[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for ftul2:ACD31158.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1yt3A3.bssp"
#ERROR : Can't open dsspfile "2hbjA2.bssp"
#ERROR : Can't open dsspfile "1l3sA1.bssp"
#ERROR : Can't open dsspfile "1d8yA1.bssp"
#ERROR : Can't open dsspfile "1vk0A.bssp"
#ERROR : Can't open dsspfile "1yt3A1.bssp"
#ERROR : Can't open dsspfile "1skrA1.bssp"
#ERROR : Can't open dsspfile "2cprA1.bssp"
#ERROR : Can't open dsspfile "1yt3A2.bssp"
#ERROR : Can't open dsspfile "2e1eA1.bssp"
#ERROR : Can't open dsspfile "2hbjA1.bssp"
#ERROR : Can't open dsspfile "1d8bA.bssp"
#ERROR : Can't open dsspfile "1wudA1.bssp"

## Summary of PDB Search
:364
    2e-28  30%  1yt3A3 [c.55.3.5] RIBONUCLEASE D A:1 -- 193
    2e-23  31%  2hbjA2 [c.55.3.5] EXOSOME COMPLEX EXONUCLEASE RRP6 A:129 -- 420
    9e-22  12%  1l3sA1 [c.55.3.5] DNA POLYMERASE I A:297 -- 468
    1e-20  20%  1d8yA1 [c.55.3.5] DNA POLYMERASE I A:324 -- 518
    1e-13  14%  1vk0A  [c.55.3.5] HYPOTHETICAL PROTEIN
    4e-09  25%  1yt3A1 [a.60.8.3] RIBONUCLEASE D A:194 -- 294
    6e-09  12%  1skrA1 [c.55.3.5] DNA POLYMERASE A:1 -- 210
    1e-08  18%  2cprA1 [a.60.8.4] EXOSOME COMPONENT 10 A:483 -- 595
    1e-08  21%  1yt3A2 [a.60.8.3] RIBONUCLEASE D A:295 -- 375
    3e-07  20%  2e1eA1 [a.60.8.1] WERNER SYNDROME ATP-DEPENDENT HELICASE A:1142 --
    4e-07  19%  2hbjA1 [a.60.8.4] EXOSOME COMPLEX EXONUCLEASE RRP6 A:421 -- 516
    3e-06  19%  1d8bA  [a.60.8.1] SGS1 RECQ HELICASE
    5e-04  34%  1wudA1 [a.60.8.1] ATP-DEPENDENT DNA HELICASE RECQ A:530 -- 606
:364

