[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for ftul2:ACD31231.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1vkbA.bssp"

## Summary of PDB Search
:266
    1e-09  15%  1vkbA  [d.269.1.1] HYPOTHETICAL PROTEIN
:266

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxNYVI
1vkbA           ------------------------------------------------------------------AHIF


                         .         .         *         .         .         .         .:140
query           GYGSLMNKDSRQITVPNATYAAPILVSGFERLWASRGEKSRATFLLAVPNKGYAMNAIYYKADAKDISAT
1vkbA           VYGTLKRGQPNHKVMLDHSHGLAAFRGRGCTVEVIAGEHNIP-WLLYLPGKGHCVTGEIYEVDEQMLRFL


                         +         .         .         .         .         *         .:210
query           DLREASYCRVKIPRKDIVPLGIKSLPKGDFWMYVKDFKDAEFPNKDYxxxxxxxxxxxxxxxxxxxxxxx
1vkbA           DDFE---DCPSMYQRTALQVQVLEWEPGQCFVYTTATYAPEWLFLPY-----------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1vkbA           --------------------------------------------------------