[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for halo0:aspB1

[Show Plain Result]

#ERROR : Can't open dsspfile "1gd9A.bssp"
#ERROR : Can't open dsspfile "1djuA.bssp"
#ERROR : Can't open dsspfile "1djuB.bssp"
#ERROR : Can't open dsspfile "1j32A.bssp"
#ERROR : Can't open dsspfile "1b5pA.bssp"
#ERROR : Can't open dsspfile "1gc3A.bssp"
#ERROR : Can't open dsspfile "1b5oA.bssp"
#ERROR : Can't open dsspfile "5bj4A.bssp"
#ERROR : Can't open dsspfile "1bkgA.bssp"
#ERROR : Can't open dsspfile "5bj3A.bssp"
#ERROR : Can't open dsspfile "1bjwA.bssp"
#ERROR : Can't open dsspfile "1xi9C.bssp"
#ERROR : Can't open dsspfile "1xi9B.bssp"
#ERROR : Can't open dsspfile "1xi9A.bssp"
#ERROR : Can't open dsspfile "1o4sB.bssp"
#ERROR : Can't open dsspfile "1o4sA.bssp"
#ERROR : Can't open dsspfile "2z61A.bssp"
#ERROR : Can't open dsspfile "3e2yA.bssp"
#ERROR : Can't open dsspfile "1w7nA.bssp"
#ERROR : Can't open dsspfile "1w7lA.bssp"
#ERROR : Can't open dsspfile "1yiyA.bssp"
#ERROR : Can't open dsspfile "2r5cB.bssp"
#ERROR : Can't open dsspfile "3e2fA.bssp"
#ERROR : Can't open dsspfile "3fvsA.bssp"
#ERROR : Can't open dsspfile "2o0rB.bssp"
#ERROR : Can't open dsspfile "2o0rA.bssp"
#ERROR : Can't open dsspfile "1u08B.bssp"
#ERROR : Can't open dsspfile "1u08A.bssp"
#ERROR : Can't open dsspfile "1yizA.bssp"
#ERROR : Can't open dsspfile "2r5cA.bssp"
#ERROR : Can't open dsspfile "2gb3F.bssp"
#ERROR : Can't open dsspfile "2gb3E.bssp"
#ERROR : Can't open dsspfile "2gb3D.bssp"
#ERROR : Can't open dsspfile "2gb3C.bssp"
#ERROR : Can't open dsspfile "2gb3B.bssp"
#ERROR : Can't open dsspfile "2gb3A.bssp"
#ERROR : Can't open dsspfile "1v2eB.bssp"
#ERROR : Can't open dsspfile "1v2eA.bssp"
#ERROR : Can't open dsspfile "1v2dA.bssp"
#ERROR : Can't open dsspfile "3b46B.bssp"
#ERROR : Can't open dsspfile "3b46A.bssp"
#ERROR : Can't open dsspfile "3dydB.bssp"
#ERROR : Can't open dsspfile "3dydA.bssp"
#ERROR : Can't open dsspfile "3h14A.bssp"
#ERROR : Can't open dsspfile "1bw0B.bssp"
#ERROR : Can't open dsspfile "1bw0A.bssp"
#ERROR : Can't open dsspfile "1wstA.bssp"
#ERROR : Can't open dsspfile "3eleC.bssp"
#ERROR : Can't open dsspfile "3eleA.bssp"
#ERROR : Can't open dsspfile "2zc0A.bssp"
#ERROR : Can't open dsspfile "2o1bA.bssp"
#ERROR : Can't open dsspfile "2douB.bssp"
#ERROR : Can't open dsspfile "2douA.bssp"
#ERROR : Can't open dsspfile "1ijiA.bssp"
#ERROR : Can't open dsspfile "1geyA.bssp"
#ERROR : Can't open dsspfile "1gexA.bssp"
#ERROR : Can't open dsspfile "1gewA.bssp"
#ERROR : Can't open dsspfile "1fg7A.bssp"
#ERROR : Can't open dsspfile "3ezsB.bssp"
#ERROR : Can't open dsspfile "3ezsA.bssp"
#ERROR : Can't open dsspfile "1vp4B.bssp"
#ERROR : Can't open dsspfile "1vp4A.bssp"
#ERROR : Can't open dsspfile "1x0mA.bssp"
#ERROR : Can't open dsspfile "3fdbA.bssp"
#ERROR : Can't open dsspfile "3jtxA.bssp"
#ERROR : Can't open dsspfile "3f6tB.bssp"
#ERROR : Can't open dsspfile "3f6tA.bssp"
#ERROR : Can't open dsspfile "3eucB.bssp"