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MIINTNKQLNNVIEILKNTSQIAVDTEFYWMRTYYPELCLVQLATENEIFLIDTLKDLEFKKLKEIFEDK
1yt3A3          -MITTDDALASLCEAVRAFPAIALDTEFVRTRTYYPQLGLIQLFDGEHLALIDPLGITDWSPLKAILRDP
2hbjA2          IWVDTSTELESMLEDLKNTKEIAVDLEHHDYRSYYGIVCLMQISTRERDYLVDTLKRENLHILNEVFTNP
1l3sA1          --KMAFTLADRVTEEMLADK-AALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDE
1d8yA1          -TILDEETLKAWIAKLEKAPVFAFATATDSLDNISANLVGLSFAIEPGVAAYIPVRERALELLKPLLEDE
1vk0A           -----SPYLSLIREDLNGNRAVIFDVYWDFTKTSGWSLSSVKLSTRNLCLFLRLPKPFHLKDLYRFFASK
1yt3A1          ----------------------------------------------------------------------
1skrA1          ---------------------IVSDIEANALLESVTKFHCGVIYAEYVSYRPSDFGAY-LDALEAEVARG
2cprA1          ----------------------------------------------------------------------
1yt3A2          ----------------------------------------------------------------------
2e1eA1          ----------------------------------------------------------------------
2hbjA1          ----------------------------------------------------------------------
1d8bA           ----------------------------------------------------------------------
1wudA1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           DILKIIHSATNDIPIIKRFFNCEVNNIFDTQLAATFLGFQTQSSXXXXXXXXXXXXXXXXSQFSDWRNRP
1yt3A3          SITKFLHAGSEDLEVFLNVFGELPQPLIDTQILAAFCGRPMSWGFASMVEEYSGVTLDKSESRTDWLARP
2hbjA2          SIVKVFHGAFMDIIWLQRDLGLYVVGLFDTYHASKAIGL-PRHSLAYLLENFANFKTSKKYQLADWRIRP
1l3sA1          TKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVAAAKMKQYEAVRPDEAVYGKGAKRAVP
1d8yA1          KALKVGQNLKYDRGILANYGIELRGIAFDTMLESYILNSVAGRDMDSLAERWLKHKTITFEEIAGKGKNQ
1vk0A           FVTFVGVQIEEDLDLLRENHGLVIRNAINVGKLAAEALVLEFLGTRELAHRVLWSDLGQLDSIEAKWEKA
1yt3A1          ----------------------------------------------------------------------
1skrA1          GLIVFHNGHKYDVPALTKEFHLPRENCIDTLVLSRLIHSNLKDKGEYKDDFKRMLEEQGEEYVDGMEWWN
2cprA1          ----------------------------------------------------------------------
1yt3A2          ----------------------------------------------------------------------
2e1eA1          ----------------------------------------------------------------------
2hbjA1          ----------------------------------------------------------------------
1d8bA           ----------------------------------------------------------------------
1wudA1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           LTQNQLNYAIKDVEYLIQLKEYLQQQLAKSEYQDFFEQELIEVQKxxxxxxENIHAKIGNIQKFDEKTQR
1yt3A3          LTERQCEYAAADVWYLLPITAKLMVETEASGWLPAALDEC------------------------------
2hbjA2          LSKPMTAAARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAK-------------------------
1l3sA1          DEPVLAEHLVRKAAAIWELERPFLDELRR-----------------------------------------
1d8yA1          LTFNQGRYAAEDADVTLQLHLKMWPDLQK-----------------------------------------
1vk0A           GPEEQLEAAAIEGWLIVNVWDQLSDE--------------------------------------------
1yt3A1          ---------------------------------------------------EDAWRDITNAWQLRTRQLA
1skrA1          FNEEMMDYNVQDVVVTKALLEKLLSDKHY-----------------------------------------
2cprA1          --------------------------------------------------------ELYRKQKKHLNTQQ
1yt3A2          ----------------------------------------------------------------------
2e1eA1          -------------------------------------------------------------VISAQEQET
2hbjA1          --------------------------------------------------------ILMYQYNIPPEREV
1d8bA           ----------------------------------------------------------------------
1wudA1          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           NAILIAQWRETIAQEKNIPVRFIFNNKILYTIAHINPKSLNSFEHSELKSLKPWIKKGVVTALNSSKSLD
1yt3A3          ----------------------------------------------------------------------
2hbjA2          ----------------------------------------------------------------------
1l3sA1          ----------------------------------------------------------------------
1d8yA1          ----------------------------------------------------------------------
1vk0A           ----------------------------------------------------------------------
1yt3A1          CLQLLADWRLRKARERDLAVNFVVREEHLWSVARYMPGSLGELD--------------------------
1skrA1          ----------------------------------------------------------------------
2cprA1          LTAFLFAWRDKTARREDESYGYVLPNHMMLKIAEELPKEP-----QGIIACPPLVRQEMHLLIQQAREMP
1yt3A2          ----------------------------------------------------------------------
2e1eA1          QIVLLVEARQKHANKMDVPPAILATNKILVDMAKMRPTTV------------------------------
2hbjA1          LVRELYQWRDLIARRDDESPRFVMPNQLLAALVAYTPTDV------------------------------
1d8bA           ----LRELSLNLGNRMVPPVGNFMPDSILKKMAAILPMND------------------------------
1wudA1          --------RKSIADESNVPPYVVFNDATLIEXAEQXPITA------------------------------


                         .         *         .         .         .         .         +:350
query           QVTLEQTSGSKLSTxxxDKIIDFFDTYTKQLKFDSSIIASRKDIRSLAYNLNIDTNYKNNKLLNGWRYEI
1yt3A3          ----------------------------------------------------------------------
2hbjA2          ----------------------------------------------------------------------
1l3sA1          ----------------------------------------------------------------------
1d8yA1          ----------------------------------------------------------------------
1vk0A           ----------------------------------------------------------------------
1yt3A1          ----------------------------------------------------------------------
1skrA1          ----------------------------------------------------------------------
2cprA1          LLKSEVAAGVKKSS--------------------------------------------------------
1yt3A2          -----------------KAIKSLITDVSETHKISAELLASRRQINQLNWHWKLKPQNNLPELISGWRGEL
2e1eA1          ----------------------------------------------------------------------
2hbjA1          ----------------------------------------------------------------------
1d8bA           ----------------------------------------------------------------------
1wudA1          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           VGKKLKEYIxxxxx
1yt3A3          --------------
2hbjA2          --------------
1l3sA1          --------------
1d8yA1          --------------
1vk0A           --------------
1yt3A1          --------------
1skrA1          --------------
2cprA1          --------------
1yt3A2          MAEALHNLL-----
2e1eA1          --------------
2hbjA1          --------------
1d8bA           --------------
1wudA1          --------------