLFGPATTGKTNIAEA
1ksfX2          -------------------------------------------------RKNNPLLVGESGVGKTAIAEG
1vkpA           -----------------LSNSIDARGRKIQVIKLYIPEPLYXTEEESSG-ITQDGEAIPRLAGTRLAASY
1sxjE2          ----------------ALSHNEELTNFLKSLSDQPR-------------DLPHLLLYGPNGTGKKTRCMA
1d2nA           -----------------IIKWGDPVTRVLDDGELLVQQT----KNSDRTPLVSVLLEGPPHSGKTALAAK
1lw7A2          --------------------------------------------------AKTVAILGGESSGKSVLVNK
1jqjC2          -------------------------------------------------LRAAYLLLGNDPLLLQESQDA
2aplA1          -----------------PFITARSDEALTAYCDAVAQGFSHP---EAESXASEVLYQGLHFSRYDTLVSV
1heiB1          --------------------------------------------------FQVAHLHAPTGSGKSTKVPA
2gnoA2          -------------------------------------------------EGISILINGEDLSYPREVSLE
1rkbA           --------------------------------------------------LPNILLTGTPGVGKTTLGKE
1ny5B2          -------------------------------------------------AECPVLITGESGVGKEVVARL
1e6cA           --------------------------------------------------TEPIFMVGARGCGMTTVGRE
1e2hA           --------------------------------------------------LLRVYIDGPHGMGKTTTTQL
1grqA           ------------------------------------------------MTTRMIILNGGSSAGKSGIVRC
1fnnA2          ---------------KRLPHREQQLQQLDILLGNWLRNPGH--------HYPRATLLGRPGTGKTVTLRK
1qvrA2          -------------------------------------------------TKNNPVLIGEPGVGKTAIVEG
1yr6A1          -----------------------------------------------------VVFVGTAGSGKTTLTGE
1eg7A           -----AKMKPVMELARGLGIQEDEVELYGKYKAKISLDVYRRLKDKPDGKLILVTAITPAGEGKTTTSVG
1a3qA2          --------------------------------------------------------------GPYLVIVE
1ckeA           --------------------------------------------------APVITIDGPSGAGKGTLCKA
1jr3A2          -----------------VVGQEHVLTALANGLSLG--RI-----------HHAYLFSGTRGVGKTSIARL
2bdtA1          -----------------------------------------------------YIITGPAGVGKSTTCKR
1iqpA2          -----------------IVGQEHIVKRLKHYVKTG--------------SMPHLLFAGPPGVGKTTAALA
1zp6A1          -------------------------------------------DLGGNI----LLLSGHPGSGKSTIAEA
2axpA1          -----------------------------------------------------IILEGPDCCFKSTVAAK


                         .         .         *         .         .         .         .:140
query           LAKLADAPFIKVEATKFTEVGYVGKDVESIIRDLVETAVKMXXXXXXXXXXXXXXRLAEDRILDVLIPPA
1do0A           LAKLANAPFIKVEATKFTEVGYVGKEVDSIIRDLTDAAVKMVRVQAIEKNRYRAEELAEERILDVLIPP-
1jb0D           ----------------------------------------------------------------------
1qhbA           CVTILKAFFDANFQIDQVFE-VDT-DEDKLVKSSFPGPLTVELNKLADNVAIGRNMAGVHYFSDQFESLL
1ksfX3          LSKALGIELLRFDMSEYMERHTVSR---------------------------------------------
1qzmA           ----------------------------------------------------------------------
1sxjA2          VAQELGYDILEQNASDVRSKTLLNAGVKNALDNMSV----------------------------------
1um8A           LAKHLDIPIA------------------------------------------------------------
1n25A           LLELCGGKALNVNLPLDRLNFELGVAIDQFLVVFED----------------------------------
1g8pA           LAALLPEIEAVEGCPVSSPNVEMIPDWATVLSTNV-----------------------------------
1oz4A2          VANETGAFFFLINGPEIMS---------------------------------------------------
1hqcA2          IAHELGVNLRVTSGPAIEK---------------------------------------------------
1a5tA2          LSRYLLCQQPQGHKSCGHCRGCQLMQAGTH----------------------------------------
1l8qA2          AGNEAKKRGYRVIYSSADD--FAQAXVEHLKKGTIN----------------------------------
1s9hA           IAHTVPFYGCVNWTENFPFNDCVDKMV-------------------------------------------
1ksfX2          LAWRGDVPEVMADCTIYSLDIGAGTKYRGDFEKRFKALLKQ-----------------------------
1vkpA           VNFYIANGGIIAP-------QFGDPIRD------------------------------------------
1sxjE2          LLESIFGPGVYRNVVSSPYHLEITP--SNDRIVIQELLKEV-----------------------------
1d2nA           IAEESNFPFI------------------------------------------------------------
1lw7A2          LAAVFNTTSAWEYGREFVFEKLGGDEQAMQYSD-------------------------------------
1jqjC2          VRQVAAAQGFEEHHTFSIDPNT------------------------------------------------
2aplA1          LEREFEQELPSPLPERLAPILLKNKAIQSVFAKYDLTDDF------------------------------
1heiB1          AYAAQGYKVLVLNPS-------------------------------------------------------
2gnoA2          LPEYVEKFPPKASDVLEIDPEGEN----------------------------------------------
1rkbA           LASKSGLKYINVGDLAREEQLYDGYD--------------------------------------------
1ny5B2          IHKLSKEPFVALNVASIPR---------------------------------------------------
1e6cA           LARALGYEFVDT----------------------------------------------------------
1e2hA           LRDDIVYVPEPMTYWRVLGASETIANIYTTQH--------------------------------------