#ERROR : Can't open dsspfile "3eucA.bssp"
#ERROR : Can't open dsspfile "2zy5F.bssp"
#ERROR : Can't open dsspfile "2zy5E.bssp"
#ERROR : Can't open dsspfile "2zy5D.bssp"
#ERROR : Can't open dsspfile "2zy5B.bssp"
#ERROR : Can't open dsspfile "2zy5A.bssp"
#ERROR : Can't open dsspfile "2zy4F.bssp"
#ERROR : Can't open dsspfile "2zy4E.bssp"
#ERROR : Can't open dsspfile "2zy4D.bssp"
#ERROR : Can't open dsspfile "2zy4C.bssp"
#ERROR : Can't open dsspfile "2zy4B.bssp"
#ERROR : Can't open dsspfile "2zy4A.bssp"
#ERROR : Can't open dsspfile "2zy3F.bssp"
#ERROR : Can't open dsspfile "2zy3E.bssp"
#ERROR : Can't open dsspfile "2zy3D.bssp"
#ERROR : Can't open dsspfile "2zy3C.bssp"
#ERROR : Can't open dsspfile "2zy3B.bssp"
#ERROR : Can't open dsspfile "2zy3A.bssp"
#ERROR : Can't open dsspfile "1uu2A.bssp"
#ERROR : Can't open dsspfile "1uu1C.bssp"
#ERROR : Can't open dsspfile "1uu1B.bssp"
#ERROR : Can't open dsspfile "1uu1A.bssp"
#ERROR : Can't open dsspfile "1uu0D.bssp"
#ERROR : Can't open dsspfile "1uu0A.bssp"
#ERROR : Can't open dsspfile "2f8jB.bssp"
#ERROR : Can't open dsspfile "2f8jA.bssp"
#ERROR : Can't open dsspfile "3jtxB.bssp"
#ERROR : Can't open dsspfile "1uu2B.bssp"
#ERROR : Can't open dsspfile "1uu0C.bssp"
#ERROR : Can't open dsspfile "1uu0B.bssp"
#ERROR : Can't open dsspfile "1h1cD.bssp"
#ERROR : Can't open dsspfile "1h1cA.bssp"
#ERROR : Can't open dsspfile "2zyjA.bssp"
#ERROR : Can't open dsspfile "2z1yB.bssp"
#ERROR : Can't open dsspfile "2z1yA.bssp"
#ERROR : Can't open dsspfile "2ogeB.bssp"
#ERROR : Can't open dsspfile "2ogeA.bssp"
#ERROR : Can't open dsspfile "2ogaC.bssp"
#ERROR : Can't open dsspfile "2ogaB.bssp"
#ERROR : Can't open dsspfile "2ogaA.bssp"
#ERROR : Can't open dsspfile "1mdzA.bssp"
#ERROR : Can't open dsspfile "1mdxA.bssp"
#ERROR : Can't open dsspfile "1iayA.bssp"
#ERROR : Can't open dsspfile "1iaxA.bssp"
#ERROR : Can't open dsspfile "3fddA.bssp"
#ERROR : Can't open dsspfile "2egyD.bssp"
#ERROR : Can't open dsspfile "2egyC.bssp"
#ERROR : Can't open dsspfile "2egyB.bssp"
#ERROR : Can't open dsspfile "3cbfA.bssp"
#ERROR : Can't open dsspfile "1ynuA.bssp"
#ERROR : Can't open dsspfile "1m7yA.bssp"
#ERROR : Can't open dsspfile "1m4nA.bssp"
#ERROR : Can't open dsspfile "3ihjA.bssp"
#ERROR : Can't open dsspfile "1b8gB.bssp"
#ERROR : Can't open dsspfile "1b8gA.bssp"
#ERROR : Can't open dsspfile "1h1cC.bssp"
#ERROR : Can't open dsspfile "1h1cB.bssp"
#ERROR : Can't open dsspfile "3cq4A.bssp"
#ERROR : Can't open dsspfile "2zg5A.bssp"
#ERROR : Can't open dsspfile "3cq5B.bssp"
#ERROR : Can't open dsspfile "3cq5A.bssp"
#ERROR : Can't open dsspfile "1c7nA.bssp"
#ERROR : Can't open dsspfile "2zy2A.bssp"
#ERROR : Can't open dsspfile "2vgzA.bssp"
#ERROR : Can't open dsspfile "2qlrA.bssp"
#ERROR : Can't open dsspfile "3dc1D.bssp"
#ERROR : Can't open dsspfile "3dc1B.bssp"
#ERROR : Can't open dsspfile "3dc1A.bssp"
#ERROR : Can't open dsspfile "3frkB.bssp"
