[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for ftul2:ACD31166.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1a69A.bssp"
#ERROR : Can't open dsspfile "1nw4A.bssp"
#ERROR : Can't open dsspfile "1k3fA.bssp"
#ERROR : Can't open dsspfile "1jysA.bssp"
#ERROR : Can't open dsspfile "1a9oA.bssp"
#ERROR : Can't open dsspfile "1cb0A.bssp"
#ERROR : Can't open dsspfile "1ybfA.bssp"

## Summary of PDB Search
:240
    3e-52  32%  1a69A  [c.56.2.1] PURINE NUCLEOSIDE PHOSPHORYLASE
    2e-36  18%  1nw4A  [c.56.2.1] URIDINE PHOSPHORYLASE, PUTATIVE
    1e-29  16%  1k3fA  [c.56.2.1] URIDINE PHOSPHORYLASE
    3e-21  16%  1jysA  [c.56.2.1] MTA/SAH NUCLEOSIDASE
    6e-13  13%  1a9oA  [c.56.2.1] PURINE NUCLEOSIDE PHOSPHORYLASE
    1e-11  12%  1cb0A  [c.56.2.1] PROTEIN (5'-DEOXY-5'-METHYLTHIOADENOSINE
    2e-06  14%  1ybfA  [c.56.2.1] AMP NUCLEOSIDASE
:240

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxPTPHIETLRKEEFAKTVIMPGDPLRAKYIADNYLENVVRVNAVRNMFGYTGTYXXXXXXXXXXXXXX
1a69A           ----TPHIN-AEMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGI
1nw4A           ----LRHLK-ISKEQITPVVLVVGDPGRVDKIK-VVCDSYVDLAYNREYKSVECHYKGQKFLCVSHGVGS
1k3fA           ---DVFHLG-LTKNDLATLAIVPGDPDRVEKIAA-LMDKPVKLASHREFTTWRAELDGKPVIVCSTGIGG
1jysA           -----------------KIGIIGAMEEEVTLLRDKIEN--RQTISLGGCEIYTGQLNGTEVALLKSGIGK
1a9oA           ----------------------------------------------------------------------
1cb0A           ----------------------------------------------------------------------
1ybfA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           XXXXIYAYELFKYYDVDNIIRVGSAGSYKAEFKVYDVVLIEESYCESNFIEIVTGSKTSDVRSSEELNKE
1a69A           PSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRN
1nw4A           AGCAVCFEELCQ-NGAKVIIRAGSCGSLQPDLKRGDICICNAAVREDRVSHLLIHGDFPAV-GDFDVYDT
1k3fA           PSTSIAVEELAQL-GIRTFLRIGTTGAIQPHINVGDVLVTTA-SVRLDGASLHFAPLEFPAVADFECTTA
1jysA           VAAALGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDADVT-AFGYEYGQLPGGFKADDK
1a9oA           ----TFPVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHLRGPNEERFGVRFPAMSDAYDRDMRQK
1cb0A           ----------LKEEGCTHVIVTTACGSLREEIQPGDIVIIDQFIDRTTMRPQSFYDGSHSCARCPKTREV
1ybfA           ------IXDLLWAIHPKAVIFLGKCGGLKLENALGDYLLPIAAIRGEGTSNDYLPEEVPSLPSFSVLRA-


                         +         .         .         .         .         *         .:210
query           LIASAQRQDIELKKAKAHCTDVFYRKNSDDYKKIVKKYNCDLVEMXXXXXXXXXXXXGKKASAVVTISDS
1a69A           AVDAAKALGIDARVGNLFSADLFYSPDGEMFDVM-EKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDH
1nw4A           LNKCAQELNVPVFNGISVSSDMYYPKIIPSRLEDYSKANAAVVEMELATLMVIGTLRKVKTGGILIVDGC
1k3fA           LVEAAKSIGATTHVGVTASSDTFYVRHFKGSMEEWQAMGVMNYEMESATLLTMCASQGLRAGMVAGVIVN
1jysA           LIAAAEELNLNAVRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISD-
1a9oA           AHSTWKQMGEELQEGTYVMLGGPNF-ETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSLITNK
1cb0A           LIETAKKLGLRCHSKGTMVTIEGPRFSSRAESFMFRTWGADVINMTTVPEVVLAKEAGICYASIAMATDY
1ybfA           ISSAIQNKGKDYWTGTVYTTNRRVWEYDEKFKDYLRSTHASGVDXETATLXTVGFANKIPXGALLLISDR


                         .         .         .         +         .         .         .:280
query           FITGESTTAQQREQSFTNMMEVALGTIKEx
1a69A           IRTHEQTTAAERQTTFNDMIKIALESV---
1nw4A           PFKWDEGDFNLVPHQLENMIKIALGACAK-
1k3fA           RTQQEIPNAETMKQTESHAVKIVVEAARR-
1jysA           --VADQSFDEFLAVAAKQSSLMVESLVQK-
1a9oA           VIMDTE---SQGKANHEEVLEAGK------
1cb0A           --DCWAVSVDRVLKTLKENANKAKSLLLT-
1ybfA           PXFPEGVKTEESNF----------------