[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for ftul2:ACD31463.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1t3tA4.bssp"
#ERROR : Can't open dsspfile "1t3tA6.bssp"
#ERROR : Can't open dsspfile "1t3tA5.bssp"
#ERROR : Can't open dsspfile "1t3tA2.bssp"
#ERROR : Can't open dsspfile "1t3tA7.bssp"
#ERROR : Can't open dsspfile "1t3tA3.bssp"
#ERROR : Can't open dsspfile "1vk3A3.bssp"
#ERROR : Can't open dsspfile "1t3tA1.bssp"
#ERROR : Can't open dsspfile "2z1eA2.bssp"
#ERROR : Can't open dsspfile "1vk3A1.bssp"
#ERROR : Can't open dsspfile "1vk3A2.bssp"
#ERROR : Can't open dsspfile "1cliA2.bssp"
#ERROR : Can't open dsspfile "1l9xA.bssp"
#ERROR : Can't open dsspfile "1vqvA2.bssp"
#ERROR : Can't open dsspfile "1gpwB.bssp"
#ERROR : Can't open dsspfile "1ka9H.bssp"
#ERROR : Can't open dsspfile "1q7rA.bssp"
#ERROR : Can't open dsspfile "2yyeA2.bssp"
#ERROR : Can't open dsspfile "1tklA.bssp"
#ERROR : Can't open dsspfile "1jvnA2.bssp"
#ERROR : Can't open dsspfile "1j42A.bssp"
#ERROR : Can't open dsspfile "1t3tA6.bssp"
#ERROR : Can't open dsspfile "1t3tA7.bssp"
#ERROR : Can't open dsspfile "1vk3A3.bssp"
#ERROR : Can't open dsspfile "2z1eA2.bssp"

## Summary of PDB Search
:1290
    3e-97  67%  1t3tA4 [d.79.4.1] PHOSPHORIBOSYLFORMYLGLYCINAMIDINE SYNTHASE A:221
    6e-57  68%  1t3tA6 [d.139.1.1] PHOSPHORIBOSYLFORMYLGLYCINAMIDINE SYNTHASE A:430
    2e-43  58%  1t3tA5 [d.79.4.1] PHOSPHORIBOSYLFORMYLGLYCINAMIDINE SYNTHASE A:617
    4e-41  59%  1t3tA2 [c.23.16.1] PHOSPHORIBOSYLFORMYLGLYCINAMIDINE SYNTHASE A:1034
    4e-37  42%  1t3tA7 [d.139.1.1] PHOSPHORIBOSYLFORMYLGLYCINAMIDINE SYNTHASE A:817
    1e-36  38%  1t3tA3 [d.284.1.2] PHOSPHORIBOSYLFORMYLGLYCINAMIDINE SYNTHASE A:1
    1e-29  26%  1vk3A3 [d.139.1.1] PHOSPHORIBOSYLFORMYLGLYCINAMIDINE SYNTHASE II
    8e-25  62%  1t3tA1 [a.5.10.1] PHOSPHORIBOSYLFORMYLGLYCINAMIDINE SYNTHASE A:153
    2e-23  17%  2z1eA2 [d.139.1.1] HYDROGENASE EXPRESSION/FORMATION PROTEIN HYPE
    7e-23  33%  1vk3A1 [d.79.4.1] PHOSPHORIBOSYLFORMYLGLYCINAMIDINE SYNTHASE II A:2
    1e-18  16%  1vk3A2 [d.79.4.1] PHOSPHORIBOSYLFORMYLGLYCINAMIDINE SYNTHASE II
    1e-17  10%  1cliA2 [d.139.1.1] PROTEIN (PHOSPHORIBOSYL-AMINOIMIDAZOLE A:171 --
    2e-14  15%  1l9xA  [c.23.16.1] GAMMA-GLUTAMYL HYDROLASE
    5e-13  13%  1vqvA2 [d.139.1.1] THIAMINE MONOPHOSPHATE KINASE A:138 -- 300
    2e-10  14%  1gpwB  [c.23.16.1] AMIDOTRANSFERASE HISH
    2e-08  19%  1ka9H  [c.23.16.1] IMIDAZOLE GLYCEROL PHOSPHTATE SYNTHASE
    1e-07  18%  1q7rA  [c.23.16.1] PREDICTED AMIDOTRANSFERASE
    6e-07  17%  2yyeA2 [d.139.1.1] SELENIDE, WATER DIKINASE A:155 -- 336
    3e-06  25%  1tklA  [d.248.1.1] COPROPORPHYRINOGEN III OXIDASE
    4e-04  18%  1jvnA2 [c.23.16.1] BIFUNCTIONAL HISTIDINE BIOSYNTHESIS PROTEIN A:-3
    7e-04  12%  1j42A  [c.23.16.2] RNA-BINDING PROTEIN REGULATORY SUBUNIT
    4e-09  23%  1t3tA6 [d.139.1.1] PHOSPHORIBOSYLFORMYLGLYCINAMIDINE SYNTHASE A:430(query 850->963)
    4e-13  16%  1t3tA7 [d.139.1.1] PHOSPHORIBOSYLFORMYLGLYCINAMIDINE SYNTHASE A:817(query 464->607)
    5e-06  16%  1vk3A3 [d.139.1.1] PHOSPHORIBOSYLFORMYLGLYCINAMIDINE SYNTHASE II(query 837->968)
    2e-04  16%  2z1eA2 [d.139.1.1] HYDROGENASE EXPRESSION/FORMATION PROTEIN HYPE(query 835->968)
:1290

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MITIFEGLSALSPFKREKILAAAKKISNKVESVSAQYIHVTELESELNSEQERIVKSLLNYNREYGIAQP
1t3tA4          ----------------------------------------------------------------------
1t3tA6          ----------------------------------------------------------------------
1t3tA5          ----------------------------------------------------------------------
1t3tA2          ----------------------------------------------------------------------
1t3tA7          ----------------------------------------------------------------------
1t3tA3          MMEILRGSPALSAFRINKLLARFQAANLQVHNIYAEYVHFADLNAPLNDSEQAQLTRLLQYGPALSSHTP
1vk3A3          ----------------------------------------------------------------------
1t3tA1          ----------------------------------------------------------------------
2z1eA2          ----------------------------------------------------------------------
1vk3A1          ----------------------------------------------------------------------
1vk3A2          ----------------------------------------------------------------------
1cliA2          ----------------------------------------------------------------------
1l9xA           ----------------------------------------------------------------------
1vqvA2          ----------------------------------------------------------------------
1gpwB           ----------------------------------------------------------------------
1ka9H           ----------------------------------------------------------------------
1q7rA           ----------------------------------------------------------------------
2yyeA2          ----------------------------------------------------------------------
1tklA           ----------------------------------------------------------------------
1jvnA2          ----------------------------------------------------------------------
1j42A           ----------------------------------------------------------------------
1t3tA6          ----------------------------------------------------------------------
1t3tA7          ----------------------------------------------------------------------
1vk3A3          ----------------------------------------------------------------------
2z1eA2          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           MGHTFIIAPRVGTISPWSSKATDIIKNTGIKAVKRIERAILFGVEGQVSASELKQIQDIVHDRMVEEVFS
1t3tA4          ----------------------------------------------------------------------
