[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for ftul2:ACD31359.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1ybdA1.bssp"
#ERROR : Can't open dsspfile "2ap9A1.bssp"
#ERROR : Can't open dsspfile "2bmuA1.bssp"
#ERROR : Can't open dsspfile "2akoA1.bssp"
#ERROR : Can't open dsspfile "1b7bA.bssp"
#ERROR : Can't open dsspfile "2j0wA1.bssp"
#ERROR : Can't open dsspfile "1b0pA3.bssp"
#ERROR : Can't open dsspfile "2cdqA1.bssp"
#ERROR : Can't open dsspfile "1kzhA.bssp"
#ERROR : Can't open dsspfile "1uimA.bssp"

## Summary of PDB Search
:249
    2e-61  42%  1ybdA1 [c.73.1.3] URIDYLATE KINASE A:6 -- 241
    3e-29  17%  2ap9A1 [c.73.1.2] ACETYLGLUTAMATE KINASE A:6 -- 296
    3e-28  27%  2bmuA1 [c.73.1.3] URIDYLATE KINASE A:1 -- 225
    2e-24  16%  2akoA1 [c.73.1.3] GLUTAMATE 5-KINASE A:2 -- 251
    8e-22  21%  1b7bA  [c.73.1.1] CARBAMATE KINASE
    2e-18  29%  2j0wA1 [c.73.1.3] LYSINE-SENSITIVE ASPARTOKINASE 3 A:3 -- 294
    2e-14  10%  1b0pA3 [c.48.1.3] PROTEIN (PYRUVATE-FERREDOXIN OXIDOREDUCTASE)
    2e-14  23%  2cdqA1 [c.73.1.3] ASPARTOKINASE A:25 -- 328
    2e-05  12%  1kzhA  [c.89.1.1] PHOSPHOFRUCTOKINASE
    4e-04  25%  1uimA  [c.79.1.1] THREONINE SYNTHASE
:249

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxSGESLSADQGFGINVESAQPIINQIKTLTNFGVELALVVGGGNILRGG
1ybdA1          ----------------------SGESLXGSDPFGINHDTIVQTVGEIAEVVKXGVQVGIVVGGGNIFRGA
2ap9A1          ------------------------------RRLGIEGD----FKGGFRVTTPEVLDVARXVLFGQVGRE-
2bmuA1          ----------------------GGSVLVPEN---PDIDFIKEIAYQLTKVSE-DHEVAVVVGGGKLARKE
2akoA1          ----------------------GSHVIS--EENTLSFERLKNLVAFLAKLXEKYEVILVTSAAISAGHTK
1b7bA           ----------------------GGNAISNDASAHAQQQALVQTSAYLVHLIKQGHRLIVSHGNGQQAADS
2j0wA1          ----------------------------------------------------------------------
1b0pA3          ----------------------------------------------------------------------
2cdqA1          ----------------------------------------------------------------------
1kzhA           ----------------------------------------------LFVAKENNLNAIIIIGGDDSNTNA
1uimA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           RANFGNKIRRATADSMGMIATMINALALRDMLISEGVDAEVFSAKGVDGLLKVASAHEFNQELAKGRVLI
1ybdA1          QAGSXD---RATADYXGXXATVXNALALKDAFETLGIKARVQSALSXQQIAETYARPKAIQYLEEGKVVI
2ap9A1          ---LVNLINAHGPYAVGITGEDAQLFTAVRRS---VTVDGVATDIGLVGDVDQVNTAAXLDLVAAGRIPV
2bmuA1          VAE-KFNSSETFKDFIGIQITRANAXLL-------------IAALREKAYPVVVEDFWEAWKAVQLKK-I
2akoA1          LD-----IDRKNLINKQVLAAIFLISVYNELLAKFNKLGGQILLTGKDFDSRKHAKNAIDXXINLGILPI
1b7bA           EKNPAMPLDTCVAMTQGSIGYWLSN-ALNQELNKAGIKKQVATVLTTEAEAKEAEAETINTLIKNDIITI
2j0wA1          ----------------------MSTLLFVEILRERDVQAQWFDVRKVIAALAELAALQLLPRLNEGLVIT
1b0pA3          ---------DAERVIVSMGSSCETIEEVINHLAAKGEKIGLIKVRLYRPFVSEAF-FAALPASAKVITVL
2cdqA1          ------------------------------------TTDDFTNGDILEATYPAVAKRLYDDWMHDPAVPI
1kzhA           ALAEYFKKNGENIQVIGVPKTIDADLRNDHIEISFGFDSATKIYSELIGNLCRDAMSTKKY----WHFVK
1uimA           --------------------------AYRYLAREEGIFCEPASAAAMAGVFKLLREGRLE---PESTVVL


                         +         .         .         .         .         *         .:210
query           FAGGTGNPFVTTDTTASLRAVEIGADALLKATTVNGVYDKDPNKYSDAKRFDKVTFSEVVSKELNVMDLG
1ybdA1          FAAGTGNPFFTTDTAAALRGAEXNCDVXLKATNVDGVYTADPKKDPSATRYETITFDEALLKNLKVXDAT
2ap9A1          VSTLAPDANINADTAAAAVAEALGAEKLLXLTDIDGLYTRWPDRDSLVSEIDTGTLLPTLELGXVPKVEA
2bmuA1          PVXGGTHPGHTTDAVAALLAEFLKADLLVVITNVDGVYTADPKKDPTAKKIKKXELLEIVGKGIEVIDPL
2akoA1          INENEEIVFGDNDSLSAYATHFFDADLLVILSDIDGFYDKNPSEFSDAKRLEKITHIKEEWLHGIVTKLK
1b7bA           SCGGGGIPVIDKDFASEKLAELVDADALVILTGVDYVC--INYGKPDEKQLTNVTVAELEEYKQAGHFAP
2j0wA1          FIGSENKGRTTTDYTAALLAEALHASRVDIWTDVPGIYTTDPRVVSAAKRIDEIAFAEMATFGAKVLHPA
1b0pA3          DRTKEPGAPGDPLYLDVCSAFVRGEAMPKILAGRYGLGSKEFSPAMVKSVYDNMAKKNHFTVGI-EDDVT
2cdqA1          VTGFLGKGWVTTDLTATTIGKALGLKEIQVWKDVDGVLTCDPTIYKRATPVPYLTFAELAYFGAQVLHPQ
1kzhA           LMGR------SASHVALECALKTHPNICILSEIIDEMVSVILKRSLNGDNFGVVIVPEGLIEFIPEV---
1uimA           TLTGHGLKDPAT----------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           AFTQCRDFGIPIYVFDLTQPNALVDAVLDSKYGTWVTxx
1ybdA1          AFALCRERKLNIVVFGIAKEGSLKRVITGEDEGTLVH--
2ap9A1          CLRAVIGGVPSAHIIDGRVTHCVLVELFDAGTGTKVV--
2bmuA1          AAKIIARSGIKTIVIGKEDAKDLFRVIKGDHNGTTI---
2akoA1          AAKFLLEHNKKXFLASGFDLSVAKTFLLKQIGGTLF---
1b7bA           GSMLPKISQPNK-QAIITSLENLGSMSGDEIVGTVV---
2j0wA1          TLLPAVRSDIPVFVGSSKDPRA-----------------
1b0pA3          GTSLPVDNAFADTT-------------------------
2cdqA1          SMRPAREGEIPVRVKNSYNPKAP---------GTIIT--
1kzhA           ---------------------------------------
1uimA           ---------------------------------------