[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for ftul2:ACD31135.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1sigA.bssp"
#ERROR : Can't open dsspfile "1xl7A1.bssp"
#ERROR : Can't open dsspfile "1aw8.1.bssp"
#ERROR : Can't open dsspfile "1or7A2.bssp"
#ERROR : Can't open dsspfile "1iw7F3.bssp"
#ERROR : Can't open dsspfile "1rp3A3.bssp"
#ERROR : Can't open dsspfile "1z77A2.bssp"
#ERROR : Can't open dsspfile "2fug21.bssp"
#ERROR : Can't open dsspfile "1jeqA3.bssp"
#ERROR : Can't open dsspfile "1ku3A.bssp"
#ERROR : Can't open dsspfile "1vl4A.bssp"
#ERROR : Can't open dsspfile "1b49A.bssp"
#ERROR : Can't open dsspfile "1rp3A1.bssp"

## Summary of PDB Search
:292
    7e-27  36%  1sigA  [a.177.1.1] RNA POLYMERASE PRIMARY SIGMA FACTOR
    1e-21   9%  1xl7A1 [c.43.1.3] PEROXISOMAL CARNITINE O-OCTANOYLTRANSFERASE A:11
    7e-21  13%  1aw8.1 [b.52.2.1] L-ASPARTATE-ALPHA-DECARBOXYLASE A:- -- - B:- -- -
    6e-17  19%  1or7A2 [a.177.1.1] RNA POLYMERASE SIGMA-E FACTOR A:-1 -- 111
    2e-16  26%  1iw7F3 [a.177.1.1] RNA POLYMERASE SIGMA-70 SUBUNIT F:74 -- 257
    4e-16  31%  1rp3A3 [a.177.1.1] RNA POLYMERASE SIGMA FACTOR SIGMA-28 (FLIA) A:0
    4e-15   7%  1z77A2 [a.121.1.1] TRANSCRIPTIONAL REGULATOR (TETR FAMILY) A:76 --
    4e-13  17%  2fug21 [c.47.1.21] NADH-QUINONE OXIDOREDUCTASE CHAIN 2 2:3 -- 180
    6e-10   6%  1jeqA3 [b.131.1.1] KU70 A:254 -- 538
    1e-08  35%  1ku3A  [a.4.13.2] SIGMA FACTOR SIGA
    1e-07   8%  1vl4A  [d.283.1.1] PMBA-RELATED PROTEIN
    7e-06  13%  1b49A  [d.117.1.1] PROTEIN (DEOXYCYTIDYLATE HYDROXYMETHYLASE)
    5e-04  24%  1rp3A1 [a.4.13.1] RNA POLYMERASE SIGMA FACTOR SIGMA-28 (FLIA) A:87
:292

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxDNNLSAYLNFVNTLPVLSLEQEQELARRYKYKKDLDAAQQLVLSHLRFVTK
1sigA           -------------------------KLQQIEEETGLTIEQVKDINRRMSIAKARRAKKEMVEANLRLVIS
1xl7A1          -------------------EESLKKYLESVK--PFANEDEYKKIVQKFQEGAGKRLHQKLLERARGKRNW
1aw8.1          ---------------------------------------------------------RTMLQGKLHRVKV
1or7A2          ---------------------------------HMSEQLTDQVLVERVQ-KGDQKAFNLLVVRYQHKVAS
1iw7F3          ---------------------LDPKTVEEIDQKLKSLPKEHKRYLHIAR--EGEAARQHLIEANLRLVVS
1rp3A3          --------------------------------------------------YSNQIEREELILKYLPLVKA
1z77A2          -------------------------------SASHPEEADFLITLVSVD-EGLRKRILLDLEKSQRVFFD
2fug21          ----------------------------------------------------------------------
1jeqA3          ----------------------------MPFTEKIMATPEQVGKMKAISFENPVLQQHFRNLEALALDLM
1ku3A           ----------------------------------------------------------------------
1vl4A           -------------------------METYVGRFEKLSVKEKMDMAKKA-HESAAKDERVVMVPTVMYKDM
1b49A           ---------------------------------------------------------------------L
1rp3A1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           IARNFSGYGLSIADLIQEGNIGLMKAVSKFDPDQGVRLLSFAVHWIKAEMHDYVLKNWKIVKVATTKAQR
1sigA           IAKKYTNRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSI----------------
1xl7A1          LEEAYLDVRIPSQLNVNFVGPCPHFEHYWPAREGT--QLERGSXXLWHNLNYWQLLRREKLPVHKSGNQF
1aw8.1          THLHYEGSCAIDQDFLDAAGILENEAIDIWNVTNGKRFSTYAIAAERGSRIISVNGAAA-HCASVGDIVI
1or7A2          LVSRYVPSGDV-PDVVQEAFIKAYRALDSFRGDSAFY--TWLYRIAVNTAKNYLVAQGRRPPSSDVDAI-
1iw7F3          IAKKYTGRGLSFLDLIQEGNQGLIRAVEKFEYKRRFKFSTYATWWIRQAINRAIADQAR-----------
1rp3A3          IATNIKKHDVDIRDLISYGVIGLIKAVDNLSTENPKRAEAYIKLRIKGAIYDYL----------------