1t3tA6          ----------------------------------------------------------------------
1t3tA5          ----------------------------------------------------------------------
1t3tA2          ----------------------------------------------------------------------
1t3tA7          ----------------------------------------------------------------------
1t3tA3          AGKLLLVTPRPGTISPWSSKATDIAHNCGLQQVDRLERGVAYYIEASLTAEQWRQVAAELHDRMMETVFS
1vk3A3          ----------------------------------------------------------------------
1t3tA1          ----------------------------------------------------------------------
2z1eA2          ----------------------------------------------------------------------
1vk3A1          ----------------------------------------------------------------------
1vk3A2          ----------------------------------------------------------------------
1cliA2          ----------------------------------------------------------------------
1l9xA           ----------------------------------------------------------------------
1vqvA2          ----------------------------------------------------------------------
1gpwB           ----------------------------------------------------------------------
1ka9H           ----------------------------------------------------------------------
1q7rA           ----------------------------------------------------------------------
2yyeA2          ----------------------------------------------------------------------
1tklA           ----------------------------------------------------------------------
1jvnA2          ----------------------------------------------------------------------
1j42A           ----------------------------------------------------------------------
1t3tA6          ----------------------------------------------------------------------
1t3tA7          ----------------------------------------------------------------------
1vk3A3          ----------------------------------------------------------------------
2z1eA2          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           CKDDLYRLFSxxxPKELEFVNVLEKGAQAIKEADRKLGLALSEQEIEYLADEYTKLGRNPTDTELYMFAQ
1t3tA4          ----------------------------------------------------------------------
1t3tA6          ----------------------------------------------------------------------
1t3tA5          ----------------------------------------------------------------------
1t3tA2          ----------------------------------------------------------------------
1t3tA7          ----------------------------------------------------------------------
1t3tA3          SLTDAEKLFI------------------------------------------------------------
1vk3A3          ----------------------------------------------------------------------
1t3tA1          -------------PAPVSSVDLLGEGRQALIDANLRLGLALAEDEIDYLQEAFTKLGRNPNDIELYMFAQ
2z1eA2          ----------------------------------------------------------------------
1vk3A1          --------------------------------------------KLRYLNILKEKLGREPTFVELQAFSV
1vk3A2          ----------------------------------------------------------------------
1cliA2          ----------------------------------------------------------------------
1l9xA           ----------------------------------------------------------------------
1vqvA2          ----------------------------------------------------------------------
1gpwB           ----------------------------------------------------------------------
1ka9H           ----------------------------------------------------------------------
1q7rA           ----------------------------------------------------------------------
2yyeA2          ----------------------------------------------------------------------
1tklA           ----------------------------------------------------------------------
1jvnA2          ----------------------------------------------------------------------
1j42A           ----------------------------------------------------------------------
1t3tA6          ----------------------------------------------------------------------
1t3tA7          ----------------------------------------------------------------------
1vk3A3          ----------------------------------------------------------------------
2z1eA2          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           ANSEHCRHKIFNAKWTIDGQEQDKSLFKMIRNTTEKSPQGVLSAYKDNAAVIEGATAQRFYPNTQTGVYS
1t3tA4          ---------IFNADWIIDGKPQPKSLFKMIKNTFETTPDYVLSAYKDNAAVMEGSAVGRYFADHNTGRYD
1t3tA6          ----------------------------------------------------------------------
1t3tA5          ----------------------------------------------------------------------
1t3tA2          ----------------------------------------------------------------------
1t3tA7          ----------------------------------------------------------------------
1t3tA3          ----------------------------------------------------------------------
1vk3A3          ----------------------------------------------------------------------
1t3tA1          ANSEHCRHK-------------------------------------------------------------
2z1eA2          ----------------------------------------------------------------------
1vk3A1          XWSEHCGYSHTK----------------------KYIRRLPKTGFEGNAGVVNLDDYYS-----------
1vk3A2          ----------------------------------------------------------------------
1cliA2          ----------------------------------------------------------------------
1l9xA           ----------------------------------------------------------------------
1vqvA2          ----------------------------------------------------------------------