1grqA           LQSVLPEPWLAF----------------------------------------------------------
1fnnA2          LWE-------------------------------------------------------------------
1qvrA2          LAQRGDVPEGLKGKRIVSLQMEFEERLKAVIQEVVQ----------------------------------
1yr6A1          FGRYLEDNYKVA----------------------------------------------------------
1eg7A           LTDALARLGKRV----------------------------------------------------------
1a3qA2          QPKQRGFRFRYGCEGPSH-GGLPG-ASSEKGRKTYPTV--------------------------------
1ckeA           MAEALQWHLL------------------------------------------------------------
1jr3A2          LAK-------------------------------------------------------------------
2bdtA1          LAAQLDNS--------------------------------------------------------------
1iqpA2          LARELFGENWRHNFLELNASDER-----------------------------------------------
1zp6A1          LANLPGVPKVHF----------------------------------------------------------
2axpA1          LSKELKYPIIKG----------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           RTSESKVGFANEPAEDAASKKEKENKTREIFRKKIQNGELDDKEIEIEVAVAPKTIGVMGPPGMEDMTSQ
1do0A           --AKNNWGQTEQQQEPSAARQAFRKKLREGQLDDKEIEIDARKLKIKDAMKLLIEEEAAKLVNPEELKQD
1jb0D           ----------------------------------------------------------------------
1qhbA           LGEQIAIGILEEQSLT----------YGENFFFNL--PKFDGTTIQI-----------------------
1ksfX3          ----------------------------------------------------------------------
1qzmA           ----------------------------------------------------------------------
1sxjA2          ----------------------------------------------------------------------
1um8A           ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1g8pA           ----------------------------------------------------------------------
1oz4A2          ----------------------------------------------------------------------
1hqcA2          ----------------------------------------------------------------------
1a5tA2          ----------------------------------------------------------------------
1l8qA2          ----------------------------------------------------------------------
1s9hA           ----------------------------------------------------------------------
1ksfX2          ----------------------------------------------------------------------
1vkpA           ----------------------------------------------------------------------
1sxjE2          ----------------------------------------------------------------------
1d2nA           ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
1jqjC2          ----------------------------------------------------------------------
2aplA1          ----------------------------------------------------------------------
1heiB1          ----------------------------------------------------------------------
2gnoA2          ----------------------------------------------------------------------
1rkbA           ----------------------------------------------------------------------
1ny5B2          ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
1grqA           ----------------------------------------------------------------------
1fnnA2          ----------------------------------------------------------------------
1qvrA2          ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1eg7A           ----------------------------------------------------------------------
1a3qA2          ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1jr3A2          ----------------------------------------------------------------------
2bdtA1          ----------------------------------------------------------------------
1iqpA2          ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
2axpA1          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           LQDLFSSLSTXXXXXXXXXXXXXXXLAQDEEAAKLVNEEDIKARALEAVEQNGIVFLDEIDKVCRKSSNS
1do0A           AIDAV--------------------------------------------EQHGIVFIDEIDKICKRGESS
1jb0D           --------------------------------PLYGGSTGGLLSAADTEEKYAITWTSPKEQVFE--MPT
1qhbA           ----------------------------------------------------------------------
1ksfX3          --------------------------------------------------PHAVLLLDEIEKAHPDVFNI
1qzmA           ----------------------------------------------------------------------
1sxjA2          ----------------------------------------------------------------------
1um8A           ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1g8pA           ----------------------------------------------------------------------
1oz4A2          ----------------------------------------------------------------------
1hqcA2          ----------------------------------------------------------------------
1a5tA2          ----------------------------------------------------------------------