#ERROR : Can't open dsspfile "3frkA.bssp"
#ERROR : Can't open dsspfile "2r2nA.bssp"
#ERROR : Can't open dsspfile "3cq4B.bssp"
#ERROR : Can't open dsspfile "1mdoA.bssp"
#ERROR : Can't open dsspfile "3cq6A.bssp"
#ERROR : Can't open dsspfile "3ffhB.bssp"
#ERROR : Can't open dsspfile "3ffhA.bssp"
#ERROR : Can't open dsspfile "3dzzB.bssp"
#ERROR : Can't open dsspfile "3dzzA.bssp"
#ERROR : Can't open dsspfile "1lkcA.bssp"
#ERROR : Can't open dsspfile "1lc8A.bssp"
#ERROR : Can't open dsspfile "1lc7A.bssp"
#ERROR : Can't open dsspfile "1lc5A.bssp"
#ERROR : Can't open dsspfile "3hdoB.bssp"
#ERROR : Can't open dsspfile "3hdoA.bssp"
#ERROR : Can't open dsspfile "3ei9B.bssp"
#ERROR : Can't open dsspfile "3ei9A.bssp"
#ERROR : Can't open dsspfile "3ei8A.bssp"
#ERROR : Can't open dsspfile "2z1zA.bssp"
#ERROR : Can't open dsspfile "3eiaB.bssp"
#ERROR : Can't open dsspfile "3eiaA.bssp"
#ERROR : Can't open dsspfile "3ei7B.bssp"
#ERROR : Can't open dsspfile "3ei7A.bssp"
#ERROR : Can't open dsspfile "3ei6B.bssp"
#ERROR : Can't open dsspfile "3ei6A.bssp"
#ERROR : Can't open dsspfile "2z20B.bssp"
#ERROR : Can't open dsspfile "2z20A.bssp"
#ERROR : Can't open dsspfile "3dr7B.bssp"
#ERROR : Can't open dsspfile "3dr4D.bssp"
#ERROR : Can't open dsspfile "3dr4C.bssp"
#ERROR : Can't open dsspfile "3dr4B.bssp"
#ERROR : Can't open dsspfile "3dr4A.bssp"
#ERROR : Can't open dsspfile "3bn1D.bssp"
#ERROR : Can't open dsspfile "3bn1C.bssp"
#ERROR : Can't open dsspfile "3bn1A.bssp"
#ERROR : Can't open dsspfile "1d2fB.bssp"
#ERROR : Can't open dsspfile "1d2fA.bssp"

## Summary of PDB Search
:373
    7e-61  38%  1gd9A  [c.67.1] ASPARTATE AMINOTRANSFERASE
    4e-57  37%  1djuA  [c.67.1] AROMATIC AMINOTRANSFERASE
    6e-57  37%  1djuB  [c.67.1] AROMATIC AMINOTRANSFERASE
    4e-51  35%  1j32A  [c.67.1] ASPARTATE AMINOTRANSFERASE
    4e-50  35%  1b5pA  [c.67.1] PROTEIN (ASPARTATE AMINOTRANSFERASE)
    6e-50  35%  1gc3A  [c.67.1] ASPARTATE AMINOTRANSFERASE
    6e-50  35%  1b5oA  [c.67.1] PROTEIN (ASPARTATE AMINOTRANSFERASE)
    9e-50  36%  5bj4A  [c.67.1] PROTEIN (ASPARTATE AMINOTRANSFERASE)
    2e-49  35%  1bkgA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    1e-48  36%  5bj3A  [c.67.1] PROTEIN (ASPARTATE AMINOTRANSFERASE)
    1e-47  35%  1bjwA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    4e-43  35%  1xi9C  [c.67.1] PUTATIVE TRANSAMINASE
    4e-43  35%  1xi9B  [c.67.1] PUTATIVE TRANSAMINASE
    4e-43  35%  1xi9A  [c.67.1] PUTATIVE TRANSAMINASE
    9e-43  33%  1o4sB  [c.67.1] ASPARTATE AMINOTRANSFERASE
    9e-43  33%  1o4sA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    4e-36  29%  2z61A  [x.x.x] PROBABLE ASPARTATE AMINOTRANSFERASE 2
    2e-32  29%  3e2yA  [x.x.x] KYNURENINE-OXOGLUTARATE TRANSAMINASE 3
    4e-32  30%  1w7nA  [c.67.1] KYNURENINE--OXOGLUTARATE TRANSAMINASE I
    8e-31  29%  1w7lA  [c.67.1] KYNURENINE--OXOGLUTARATE TRANSAMINASE I
    1e-30  29%  1yiyA  [x.x.x] KYNURENINE AMINOTRANSFERASE GLUTAMINE