1gpwB           ----------------------------------------------------------------------
1ka9H           ----------------------------------------------------------------------
1q7rA           ----------------------------------------------------------------------
2yyeA2          ----------------------------------------------------------------------
1tklA           ----------------------------------------------------------------------
1jvnA2          ----------------------------------------------------------------------
1j42A           ----------------------------------------------------------------------
1t3tA6          ----------------------------------------------------------------------
1t3tA7          ----------------------------------------------------------------------
1vk3A3          ----------------------------------------------------------------------
2z1eA2          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           FNQEEVDILMKVETHNHPTAIAPFSGSATGVGGEIRDEGATGLGAKPKAGLTGFTVSNLNIPGFEQAWET
1t3tA4          FHQEPAHILMKVETHNHPTAISPWPGAATGSGGEIRDEGATGRGAKPKAGLVGFSVSNLRIPGFEQPWE-
1t3tA6          ----------------------------------------------------------------------
1t3tA5          ----------------------------------------------------------------------
1t3tA2          ----------------------------------------------------------------------
1t3tA7          ----------------------------------------------------------------------
1t3tA3          ----------------------------------------------------------------------
1vk3A3          ----------------------------------------------------------------------
1t3tA1          ----------------------------------------------------------------------
2z1eA2          ----------------------------------------------------------------------
1vk3A1          -------VAFKIESHNHPSAIEPYNGAATGVGGIIRD--VLAXGARPTAIFDSLHXSRI----IDGIIE-
1vk3A2          ----------------------------------------------------------------------
1cliA2          ----------------------------------------------------------------------
1l9xA           ----------------------------------------------------------------------
1vqvA2          ----------------------------------------------------------------------
1gpwB           ----------------------------------------------------------------------
1ka9H           ----------------------------------------------------------------------
1q7rA           ----------------------------------------------------------------------
2yyeA2          ----------------------------------------------------------------------
1tklA           ----------------------------------------------------------------------
1jvnA2          ----------------------------------------------------------------------
1j42A           ----------------------------------------------------------------------
1t3tA6          ----------------------------------------------------------------------
1t3tA7          ----------------------------------------------------------------------
1vk3A3          ----------------------------------------------------------------------
2z1eA2          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           SKYGKPNHIVTPLQIMLEAPIGGAHYSNEFGRPNLNGYFRTYEQEVNTSAGKEMFGYHKPIMIAGGMANI
1t3tA4          EDFGKPERIVTALDIMTEGPLGGAAFNNEFGRPALTGYFRTYEEKVNSHNGEELRGYHKPIMLAGGIGNI
1t3tA6          ----------------------------------------------------------------------
1t3tA5          ----------------------------------------------------------------------
1t3tA2          ----------------------------------------------------------------------
1t3tA7          ----------------------------------------------------------------------
1t3tA3          ----------------------------------------------------------------------
1vk3A3          ----------------------------------------------------------------------
1t3tA1          ----------------------------------------------------------------------
2z1eA2          ----------------------------------------------------------------------
1vk3A1          ---------------------GIADYGNSIGVPTVGGELRISSL-----------YAHNPLVNVLAAGVV
1vk3A2          ----------------------------------------------------------------------
1cliA2          ----------------------------------------------------------------------
1l9xA           ----------------------------------------------------------------------
1vqvA2          ----------------------------------------------------------------------
1gpwB           ----------------------------------------------------------------------
1ka9H           ----------------------------------------------------------------------
1q7rA           ----------------------------------------------------------------------
2yyeA2          ----------------------------------------------------------------------
1tklA           ----------------------------------------------------------------------
1jvnA2          ----------------------------------------------------------------------
1j42A           ----------------------------------------------------------------------
1t3tA6          ----------------------------------------------------------------------
1t3tA7          ----------------------------------------------------------------------
1vk3A3          ----------------------------------------------------------------------
2z1eA2          ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           KRMHVEKGDIKVGAKLICLGGPAMRIXXXXXXXXXXXXXDTNSELDFASVQRDNAEMERRCQEVIDRCWQ
1t3tA4          RADHVQKGE-------------------------------------------------------------
1t3tA6          ---------IVVGAKLIVLGGPAMNI-------------------GFASVQRDNPEMERRCQEVIDRCWQ
