[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for ftul2:ACD31313.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2iv7A1.bssp"
#ERROR : Can't open dsspfile "2bisA1.bssp"
#ERROR : Can't open dsspfile "1gz5A.bssp"
#ERROR : Can't open dsspfile "2bfwA1.bssp"
#ERROR : Can't open dsspfile "1rzuA.bssp"
#ERROR : Can't open dsspfile "1c3jA.bssp"
#ERROR : Can't open dsspfile "2f9fA1.bssp"
#ERROR : Can't open dsspfile "1f0kA.bssp"
#ERROR : Can't open dsspfile "2nzwA1.bssp"
#ERROR : Can't open dsspfile "1a14N.bssp"

## Summary of PDB Search
:366
    6e-34  11%  2iv7A1 [c.87.1.8] LIPOPOLYSACCHARIDE CORE BIOSYNTHESIS PROTEIN A:2
    4e-25  23%  2bisA1 [c.87.1.8] GLGA GLYCOGEN SYNTHASE A:1 -- 437
    4e-24  11%  1gz5A  [c.87.1.6] ALPHA-TREHALOSE-PHOSPHATE SYNTHASE
    1e-17  22%  2bfwA1 [c.87.1.8] GLGA GLYCOGEN SYNTHASE A:218 -- 413
    8e-16  18%  1rzuA  [c.87.1.8] GLYCOGEN SYNTHASE 1
    1e-12  10%  1c3jA  [c.87.1.1] BETA-GLUCOSYLTRANSFERASE
    4e-10  23%  2f9fA1 [c.87.1.8] FIRST MANNOSYL TRANSFERASE (WBAZ-1) A:2 -- 167
    3e-08  11%  1f0kA  [c.87.1.2] UDP-N-ACETYLGLUCOSAMINE-N-ACETYLMURAMYL-
    1e-06  10%  2nzwA1 [c.87.1.11] ALPHA1,3-FUCOSYLTRANSFERASE A:1 -- 349
    2e-04   7%  1a14N  [b.68.1.1] NEURAMINIDASE
:366

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxGGAETMLYKLCKSMDKSIYHITVISLMGRGVFANKLEAYGVKVYTXXXXXXXXXXXX
2iv7A1          -------------GGLQRDFXRIASTVAARGHHVRVYTQSWEGDCPKAFELIQVPVKSHTNHGRNAEYYA
2bisA1          ----------------------------------------------------------------------
1gz5A           -------------GETGNEDQPLKKVKKGNITWASFNLSEQDLDEYYNQFSNAVLWPAFHYRLDLVQFQR
2bfwA1          ----------------------------------------------------------------------
1rzuA           ----------------------------------------------------------------------
1c3jA           ----------------------------------------------------------------------
2f9fA1          ----------------------------------------------------------------------
1f0kA           ----------------------------------------------------------------------
2nzwA1          ----------------------------------------------------------------------
1a14N           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           XXYIKIIRRIKPDVIHAWMYHANVISILCKPFYRKTKYINSIRMGLENYDGHKNLTKFMIKLNAKFSKFS
2iv7A1          WVQ-NHLKEHPADRVVGFNKXPGLDVYFAADVCYAEKVAQEKGFLYRLTSRRHYAAFERATFEQGKSTKL
2bisA1          -----------PDVVHFHDWHTVFAGALIKK-YFKIPAVFTIKSKLPAFYFHEALSELAPYPDIDPEHIA
1gz5A           PAWDGYLRKLLPDIIWIHDYHLLPFAHELRKRGVNNRIGFFLHIPFEQLCDYDLLGFQTENDRLAFLDCL
2bfwA1          ----------------------------------------------------------------------
1rzuA           ----------RPDMVHAHDWQAAMTPVYMR--YAETPEIPSLKLALPAHAFGMEGIEYYNDVSFLKGQTA
1c3jA           ----------NVDIISL--KNGVYTKSFDEVDVNDYDRLIVVNSNLAILSAQKFMAKYKSKIYYLFTDI-
2f9fA1          ----------------------------------------------------------------------
1f0kA           ----AIMKAYKPDVVLGMGGYVSGPGGLAAWSLGIPVVLH-------------EQNGIAGLTNKWLAKIA
2nzwA1          ----------------------------------------------------------------------
1a14N           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           DLTLNNSKKSLEDHQNIGFKNQCFIANGFDKDVFKPSFLKYEKFRLNNDLDDNVKIIGIIARNHADKNIS
2iv7A1          XXLTDKQIADFQKHYQTEPERFQILPPGIYPDRKYSEQIPNSREIYRQKIKEQQNLLLQVGSDFGRKGVD
2bisA1          DIVTTVSRGYLIDEWGFNFEGKTYVFNGIDCSFWNESYLRKKSLLSKFGMDEGVTFMFIGRFDRGQKGVD
1gz5A           SNLTRVTTRSAKSHTAWGKAFRTEYPIGIEPKEIAKQAAGPLKLAQLKAELKNVQNIFSVERLDYSKGLP
2bfwA1          ---------------------------GIDCSFWNESYLTGSRLLSKFGMDEGVTFMFIGRFDRGQKGVD
1rzuA           TALSTVSPSYAEEILTAEFHVLHGIVNGIDADVWNPATDHLEHFRID---DDGSPLFCVISRLTWQKGID
1c3jA           RLPFSQSAYLYTEEELLIKSPIKVISQGINLDIAKAAHKKVDNEFEYFPIEQYKIHMNDFQLSKPTKKTL
2f9fA1          -----------------------------------------------------------VNRIYPEKRIE
1f0kA           TKVMQAFPGAFPNAEVV-------------GNPVRTDVLALPLPQQRLAGREGPVRVLVVGGSQGARILN
2nzwA1          ----------------------------------------------------------------------
1a14N           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           RFLQIANLLLKSNPSLRFLIAGRECSKIDIGSYLDNKSNVNKFFVFESVDSSEYLPVLDLYLSTSKVEGF
2iv7A1          RSIEALASLPESLRHNTLLFVVGQDKPRKFEALAEKLGVRSNVHFFSGRNDVSELXAADLLLHPAYQEAA
2bisA1          VLLKAIEILSKEFQEMRFIIIGKGDPELEGWARSLEEKHGNVKVITEMLFVRELYGSVDFVIIPSYFEPF
1gz5A           ERFLAYEALLEHHGKIRYTQIAQLENEAGRINGKYGQLGWTPLYYLNQHFDRKLLXKIDVGLVTPLRDGX
2bfwA1          VLLKAIEILSSKKEFMRFIIIGKGDPELEGWARSLEEKHGNVKVITEMLSREFVRELYDFVIIPSYFEPF
1rzuA           LMAEAVDEIVSLGGRLVVLGAGDVALEGALAAASRHHGRVGVAIGYNEPLSHLMQAGCDAIIIPSRFEPC
1c3jA           DVIYGGSFRSGQRESKNIEFFGNAREKQFKNPKYPWTKAPVFTGKIPMNMVSEKNSQAIAALKNYNDNFI
2f9fA1          LQLEVFKKL----QDEKLYIVGWFSKGDHAERYARAPDNV-KFLGSVSEEEIDLYSRCKGLLCTAKDEDF
1f0kA           QT--MPQVAAKLGDSVTIWHQSGKGSQQSVEQAYAEAGQPQHKVTEFIDDMAAAYAWADVVVC----RSG
2nzwA1          ---------------------------------------------YNVKNKNEFLSQYKFNLCFENTQGY
1a14N           ----------------------------------------------------RIGEDSDVLVTREPYVSC