1l8qA2          ----------------------------------------------------------------------
1s9hA           ----------------------------------------------------------------------
1ksfX2          ----------------------------------------------------------------------
1vkpA           ----------------------------------------------------------------------
1sxjE2          ----------------------------------------------------------------------
1d2nA           ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
1jqjC2          ----------------------------------------------------------------------
2aplA1          ----------------------------------------------------------------------
1heiB1          ----------------------------------------------------------------------
2gnoA2          ----------------------------------------------------------------------
1rkbA           ----------------------------------------------------------------------
1ny5B2          ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
1grqA           ----------------------------------------------------------------------
1fnnA2          ----------------------------------------------------------------------
1qvrA2          ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1eg7A           ----------------------------------------------------------------------
1a3qA2          ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1jr3A2          -----------------------------------------------------VYLIDEVHMLSRHSFNA
2bdtA1          ----------------------------------------------------------------------
1iqpA2          ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
2axpA1          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           GADVSREGVQRDLLPLVEGSTVSTKYGVIKTDHILFIASGAFHVAKPSDLIPELQGRLPIRVELKSLEIE
1do0A           GPDVSREGVQRDLLPLVEGCTVSTKHGMVKTDHILFIASGAFQIAKPSDLIPELQGRLPIRVELQALTTS
1jb0D           AGA--------AVMREGENLVYFAR-----KEQCLALAAQQLRPRKINDYKIYRIFPDGETVLIHPKDGV
1qhbA           ----------------------------------------------------------------------
1ksfX3          LLQVMDNGTLTDNNGRKA---DFRNVVLVMTTNAGVRNSTDAMEEIKKIFTPEFRNRLDNIIWFDHLSTD
1qzmA           -----------------------------------------------------------------GYTED
1sxjA2          ----------------------------------------------------------------------
1um8A           -----------------------------------------------------LIGRLPVLSTLDSISLE
1n25A           ----------------------------------------------------------------------
1g8pA           ----------------------------------------------------------------------
1oz4A2          ----------------------------------------------------------------------
1hqcA2          ----------------------------------------------------------------------
1a5tA2          ----------------------------------------------------------------------
1l8qA2          ----------------------------------------------------------------------
1s9hA           ----------------------------------------------------------------------
1ksfX2          ----------------------------------------------------------------------
1vkpA           ----------------------------------------------------------------------
1sxjE2          ----------------------------------------------------------------------
1d2nA           ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
1jqjC2          ----------------------------------------------------------------------
2aplA1          ----------------------------------------------------------------------
1heiB1          ----------------------------------------------------------------------
2gnoA2          ----------------------------------------------------------------------
1rkbA           ----------------------------------------------------------------------
1ny5B2          ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
1grqA           ----------------------------------------------------------------------
1fnnA2          ----------------------------------------------------------------------
1qvrA2          ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1eg7A           ----------------------------------------------------------------------
1a3qA2          ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1jr3A2          ------------LLKTLEEPPEHVKFLLATTDP--------------QKLPVTILSRC-LQFHLKALDVE
2bdtA1          ----------------------------------------------------------------------
1iqpA2          ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
2axpA1          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           DFVRILREPDCSILKQYIALMKTEGIDLSFEEDAIRKIAEIAYKVNEEVENIGARRLHTVMERLLEKISF
1do0A           DFERILTEPNASITVQYKALMATEGVNIEFTDSGIKRIAEAAWQVNESTENIGARRLHTVLERLMEEISY