    1e-30  29%  2r5cB  [x.x.x] KYNURENINE AMINOTRANSFERASE
    1e-30  29%  3e2fA  [x.x.x] KYNURENINE-OXOGLUTARATE TRANSAMINASE 3
    2e-30  29%  3fvsA  [x.x.x] KYNURENINE--OXOGLUTARATE TRANSAMINASE 1
    8e-30  34%  2o0rB  [x.x.x] RV0858C (N-SUCCINYLDIAMINOPIMELATE
    8e-30  34%  2o0rA  [x.x.x] RV0858C (N-SUCCINYLDIAMINOPIMELATE
    1e-29  29%  1u08B  [c.67.1] HYPOTHETICAL AMINOTRANSFERASE YBDL
    1e-29  29%  1u08A  [c.67.1] HYPOTHETICAL AMINOTRANSFERASE YBDL
    2e-29  29%  1yizA  [x.x.x] KYNURENINE AMINOTRANSFERASE GLUTAMINE
    2e-29  29%  2r5cA  [x.x.x] KYNURENINE AMINOTRANSFERASE
    2e-27  31%  2gb3F  [x.x.x] ASPARTATE AMINOTRANSFERASE
    2e-27  31%  2gb3E  [x.x.x] ASPARTATE AMINOTRANSFERASE
    2e-27  31%  2gb3D  [x.x.x] ASPARTATE AMINOTRANSFERASE
    2e-27  31%  2gb3C  [x.x.x] ASPARTATE AMINOTRANSFERASE
    2e-27  31%  2gb3B  [x.x.x] ASPARTATE AMINOTRANSFERASE
    2e-27  31%  2gb3A  [x.x.x] ASPARTATE AMINOTRANSFERASE
    1e-25  34%  1v2eB  [c.67.1] GLUTAMINE AMINOTRANSFERASE
    1e-25  34%  1v2eA  [c.67.1] GLUTAMINE AMINOTRANSFERASE
    1e-25  34%  1v2dA  [c.67.1] GLUTAMINE AMINOTRANSFERASE
    5e-25  29%  3b46B  [x.x.x] AMINOTRANSFERASE BNA3
    5e-25  29%  3b46A  [x.x.x] AMINOTRANSFERASE BNA3
    4e-23  27%  3dydB  [x.x.x] TYROSINE AMINOTRANSFERASE
    4e-23  27%  3dydA  [x.x.x] TYROSINE AMINOTRANSFERASE
    6e-23  34%  3h14A  [x.x.x] AMINOTRANSFERASE, CLASSES I AND II
    4e-19  26%  1bw0B  [c.67.1] PROTEIN (TYROSINE AMINOTRANSFERASE)
    4e-19  26%  1bw0A  [c.67.1] PROTEIN (TYROSINE AMINOTRANSFERASE)
    2e-17  24%  1wstA  [x.x.x] MULTIPLE SUBSTRATE AMINOTRANSFERASE
    3e-17  27%  3eleC  [x.x.x] AMINO TRANSFERASE
    3e-17  27%  3eleA  [x.x.x] AMINO TRANSFERASE
    6e-17  23%  2zc0A  [x.x.x] ALANINE GLYOXYLATE TRANSAMINASE
    3e-16  26%  2o1bA  [x.x.x] AMINOTRANSFERASE, CLASS I
    2e-15  23%  2douB  [x.x.x] PROBABLE N-SUCCINYLDIAMINOPIMELATE
    2e-15  23%  2douA  [x.x.x] PROBABLE N-SUCCINYLDIAMINOPIMELATE
    2e-14  26%  1ijiA  [c.67.1] HISTIDINOL PHOSPHATE AMINOTRANSFERASE
    2e-14  26%  1geyA  [c.67.1] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    2e-14  26%  1gexA  [c.67.1] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    2e-14  26%  1gewA  [c.67.1] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    1e-13  25%  1fg7A  [c.67.1] HISTIDINOL PHOSPHATE AMINOTRANSFERASE
    2e-13  26%  3ezsB  [x.x.x] AMINOTRANSFERASE ASPB
    2e-13  26%  3ezsA  [x.x.x] AMINOTRANSFERASE ASPB
    1e-12  26%  1vp4B  [c.67.1] AMINOTRANSFERASE, PUTATIVE
    1e-12  26%  1vp4A  [c.67.1] AMINOTRANSFERASE, PUTATIVE
    2e-12  21%  1x0mA  [x.x.x] AMINOTRANSFERASE II HOMOLOGUE
    4e-11  21%  3fdbA  [x.x.x] PUTATIVE PLP-DEPENDENT BETA-CYSTATHIONASE
    3e-10  23%  3jtxA  [x.x.x] AMINOTRANSFERASE
    1e-09  32%  3f6tB  [x.x.x] ASPARTATE AMINOTRANSFERASE
    1e-09  32%  3f6tA  [x.x.x] ASPARTATE AMINOTRANSFERASE
    2e-09  32%  3eucB  [x.x.x] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE 2