1t3tA5          ----------------------------------------------------------------------
1t3tA2          ----------------------------------------------------------------------
1t3tA7          ----------------------------------------------------------------------
1t3tA3          ----------------------------------------------------------------------
1vk3A3          --------------------------------------------GTKLSIQVGDPFAEKX---LIEAFLE
1t3tA1          ----------------------------------------------------------------------
2z1eA2          ------------------------------------------EGIAFETELKSDVAPIWD---VVKAVAE
1vk3A1          RN--------------------------------------------------------------------
1vk3A2          ----------------------------------------------------------------------
1cliA2          --------KVSDGDVLIALGSSGPHSNGYSLVRKILEVSGCDPQTTELDGKPLADHLLAPTRIYVKSVLE
1l9xA           ----------------------------------------------------------------------
1vqvA2          ------------------------------------------------ALIQRHLRPTARIDYVKHIQ--
1gpwB           ----------------------------------------------------------------------
1ka9H           ----------------------------------------------------------------------
1q7rA           ----------------------------------------------------------------------
2yyeA2          -------------------------------------------------------------------ARN
1tklA           ----------------------------------------------------------------------
1jvnA2          ----------------------------------------------------------------------
1j42A           ----------------------------------------------------------------------
1t3tA6          ----------------------------------------------------------------------
1t3tA7          -------------------------------------------QLGDKPADVRDVAQLKGFYDA---MQA
1vk3A3          ----------------------------------------------------------------------
2z1eA2          ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           MGENNPITFIHDVGAGGISNAFPELVKDGGGGGYFELRKVNVGEEGLSPLEIWSNESQERYVLSVDPESL
1t3tA4          ----------------------------------------------------------------------
1t3tA6          LGDANPILFIHDVGAGGLSNAMPELVSDGGRGGKFELRDILSDEPGMSPLEIWCNESQERYVLAVAADQL
1t3tA5          ----------------------------------------------------------------------
1t3tA2          ----------------------------------------------------------------------
1t3tA7          ----------------------------------------------------------------------
1t3tA3          ----------------------------------------------------------------------
1vk3A3          XVEEGLVEGAQDLGAGGVLSATSELVAKGNLGAIVHLDRVPLREPDXEPWEILISESQERXAVVTSPQKA
1t3tA1          ----------------------------------------------------------------------
2z1eA2          TIGWENIHAMKDPTRAGLSNALNEIARKSNVGILVREADIPIRPEVRAASEMLGISNEGKVVMVVAREYA
1vk3A1          ----------------------------------------------------------------------
1vk3A2          ----------------------------------------------------------------------
1cliA2          LIEKVDVHAIAHLTGGGFWENIPRVLPD-NTQAVIDESSWQWPEVNVEHHEMYTFNCGVGMIIALPAPEV
1l9xA           ----------------------------------------------------------------------
1vqvA2          ----KYANASXDI-SDGLVADANHLAQRSGVKIEILSEKLPLSNEGKNPIEYALFGGEDQLLFTHPKERW
1gpwB           ----------------------------------------------------------------------
1ka9H           ----------------------------------------------------------------------
1q7rA           ----------------------------------------------------------------------
2yyeA2          LMLSLDATACTDVTGFGLLGHAWNICKNSNIGARIFFEKVPLVKKKIYPKGAIENVTSGGLLFTINKEKL
1tklA           ----------------------------------------------------------------------
1jvnA2          ----------------------------------------------------------------------
1j42A           ----------------------------------------------------------------------
1t3tA6          ----------------------------------------------------------------------
1t3tA7          LVAARKLLAWHDRSDGGLLVTLAEMAFAGHCGVQVDIAAL-----GDDHLAALFNEELG-GVIQVRAEDR
1vk3A3          ----------------------------------------------------------------------
2z1eA2          ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           ELFEQLCNRERCPFAVVGEAISEKHITLNDEYFDNKPVDLPMGLLFGNTPQMHIDVKTVKVEQQAFDTSA
1t3tA4          ----------------------------------------------------------------------
1t3tA6          PLFDELCKRERAPYAVIGDATEEQHLSLHDNHFDNQPIDLPLDVLLGKTPKMTRDV--------------
1t3tA5          --------------------------------------------------------QTLKAKGDALNRAD
1t3tA2          ----------------------------------------------------------------------
1t3tA7          ----------------------------------------------------------------------
1t3tA3          ----------------------------------------------------------------------
1vk3A3          SRILEIARKHLLFGDVVAEVIEEPVYRVXYR--NDLVXEVPVQLLAN-APEEDI----------------
1t3tA1          ----------------------------------------------------------------------
2z1eA2          EEALEAMRKTERNAAIIGEVIADYRVLLETGIGGKRFMEPPEG---------------------------
1vk3A1          ----------------------------------------------------------------------
1vk3A2          ----------------------------------------------------------------------
1cliA2          DKALALLNANGENAWKIGIIKASDSEQR------------------------------------------
1l9xA           ----------------------------------------------------------------------
1vqvA2          N--------PFLDXTEIGRVEEGGVF--------------------------------------------
1gpwB           ----------------------------------------------------------------------
