[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for ftul2:ACD31331.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1bxyA.bssp"

## Summary of PDB Search
:61
    3e-14  38%  1bxyA  [d.59.1.1] PROTEIN (RIBOSOMAL PROTEIN L30)
:61

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxTFKVTLVKSLIGRKENHIASARGLGLRKINHTVEVLDTPENRGMANKIYYMVKIEx
1bxyA           -----RLKVKLVKSPIGYPKDQKAALKALGLRRLQQERVLEDTPAIRGNVEKVAHLVRVE-