    2e-09  32%  3eucA  [x.x.x] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE 2
    3e-09  30%  2zy5F  [x.x.x] L-ASPARTATE BETA-DECARBOXYLASE
    3e-09  30%  2zy5E  [x.x.x] L-ASPARTATE BETA-DECARBOXYLASE
    3e-09  30%  2zy5D  [x.x.x] L-ASPARTATE BETA-DECARBOXYLASE
    3e-09  30%  2zy5B  [x.x.x] L-ASPARTATE BETA-DECARBOXYLASE
    3e-09  30%  2zy5A  [x.x.x] L-ASPARTATE BETA-DECARBOXYLASE
    3e-09  30%  2zy4F  [x.x.x] L-ASPARTATE BETA-DECARBOXYLASE
    3e-09  30%  2zy4E  [x.x.x] L-ASPARTATE BETA-DECARBOXYLASE
    3e-09  30%  2zy4D  [x.x.x] L-ASPARTATE BETA-DECARBOXYLASE
    3e-09  30%  2zy4C  [x.x.x] L-ASPARTATE BETA-DECARBOXYLASE
    3e-09  30%  2zy4B  [x.x.x] L-ASPARTATE BETA-DECARBOXYLASE
    3e-09  30%  2zy4A  [x.x.x] L-ASPARTATE BETA-DECARBOXYLASE
    3e-09  30%  2zy3F  [x.x.x] L-ASPARTATE BETA-DECARBOXYLASE
    3e-09  30%  2zy3E  [x.x.x] L-ASPARTATE BETA-DECARBOXYLASE
    3e-09  30%  2zy3D  [x.x.x] L-ASPARTATE BETA-DECARBOXYLASE
    3e-09  30%  2zy3C  [x.x.x] L-ASPARTATE BETA-DECARBOXYLASE
    3e-09  30%  2zy3B  [x.x.x] L-ASPARTATE BETA-DECARBOXYLASE
    3e-09  30%  2zy3A  [x.x.x] L-ASPARTATE BETA-DECARBOXYLASE
    3e-09  27%  1uu2A  [c.67.1] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    3e-09  27%  1uu1C  [c.67.1] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    3e-09  27%  1uu1B  [c.67.1] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    3e-09  27%  1uu1A  [c.67.1] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    3e-09  27%  1uu0D  [c.67.1] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    3e-09  27%  1uu0A  [c.67.1] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    3e-09  27%  2f8jB  [x.x.x] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    3e-09  27%  2f8jA  [x.x.x] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    4e-09  22%  3jtxB  [x.x.x] AMINOTRANSFERASE
    1e-08  27%  1uu2B  [c.67.1] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    2e-08  27%  1uu0C  [c.67.1] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    2e-08  27%  1uu0B  [c.67.1] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    2e-08  26%  1h1cD  [c.67.1] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    2e-08  26%  1h1cA  [c.67.1] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    2e-08  25%  2zyjA  [x.x.x] ALPHA-AMINODIPATE AMINOTRANSFERASE
    2e-08  25%  2z1yB  [x.x.x] ALPHA-AMINODIPATE AMINOTRANSFERASE
    2e-08  25%  2z1yA  [x.x.x] ALPHA-AMINODIPATE AMINOTRANSFERASE
    2e-08  35%  2ogeB  [x.x.x] TRANSAMINASE
    2e-08  35%  2ogeA  [x.x.x] TRANSAMINASE
    2e-08  35%  2ogaC  [x.x.x] TRANSAMINASE
    2e-08  35%  2ogaB  [x.x.x] TRANSAMINASE
    2e-08  35%  2ogaA  [x.x.x] TRANSAMINASE
    2e-08  33%  1mdzA  [c.67.1] ARNB AMINOTRANSFERASE
    2e-08  33%  1mdxA  [c.67.1] ARNB AMINOTRANSFERASE
    2e-08  22%  1iayA  [c.67.1] 1-AMINOCYCLOPROPANE-1-CARBOXYLATE SYNTHASE 2