1ka9H           ----------------------------------------------------------------------
1q7rA           ----------------------------------------------------------------------
2yyeA2          EKIDETAKELEVNYWIIGETIAENVLEV------------------------------------------
1tklA           ----------------------------------------------------------------------
1jvnA2          ----------------------------------------------------------------------
1j42A           ----------------------------------------------------------------------
1t3tA6          ----------------------------------------------------------------------
1t3tA7          DAVEALLAQYGLAVHYLGQALAGDRFVITAN--DQTVFSESRTTLRV-----------------------
1vk3A3          ----------------------------------------------------------------------
2z1eA2          ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           IKLDEAIERVLKVPAVASKSFLITIGDRSITGMVARDQMVGPWQVPVADCAVTTATVDSQAGEAMAMGER
1t3tA4          ----------------------------------------------------------------------
1t3tA6          ----------------------------------------------------------------------
1t3tA5          ITIADAVKRVLHLPTVAEKTFLVTIGDRTVTGMVARDQMVGPWQVPVADCAVTTASLDSYYGEAMSIGER
1t3tA2          ----------------------------------------------------------------------
1t3tA7          ----------------------------------------------------------------------
1t3tA3          ----------------------------------------------------------------------
1vk3A3          ----------------------------------------------------------------------
1t3tA1          ----------------------------------------------------------------------
2z1eA2          ----------------------------------------------------------------------
1vk3A1          ----------------------------------------------------------------------
1vk3A2          --------KRVEFEEVNAR-EVFEQYDHXVGTDTV--------VPPGFGAAVXR--IKRDGGYSLVTHSR
1cliA2          ----------------------------------------------------------------------
1l9xA           ----------------------------------------------------------------------
1vqvA2          ----------------------------------------------------------------------
1gpwB           ----------------------------------------------------------------------
1ka9H           ----------------------------------------------------------------------
1q7rA           ----------------------------------------------------------------------
2yyeA2          ----------------------------------------------------------------------
1tklA           ----------------------------------------------------------------------
1jvnA2          ----------------------------------------------------------------------
1j42A           ----------------------------------------------------------------------
1t3tA6          ----------------------------------------------------------------------
1t3tA7          ----------------------------------------------------------------------
1vk3A3          ----------------------------------------------------------------------
2z1eA2          ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           TPVAAINAAASGRLAIAETVTNLLAADIEKLSDIRLSANWMVAANQGDENQKLYETVRAVGMEFAPALGI
1t3tA4          ----------------------------------------------------------------------
1t3tA6          ----------------------------------------------------------------------
1t3tA5          APVALLDFAASARLAVGEALTNIAATQIGDIKRIKLSANWMAAAGHPGEDAGLYDAVKAVGEELCPQLGL
1t3tA2          ----------------------------------------------------------------------
1t3tA7          ----------------------------------------------------------------------
1t3tA3          ----------------------------------------------------------------------
1vk3A3          ----------------------------------------------------------------------
1t3tA1          ----------------------------------------------------------------------
2z1eA2          ----------------------------------------------------------------------
1vk3A1          ----------------------------------------------------------------------
1vk3A2          ADLALQDTYWGTLIAVLESVRKTLSVGAEPLA-ITNCVNYGDPDVDPV---GLSAXXTALK-NACEFSGV
1cliA2          ----------------------------------------------------------------------
1l9xA           ----------------------------------------------------------------------
1vqvA2          ----------------------------------------------------------------------
1gpwB           ----------------------------------------------------------------------
1ka9H           ----------------------------------------------------------------------
1q7rA           ----------------------------------------------------------------------
2yyeA2          ----------------------------------------------------------------------
1tklA           ----------------------------------------------------------------------
1jvnA2          ----------------------------------------------------------------------
1j42A           ----------------------------------------------------------------------
1t3tA6          ----------------------------------------------------------------------
1t3tA7          ----------------------------------------------------------------------
1vk3A3          ----------------------------------------------------------------------
2z1eA2          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           AIPVGKDSMSMKTKWSDNGQAKSVTSPLSLVISGFSPVTNARKTLTxxxxxxxxxxLLHIDLSNGAGRLG
1t3tA4          ----------------------------------------------------------------------
1t3tA6          ----------------------------------------------------------------------
1t3tA5          TIPVGKDSMSMKTRWQEGNEQREMTSPLSLVISAFARVEDVRHTLT------------------------