1jb0D           FPEKVN-------KGREAVNSVPRSIGQNPNPSQLKFTGKKPY---------------------------
1qhbA           ----------------------------------------------------------------------
1ksfX3          VIHQVVD----KFIVELQVQLDQKGVSLEVSQEARNWLAEKGYD-----RAMGARPMARVIQDNLKKPLA
1qzmA           EKLNI---AKRHLLPKQIERNALKKGELTVDDSAIIGII------RYYTREAGVRGLEREISKLCRKAVK
1sxjA2          ----------------------------------------------------------------------
1um8A           AMVDILQKPKNALIKQYQQLFKMDEVDLIFEEEAIKEIAQLALE-----RKTGARGLRAIIEDFCLDIMF
1n25A           ----------------------------------------------------------------------
1g8pA           ----------------------------------------------------------------------
1oz4A2          ----------------------------------------------------------------------
1hqcA2          ----------------------------------------------------------------------
1a5tA2          ----------------------------------------------------------------------
1l8qA2          ----------------------------------------------------------------------
1s9hA           ----------------------------------------------------------------------
1ksfX2          ----------------------------------------------------------------------
1vkpA           ----------------------------------------------------------------------
1sxjE2          ----------------------------------------------------------------------
1d2nA           ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
1jqjC2          ----------------------------------------------------------------------
2aplA1          ----------------------------------------------------------------------
1heiB1          ----------------------------------------------------------------------
2gnoA2          ----------------------------------------------------------------------
1rkbA           ----------------------------------------------------------------------
1ny5B2          ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
1grqA           ----------------------------------------------------------------------
1fnnA2          ----------------------------------------------------------------------
1qvrA2          ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1eg7A           ----------------------------------------------------------------------
1a3qA2          ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1jr3A2          QIRHQLEH----ILNE-------EHIA--HEPRALQLLARAA----------------------------
2bdtA1          ----------------------------------------------------------------------
1iqpA2          ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
2axpA1          ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           DAPELVEKNINITTDYVNEKLGNLVKNKDLSQYIL
1do0A           DASDLSGQNITIDADYVSKHLDALVADEDLSRFIL
1jb0D           -----------------------------------
1qhbA           -----------------------------------
1ksfX3          NEFGSLVDGGQVTVALDKEKN--------------
1qzmA           QLLLDSLKHIEINGDNLHDYLG-------------
1sxjA2          -----------------------------------
1um8A           DLPKLKGSEVRITKDCVLKQAEPLI----------
1n25A           -----------------------------------
1g8pA           -----------------------------------
1oz4A2          -----------------------------------
1hqcA2          -----------------------------------
1a5tA2          -----------------------------------
1l8qA2          -----------------------------------
1s9hA           -----------------------------------
1ksfX2          -----------------------------------
1vkpA           -----------------------------------
1sxjE2          -----------------------------------
1d2nA           -----------------------------------
1lw7A2          -----------------------------------
1jqjC2          -----------------------------------
2aplA1          -----------------------------------
1heiB1          -----------------------------------
2gnoA2          -----------------------------------
1rkbA           -----------------------------------
1ny5B2          -----------------------------------
1e6cA           -----------------------------------
1e2hA           -----------------------------------
1grqA           -----------------------------------
1fnnA2          -----------------------------------
1qvrA2          -----------------------------------
1yr6A1          -----------------------------------
1eg7A           -----------------------------------
1a3qA2          -----------------------------------
1ckeA           -----------------------------------
1jr3A2          -----------------------------------
2bdtA1          -----------------------------------
1iqpA2          -----------------------------------
1zp6A1          -----------------------------------
2axpA1          -----------------------------------