    2e-08  22%  1iaxA  [c.67.1] 1-AMINOCYCLOPROPANE-1-CARBOXYLATE SYNTHASE 2
    2e-08  30%  3fddA  [x.x.x] L-ASPARTATE-BETA-DECARBOXYLASE
    2e-08  25%  2egyD  [x.x.x] ALPHA-AMINODIPATE AMINOTRANSFERASE
    2e-08  25%  2egyC  [x.x.x] ALPHA-AMINODIPATE AMINOTRANSFERASE
    2e-08  25%  2egyB  [x.x.x] ALPHA-AMINODIPATE AMINOTRANSFERASE
    2e-08  25%  3cbfA  [x.x.x] ALPHA-AMINODIPATE AMINOTRANSFERASE
    3e-08  26%  1ynuA  [x.x.x] 1-AMINOCYCLOPROPANE-1-CARBOXYLATE SYNTHASE
    7e-08  26%  1m7yA  [c.67.1] 1-AMINOCYCLOPROPANE-1-CARBOXYLATE SYNTHASE
    7e-08  26%  1m4nA  [c.67.1] 1-AMINOCYCLOPROPANE-1-CARBOXYLATE SYNTHASE
    7e-08  29%  3ihjA  [x.x.x] ALANINE AMINOTRANSFERASE 2
    7e-08  26%  1b8gB  [c.67.1] PROTEIN (1-AMINOCYCLOPROPANE-1-CARBOXYLATE
    7e-08  26%  1b8gA  [c.67.1] PROTEIN (1-AMINOCYCLOPROPANE-1-CARBOXYLATE
    1e-07  26%  1h1cC  [c.67.1] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    1e-07  26%  1h1cB  [c.67.1] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    3e-07  27%  3cq4A  [x.x.x] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    6e-07  25%  2zg5A  [x.x.x] ALPHA-AMINODIPATE AMINOTRANSFERASE
    6e-07  27%  3cq5B  [x.x.x] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    6e-07  27%  3cq5A  [x.x.x] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    6e-07  23%  1c7nA  [c.67.1] CYSTALYSIN
    8e-07  29%  2zy2A  [x.x.x] L-ASPARTATE 4-CARBOXYLYASE
    8e-07  25%  2vgzA  [x.x.x] KYNURENINE/ALPHA-AMINOADIPATE AMINOTRANSFERASE
    8e-07  25%  2qlrA  [x.x.x] KYNURENINE/ALPHA-AMINOADIPATE AMINOTRANSFERASE
    8e-07  25%  3dc1D  [x.x.x] KYNURENINE/ALPHA-AMINOADIPATE AMINOTRANSFERASE
    8e-07  25%  3dc1B  [x.x.x] KYNURENINE/ALPHA-AMINOADIPATE AMINOTRANSFERASE
    8e-07  25%  3dc1A  [x.x.x] KYNURENINE/ALPHA-AMINOADIPATE AMINOTRANSFERASE
    1e-06  29%  3frkB  [x.x.x] QDTB
    1e-06  29%  3frkA  [x.x.x] QDTB
    1e-06  25%  2r2nA  [x.x.x] KYNURENINE/ALPHA-AMINOADIPATE AMINOTRANSFERASE
    1e-06  27%  3cq4B  [x.x.x] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    6e-06  33%  1mdoA  [c.67.1] ARNB AMINOTRANSFERASE
    8e-06  26%  3cq6A  [x.x.x] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    1e-05  27%  3ffhB  [x.x.x] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    1e-05  27%  3ffhA  [x.x.x] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    1e-05  26%  3dzzB  [x.x.x] PUTATIVE PYRIDOXAL 5'-PHOSPHATE-DEPENDENT C-S
    1e-05  26%  3dzzA  [x.x.x] PUTATIVE PYRIDOXAL 5'-PHOSPHATE-DEPENDENT C-S
    1e-05  23%  1lkcA  [c.67.1] L-THREONINE-O-3-PHOSPHATE DECARBOXYLASE
    1e-05  23%  1lc8A  [c.67.1] L-THREONINE-O-3-PHOSPHATE DECARBOXYLASE
    1e-05  23%  1lc7A  [c.67.1] L-THREONINE-O-3-PHOSPHATE DECARBOXYLASE
    1e-05  23%  1lc5A  [c.67.1] L-THREONINE-O-3-PHOSPHATE DECARBOXYLASE