1t3tA2          ----------------------------------------------------------------------
1t3tA7          --------------------------------------------------------LLLIDLGKGHNALG
1t3tA3          ----------------------------------------------------------------------
1vk3A3          ----------------------------------------------------------------------
1t3tA1          ----------------------------------------------------------------------
2z1eA2          ----------------------------------------------------------------------
1vk3A1          ----------------------------------------------------------------------
1vk3A2          PVASGNASLYNTYQ--------------------------------------------------------
1cliA2          ----------------------------------------------------------------------
1l9xA           ----------------------------------------------------------------------
1vqvA2          ----------------------------------------------------------------------
1gpwB           ----------------------------------------------------------------------
1ka9H           ----------------------------------------------------------------------
1q7rA           ----------------------------------------------------------------------
2yyeA2          ----------------------------------------------------------------------
1tklA           ----------------------------------------------------------------------
1jvnA2          ----------------------------------------------------------------------
1j42A           ----------------------------------------------------------------------
1t3tA6          ----------------------------------------------------------------------
1t3tA7          ----------------------------------------------------------------------
1vk3A3          ------------------------------------------------------------------GATG
2z1eA2          ----------------------------------------------------------------GDHGIA


                         +         .         .         .         .         *         .:910
query           ASCLAQAYNQVGNVAPDIEASKVKVLFENITKLKAENKILAYHDVSDGGVFATLAEMSFAGRKGLDVKLQ
1t3tA4          ----------------------------------------------------------------------
1t3tA6          ----------------------------------------------------------------------
1t3tA5          ----------------------------------------------------------------------
1t3tA2          ----------------------------------------------------------------------
1t3tA7          ATALAQVYRQLGDKPADVRDVAQKGFYDAMQALVAARKLLAWHDRSDGGLLVTLAEMAFAGHCGVQVDIA
1t3tA3          ----------------------------------------------------------------------
1vk3A3          ----------------------------------------------------------------------
1t3tA1          ----------------------------------------------------------------------
2z1eA2          ----------------------------------------------------------------------
1vk3A1          ----------------------------------------------------------------------
1vk3A2          ----------------------------------------------------------------------
1cliA2          ----------------------------------------------------------------------
1l9xA           ----------------------------------------------------------------------
1vqvA2          ----------------------------------------------------------------------
1gpwB           ----------------------------------------------------------------------
1ka9H           ----------------------------------------------------------------------
1q7rA           ----------------------------------------------------------------------
2yyeA2          ----------------------------------------------------------------------
1tklA           ----------------------------------------------------------------------
1jvnA2          ----------------------------------------------------------------------
1j42A           ----------------------------------------------------------------------
1t3tA6          ---------QRDN--PEME-RRCQEVIDRCWQLGDANPILFIHDVGAGGLSNAMPELVSDGGRGGKFELP
1t3tA7          ----------------------------------------------------------------------
1vk3A3          RDGTKLSI-QVGDPFA--EKXLIEAFLEXVE----EGLVEGAQDLGAGGVLSATSELVAKGNLGAIVHLD
2z1eA2          LMSIAFETELKSDVAP------IWDVVKAVAETIGWENIHAMKDPTRAGLSNALNEIARKSNVGILVREA


                         .         .         .         +         .         .         .:980
query           TQDVLAKLFAEEVGVVIQVRNSDVSLVEEMFKDTQIHLCAIAKLNSSDELNIFANGEKTYSNTRVNLQRW
1t3tA4          ----------------------------------------------------------------------
1t3tA6          ----------------------------------------------------------------------
1t3tA5          ----------------------------------------------------------------------
1t3tA2          ----------------------------------------------------------------------
1t3tA7          ALGDLAALFNEELGGVIQVRAEDRDAVEALLAQYGLADCVLGQALAGDRFVITANDQTVFSESRTTLRVW
1t3tA3          ----------------------------------------------------------------------
1vk3A3          ----------------------------------------------------------------------
1t3tA1          ----------------------------------------------------------------------
2z1eA2          ----------------------------------------------------------------------
1vk3A1          ----------------------------------------------------------------------
1vk3A2          ----------------------------------------------------------------------
1cliA2          ----------------------------------------------------------------------
1l9xA           ----------------------------------------------------------------------
1vqvA2          ----------------------------------------------------------------------