1z77A2          FVREKLKDLDLAEDVTEEIALKFLXWFFSGFEEVYLRTYQGKPELLKRDXNTLVEEVKVXLRI-------
2fug21          -----------------------------------------KQDFLEETFAKYPPEGRRAAIMPL-----
1jeqA3          EPEQAVDLTLPKVEAMNKRLGSLVDEFKELVYPPDYN---------------------------------
1ku3A           ----------------------------------------------------------------------
1vl4A           VIKKIDGGFLFAMAIARDANPRSGSWYELARTPEDLNPEEIGKRAAE-----------------------
1b49A           HLGLALKEKDFVVDKTGVKTIEIIGASFVADEPFIFGA--LNDEYIQRELEWYKSKSLFVKDI-------
1rp3A1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           KLFFNLRSSKDKIGWLSSENIKELAEELGVKEETVIEMEKRMCQGDASLDLPYTDDDGEQTSxxxxxxxx
1sigA           ----------------------------------------------------------------------
1xl7A1          RXLFSTCKVPGITRDSIXNYFKTESEGHCPTHIAVLCRGRAFV---------------------------
1aw8.1          IASFVTMPDEEARTW--RPNVAYFEGDNEMK---------------------------------------
1or7A2          ----------------------------------------------------------------------
1iw7F3          ----------------------------------------------------------------------
1rp3A3          ----------------------------------------------------------------------
1z77A2          ----------------------------------------------------------------------
2fug21          -----LRRVQQEEGWIRPERIEEIARLVGTTPTEVMGVASFYSY--------------------------
1jeqA3          ----------------------------------------------------------------------
1ku3A           ----------------------------------------------------------------------
1vl4A           ----------------------------------------------------------------------
1b49A           ----------------------------------------------------------------------
1rp3A1          --------------------DEEVAKELGISTEELFKLDKINFSYILSLEEVFRDFARDYSE--------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxVKDVLSGFDTRTKDIIMSRYLLDNKATLQDLAAKYNISAERVRQIEEDA
1sigA           ----------------------------------------------------------------------
1xl7A1          ----------------------------------------------------------------------
1aw8.1          ----------------------------------------------------------------------
1or7A2          ----------------------------------------------------------------------
1iw7F3          ----------------------------------------------------------------------
1rp3A3          ----------------------------------------------------------------------
1z77A2          ----------------------------------------------------------------------
2fug21          ----------------------------------------------------------------------
1jeqA3          ----------------------------------------------------------------------
1ku3A           ---------------------LEKALSKLSEREAMVLKMRKGLIDEHTLEEVGAYFGVTRERIRQIENKA
1vl4A           ----------------------------------------------------------------------
1b49A           ----------------------------------------------------------------------
1rp3A1          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           LAKLKKxxxxxx
1sigA           ------------
1xl7A1          ------------
1aw8.1          ------------
1or7A2          ------------
1iw7F3          ------------
1rp3A3          ------------
1z77A2          ------------
2fug21          ------------
1jeqA3          ------------
1ku3A           LRKLKY------
1vl4A           ------------
1b49A           ------------
1rp3A1          ------------