    1e-05  25%  3hdoB  [x.x.x] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    1e-05  25%  3hdoA  [x.x.x] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    1e-05  27%  3ei9B  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    1e-05  27%  3ei9A  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    1e-05  27%  3ei8A  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    2e-05  28%  2z1zA  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    2e-05  27%  3eiaB  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    2e-05  27%  3eiaA  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    2e-05  28%  3ei7B  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    2e-05  28%  3ei7A  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    2e-05  28%  3ei6B  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    2e-05  28%  3ei6A  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    5e-05  28%  2z20B  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    5e-05  28%  2z20A  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    5e-05  36%  3dr7B  [x.x.x] PUTATIVE PEROSAMINE SYNTHETASE
    5e-05  36%  3dr4D  [x.x.x] PUTATIVE PEROSAMINE SYNTHETASE
    5e-05  36%  3dr4C  [x.x.x] PUTATIVE PEROSAMINE SYNTHETASE
    5e-05  36%  3dr4B  [x.x.x] PUTATIVE PEROSAMINE SYNTHETASE
    5e-05  36%  3dr4A  [x.x.x] PUTATIVE PEROSAMINE SYNTHETASE
    5e-05  36%  3bn1D  [x.x.x] PEROSAMINE SYNTHETASE
    5e-05  36%  3bn1C  [x.x.x] PEROSAMINE SYNTHETASE
    5e-05  36%  3bn1A  [x.x.x] PEROSAMINE SYNTHETASE
    2e-04  26%  1d2fB  [c.67.1] MALY PROTEIN
    2e-04  26%  1d2fA  [c.67.1] MALY PROTEIN
:373

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxFSDRVAQVSISGIRAVFEAAGEDAINLGLGQPDFPTPDHARQAAVDAIESGAADGYTSNRGTAALVD
1gd9A           ----SDRLELVSASEIRKLFDIAAKDVISLGIGEPDFDTPQHIKEYAKEALDKGLTH-YGPNIGLLELRE
1djuA           ----------------------SAKDVISLGIGEPDFDTPQHIKEYAKEALDKGLTH-YGPNIGLLELRE
1djuB           -------------------------DVISLGIGEPDFDTPQHIKEYAKEALDKGLTH-YGPNIGLLELRE
1j32A           --------------------KAEGIDVCSFSAGEPDFNTPKHIVEAAKAALEQGKTR-YGPAAGEPRLRE
1b5pA           --------ATVAVNAKALELRRQGVDLVALTAGEPDFDTPEHVKEAARRALAQGKTK-YAPPAGIPELRE
1gc3A           --------AVVAVNAKALELRRQGVDLVALTAGEPDFDTPEHVKEAARRALAQGKTK-YAPPAGIPELRE
1b5oA           --------ATVAVNAKALELRRQGVDLVALTAGEPDFDTPEHVKEAARRALAQGKTK-YAPPAGIPELRE
5bj4A           -----------------------GVDLVALTAGEPDFDTPEHVKEAARRALAQGKTK-YAPPAGIPELRE
1bkgA           --------ATVAVNAKALELRRQGVDLVALTAGEPDFDTPEHVKEAARRALAQGKTK-YAPPAGIPELRE
5bj3A           ---------------------------VALTAGEPDFDTPEHVKEAARRALAQGKTK-YAPPAGIPELRE
1bjwA           --------ATVAVNAKALELRRQGVDLVALTAGEPDFDTPEHVKEAARRALAQGKTK-YAPPAGIPELRE
1xi9C           --------------------EKKGIKVIRLNIGDPDFQPPEHMKEAYCKAIKEGH-NYYGDSEGLPELRK
1xi9B           --------------------EKKGIKVIRLNIGDPDFQPPEHMKEAYCKAIKEGH-NYYGDSEGLPELRK
1xi9A           --------------------EKKGIKVIRLNIGDPDFQPPEHMKEAYCKAIKEGH-NYYGDSEGLPELRK
1o4sB           ----SRRISEIPISKTMELDAKAGEDVINLTAGEPDFPTPEPVVEEAVRFLQKGEVK-YTDPRGIYELRE