1gpwB           ----------------------------------------------------------------------
1ka9H           ----------------------------------------------------------------------
1q7rA           ----------------------------------------------------------------------
2yyeA2          ----------------------------------------------------------------------
1tklA           ----------------------------------------------------------------------
1jvnA2          ----------------------------------------------------------------------
1j42A           ----------------------------------------------------------------------
1t3tA6          GMSPLEIWCNEQERYVLAVAADQLPLFDELCKRERAPYAVIGDATEEQHLSLH-----------------
1t3tA7          ----------------------------------------------------------------------
1vk3A3          RVPLREPDXESQERXAVVTSPQKASRILEIARKHLLFGDVVAEVIEEPVYRVXYRNDL------------
2z1eA2          DIPIRPEVRANEGKVVMVVAREYAEEALEAMRKTERNAAIIGEVIADYRGKVLLETGI------------


                         .         *         .         .         .         .         +:1050
query           WAETSYQIQSIRDNSECAKQEFDSILNTNDKGIHVEATFDLEEDITAKFxxxEKPKVTILREQGVNGQVE
1t3tA4          ----------------------------------------------------------------------
1t3tA6          ----------------------------------------------------------------------
1t3tA5          ----------------------------------------------------------------------
1t3tA2          ----------------------------------------------------ARPKVAVLREQGVNSHVE
1t3tA7          WAETTWQMQRLRDNPQCADQEHEAKANDTDPGLNVKLSFDINEDIAAPY---------------------
1t3tA3          ----------------------------------------------------------------------
1vk3A3          ----------------------------------------------------------------------
1t3tA1          ----------------------------------------------------------------------
2z1eA2          ----------------------------------------------------------------------
1vk3A1          ----------------------------------------------------------------------
1vk3A2          ----------------------------------------------------------------------
1cliA2          ----------------------------------------------------------------------
1l9xA           ----------------------------------------------------KKPIIGILMQKCRNKVMS
1vqvA2          ----------------------------------------------------------------------
1gpwB           -------------------------------------------------------RIGII-SVGPGNIMN
1ka9H           -------------------------------------------------------KALLID-YGSGNLRS
1q7rA           ----------------------------------------------------SNXKIGVLGLQGAVR--E
2yyeA2          ----------------------------------------------------------------------
1tklA           ----------------------------------------------------------------------
1jvnA2          ------------------------------------------------------PVVHVIDVESGNLQ-S
1j42A           ----------------------------------------------------------------------
1t3tA6          ----------------------------------------------------------------------
1t3tA7          ----------------------------------------------------------------------
1vk3A3          ----------------------------------------------------------------------
2z1eA2          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:1120
query           MAAAFTTAGFEAHDVHMSDLHAGRVTLADFKVLVACGGFSYGDVLGAGGGWAKNILFTEKLRDEFSRFFG
1t3tA4          ----------------------------------------------------------------------
1t3tA6          ----------------------------------------------------------------------
1t3tA5          ----------------------------------------------------------------------
1t3tA2          MAAAFHRAGFDAIDVHMSDLLGGRIGLGNFHALVACGGFSYGDVLGAGEGWAKSILFNHRVRDEFETFFH
1t3tA7          ----------------------------------------------------------------------
1t3tA3          ----------------------------------------------------------------------
1vk3A3          ----------------------------------------------------------------------
1t3tA1          ----------------------------------------------------------------------
2z1eA2          ----------------------------------------------------------------------
1vk3A1          ----------------------------------------------------------------------
1vk3A2          ----------------------------------------------------------------------
1cliA2          ----------------------------------------------------------------------
1l9xA           YVKYLESAGARVVPVLDLTEKDYEILFKSINGILFPGGSVDLRRSDYA------KVAKIFYNLSIQSFDD
1vqvA2          ----------------------------------------------------------------------
1gpwB           LYRGVKRASENFEDVSIELVES--PRNDLYDLLFIPGVGHFGEGMRRLRENDL---------IDFVRKHV
1ka9H           AAKALEAAGFSVAVAQDPKA------HEEADLLVLPGQGHFGQVMRAFQESGF---------VERVRRHL
1q7rA           HVRAIEACGAEAVIVKKSE------QLEGLDGLVLPGGESTTXRRLIDRYGLXEPL----------KQFA
2yyeA2          ----------------------------------------------------------------------
1tklA           ----------------------------------------------------------------------
1jvnA2          LTNAIEHLGYEVQLVKSPKDFN----ISGTSRLILPGVGNYGHFV--------DNLFNRGFEKPIREYI-
1j42A           --------------ICPDASLEDAKKEGPYDVVVLPGGNLGAQNLSESAAVKEIL-----------KEQE
1t3tA6          ----------------------------------------------------------------------
1t3tA7          ----------------------------------------------------------------------
1vk3A3          ----------------------------------------------------------------------
2z1eA2          ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:1190
query           RDDTLALGVCNGCQMLAQLKSLIKGAENWPIFIKNKSEQFEARVSMVEIQESDSIWFADMACTKAPIAVA