                         .         *         .         .         .         .         +:350
query           PNILAEAMLCEVPIVASNVGDCKDILNGYGEVFELSQGNKEIIEKIMKVLETTVVMKKRMREYIINNFSI
2iv7A1          GIVLLEAITAGLPVLTTAVCGYAHYIANCGTVIAEPFSQEQLNEVLRKALPLRXAWAENARHY-ADTQDL
2bisA1          GLVALEAMCLGAIPIASAVGGLRDIITNETGILVKAGDPGELANAILKALELSRSDLSKFRENCKKSFSW
1gz5A           NLVAKEYVAAQDPANPGVLVLSQFAGSALIVNPYDRDEVAAALDRALTXSLAERISRHAEXLDVIVKNDI
2bfwA1          GLVALEAMCLGAIPIASAVGGLRDIINETGILVK-AGDPGELANAILKALELSRSDLSKFRE--------
1rzuA           GLTQLYALRYGCIPVVARTGGLADTVAATGVQFSTLDGLKQAIRRTVRYYHDPKLWTQMQKLGMKSDVSW
1c3jA           TLRVWETMASDAVMLIDEEFDTKHRINDARFYVNNRAELIDRVNELKHSDVLRKEMLSIQHDILAKKAEW
2f9fA1          GLTPIEAXASGKPVIAVNEGGFKETVINEKTGYLVNADVNEIIDAXKKVSKNPDKFKKDCFR--------
1f0kA           ALTVSEIAAAGLPALFVPFQHKDRYWNGAAKIIEQPQLSVDAVANTLAGWETLLTMAERARAASIPD-AT
2nzwA1          TEKIIDAYFSHTIPIYWGSPSVAKDFKSFVNVHDFKNF-DEAIDYIKYLHTHKNAMLYENPLNTLDGKAY
1a14N           DPDECRFYALSTIRGKHSNGTIHDRS--------------------------------------------


                         .         .         .         .         *         .         .:420
query           EAILEKHEKLYHEGxx
2iv7A1          YSLPEKAADIITGG--
2bisA1          EKSAERYVKAY-----
1gz5A           NHWQECFISDLKQ---
2bfwA1          ----------------
1rzuA           EKSAGLYAALYSQ---
1c3jA           QDAFKKAIDL------
2f9fA1          ----------------
1f0kA           ERVANEVSRVA-----
2nzwA1          FYQNLSFKKIL-----
1a14N           ----------------