[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for ftul2:ACD31100.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1nrkA2.bssp"
#ERROR : Can't open dsspfile "1pj5A4.bssp"
#ERROR : Can't open dsspfile "1v5vA2.bssp"

## Summary of PDB Search
:248
    1e-32  32%  1nrkA2 [d.250.1.1] YGFZ PROTEIN A:1 -- 243
    3e-15  19%  1pj5A4 [d.250.1.1] N,N-DIMETHYLGLYCINE OXIDASE A:428 -- 742
    3e-15  22%  1v5vA2 [d.250.1.1] AMINOMETHYLTRANSFERASE A:3 -- 312
:248

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxNFKILEVSGVDTKKFLQGLTTADLNGLSIDNDILLTAFANLKGRIISLCFVKFISNEKLLLSVE
1nrkA2          ------------ITGADSEKYXQGQVTADVSQXAEDQH-LLAAHCDAKGKXWSNLRL-FRDGDGFAWIER
1pj5A4          ------PLKRLEVSGPGALKLLQELTTADLAKK--PGAVTYTLLLDHAGGVRSDITVARLSEDTFQLGAN
1v5vA2          ------HMGEIVFRGKDALKFLQYVTTNDISKPP-AISGTYTLVLNERGAIKDETLVFNMGNNEYLMICD


                         .         .         *         .         .         .         .:140
query           QEVFENLLAWLKKYGMFSKVSFNPNDDYALFFTKTGFLNHDILTKGSLTSEMTFEQVRKENIINKLATIN
1nrkA2          RSVREPQLTELKKYAVFSKVTIAPDDERVLLFSELPSKEKQVVKEGATTDEATANXLTDKNIEAGFPVID
1pj5A4          GNIDTAYFERAARHQTQSGSATDTTGGTCCIAKNVVIGGIPTAMRLSYVGELGWEAGQPFGVIAARAAFS
1v5vA2          SDAFEKLYAWFTYLFTKLDLEIELKTYDIAMFAVQGPKARDLAKD-------------------------


                         +         .         .         .         .         *         .:210
query           AANFEKFLPAELDLDNVDKVVCYTKGCYMGQEVIARMHYxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1nrkA2          AANSGQFIPQATNLQALGG-ISFKKGCYTGQEXVARAKF-------------------------------
1pj5A4          SLRLEKGYRTDMTTEGLGFAVKMAKESFIGKGALEGR---------------------------------
1v5vA2          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1nrkA2          --------------------------------------
1pj5A4          --------------------------------------
1v5vA2          --------------------------------------