1t3tA4          ----------------------------------------------------------------------
1t3tA6          ----------------------------------------------------------------------
1t3tA5          ----------------------------------------------------------------------
1t3tA2          RPQTLALGVXNGCQMMSNLRELIPGSELWPRFVRNHSDRFEARFSLVEVTQSPSLLLQGMVGSQMPIAVS
1t3tA7          ----------------------------------------------------------------------
1t3tA3          ----------------------------------------------------------------------
1vk3A3          ----------------------------------------------------------------------
1t3tA1          ----------------------------------------------------------------------
2z1eA2          ----------------------------------------------------------------------
1vk3A1          ----------------------------------------------------------------------
1vk3A2          ----------------------------------------------------------------------
1cliA2          ----------------------------------------------------------------------
1l9xA           GDYFPVWGTCLGFEELSLLISGECLLTATDTVDVA-----------MPLNFTGGQLHSRMFQNFPTELLL
1vqvA2          ----------------------------------------------------------------------
1gpwB           EDERYVVGVCLGMQLLFEESEEAPGVKGLSLIEGNVVKLRSRRLPH------------------------
1ka9H           ERGLPFLGICVGMQVLYEEAPGVRGLGLVPGEVRRFRAVPQMGWNALEFGGAFAPLTGRHFYFANSYYGP
1q7rA           AAGKPXFGTCAGLILLA--------------------KRIVGYDEPHLGLXDITVERNSFGRQ-----RE
2yyeA2          ----------------------------------------------------------------------
1tklA           ----------------------------------------------------------------------
1jvnA2          ESGKPIMGIXVGLQALFA-GSVESPKSTGLNYIDFKLSRFDDSEKPVPEIGWNSCIPSE-----------
1j42A           NRKGLIAAICAGPTALLAHEIGCGSKVTTHPLAKDKMMNGGHYTYSENRVEKDGLILTSRGPGTSFAIVE
1t3tA6          ----------------------------------------------------------------------
1t3tA7          ----------------------------------------------------------------------
1vk3A3          ----------------------------------------------------------------------
2z1eA2          ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:1260
query           HGEGRPLFENDNQQQAMLASAQVALKYIDGQGQATEMYPYNPNGAVNGLTAVTALDGRVLAMMPHPERVY
1t3tA4          ----------------------------------------------------------------------
1t3tA6          ----------------------------------------------------------------------
1t3tA5          ----------------------------------------------------------------------
1t3tA2          HGEGRVEVRDDAHLAALESKGLVALRYVDNFGKVTETYPANPNGSPNGITAVTTENGRVTIMMPHPERVF
1t3tA7          ----------------------------------------------------------------------
1t3tA3          ----------------------------------------------------------------------
1vk3A3          ----------------------------------------------------------------------
1t3tA1          ----------------------------------------------------------------------
2z1eA2          ----------------------------------------------------------------------
1vk3A1          ----------------------------------------------------------------------
1vk3A2          ----------------------------------------------------------------------
1cliA2          ----------------------------------------------------------------------
1l9xA           SLAVEPLTANFHKWSLSVKNFTMNEKLKKF----FNVLTTNTDGKIEFISTMEGYKYPVYGVQWHPEK--
1vqvA2          ----------------------------------------------------------------------
1gpwB           -------MGWNEVIFKDTFPNGYYYFVHTYRAVCEEEHVLGTTEYDGEIFPSAVRKGRILGFQFHPEK--
1ka9H           LTYSLGKGEYEG----------------------------TPFTALLA-------KENLLAPQFHPEK--
1q7rA           SFEAELSIKGVGDGFVGVFIRAPHIVEAGDGVDVLATYNDRIVAAR---------QGQFLGCSFHPE---
2yyeA2          ----------------------------------------------------------------------
1tklA           -------------------------------------------------------------LMSLPEHAS
1jvnA2          -----NLFFGLDPYKRYYFVHSFAAILNSEKKKNLENDGWKIAKAKYGSEEFIAAKNNIFATQFHPEK--
1j42A           ALNGKE----------------------------------------------------------------
1t3tA6          ----------------------------------------------------------------------
1t3tA7          ----------------------------------------------------------------------
1vk3A3          ----------------------------------------------------------------------
2z1eA2          ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:1330
query           RAITNSHIPAEYDEYSVWMRMFRNARKWVG
1t3tA4          ------------------------------
1t3tA6          ------------------------------
1t3tA5          ------------------------------
1t3tA2          RTVANSWHPENWGEDSPWMRIFRNARKQLG
1t3tA7          ------------------------------
1t3tA3          ------------------------------
1vk3A3          ------------------------------
1t3tA1          ------------------------------
2z1eA2          ------------------------------
1vk3A1          ------------------------------
1vk3A2          ------------------------------
1cliA2          ------------------------------
1l9xA           -------APYEWKN-LDGISHAPNAVKT--
1vqvA2          ------------------------------
1gpwB           ----SSK---------IGRKLLEKVIECS-
1ka9H           -----SG--------KAGLAFLALARRY--
1q7rA           ------------------------------
2yyeA2          ------------------------------
1tklA           WLY--NHHPAPGSREAKLLEVTTKPREWV-
1jvnA2          ------------------------------
1j42A           ------------------------------
1t3tA6          ------------------------------
1t3tA7          ------------------------------
1vk3A3          ------------------------------
2z1eA2          ------------------------------