1o4sA           ----SRRISEIPISKTMELDAKAGEDVINLTAGEPDFPTPEPVVEEAVRFLQKGEVK-YTDPRGIYELRE
2z61A           ----------MDILALAQKLESEGKKVIHLEIGEPDFNTPKPIVDEGIKSLKEGKTH-YTDSRGILELRE
3e2yA           ---------------------AADPSVVNLGQGFPDISPPSYVKEELSKAAFIDNMNQYTRGFGHPALVK
1w7nA           ---------------------ASEHDVVNLGQGXXXXXXXXXAVEAFQHAVSGDMLNQYTKTFGYPPLTK
1w7lA           ---------------------ASEHDVVNLGQGXXXXXXXXXAVEAFQHAVSGDMLNQYTKTFGYPPLTK
1yiyA           ---------------------AAQYKPLNLGQGFPDYHXXXXXXXXXXXXXXXXXXXXYTRGFGHPRLVQ
2r5cB           ---------------------AAQYKPLNLGQGFPDYHXXXXXXXXXXXXXXXXXXXXYTRGFGHPRLVQ
3e2fA           ---------------------AADPSVVNLGQGFPDISPPSYVKEELSKAAFIDNMNQYTRGFGHPALVK
3fvsA           ---------------------ASEHDVVNLGQGXXXXXXXXXAVEAFQHAVSGDMLNQYTKTFGYPPLTK
2o0rB           --------------------------AVNLGQGFPDEDGPPKMLQAAQDAI-AGGVNQYPPGPGSAPLRR
2o0rA           --------------------------AVNLGQGFPDEDGPPKMLQAAQDAI-AGGVNQYPPGPGSAPLRR
1u08B           ---------------------AQQHQAINLSQGFPDFDGPRYLQERLAHHVAQGA-NQYAPMTGVQALRE
1u08A           ---------------------AQQHQAINLSQGFPDFDGPRYLQERLAHHVAQGA-NQYAPMTGVQALRE
1yizA           ---------------------AAQYKPLNLGQGFPDYHXXXXXXXXXXXXXXXXXXXXYTRGFGHPRLVQ
2r5cA           ---------------------AAQYKPLNLGQGFPDYHXXXXXXXXXXXXXXXXXXXXYTRGFGHPRLVQ
2gb3F           ---FSDRVLLTEESPIRKLVPFAGVRIHHLNIGQPDLKTPEVFFERIYE--NKPEVVYYSHSAGIWELRE
2gb3E           ---FSDRVLLTEESPIRKLVPFAGVRIHHLNIGQPDLKTPEVFFERIYE--NKPEVVYYSHSAGIWELRE
2gb3D           ---FSDRVLLTEESPIRKLVPFAGVRIHHLNIGQPDLKTPEVFFERIYE--NKPEVVYYSHSAGIWELRE
2gb3C           ---FSDRVLLTEESPIRKLVPFAGVRIHHLNIGQPDLKTPEVFFERIYE--NKPEVVYYSHSAGIWELRE
2gb3B           ---FSDRVLLTEESPIRKLVPFAGVRIHHLNIGQPDLKTPEVFFERIYE--NKPEVVYYSHSAGIWELRE
2gb3A           ---FSDRVLLTEESPIRKLVPFAGVRIHHLNIGQPDLKTPEVFFERIYE--NKPEVVYYSHSAGIWELRE
1v2eB           --------------------------AVNLGQGFPSNPPPPFLLEAVRRAL--GRQDQYAPPAGLPALRE
1v2eA           --------------------------AVNLGQGFPSNPPPPFLLEAVRRAL--GRQDQYAPPAGLPALRE
1v2dA           --------------------------AVNLGQGFPSNPPPPFLLEAVRRAL--GRQDQYAPPAGLPALRE
3b46B           -----------------------GRELINLGQGFFSYSPPQFAIKEAQKALDIPMVNQYSPTRGRPSLIN
3b46A           -----------------------GRELINLGQGFFSYSPPQFAIKEAQKALDIPMVNQYSPTRGRPSLIN
3dydB           ---------------------------ISLSIGDPNLPTDPEVTQAMKDALDSGKYNGYAPSIGFLSSRE
3dydA           ---------------------------ISLSIGDPNLPTDPEVTQAMKDALDSGKYNGYAPSIGFLSSRE
3h14A           -------------------------------VGQPGTGAPRGAVEALAKSLE-----------GLPALRQ
1bw0B           ------------------------------------------------EAIDSQECNGYFPTVGSPEARE
1bw0A           ------------------------------------------------EAIDSQECNGYFPTVGSPEARE
1wstA           ---FSEKAMLMKASEVRELLKLVESDVISLGLPAPETFPVETIKKIAVEVLEEHAALQYGTTKGFTPLRL
3eleC           -------------SAIRELFEVGKENVYDFSIGNPSIPAPQIVNDTIKELVDSVALHGYTSAQGDVETRA
3eleA           -------------SAIRELFEVGKENVYDFSIGNPSIPAPQIVNDTIKELVDSVALHGYTSAQGDVETRA
2zc0A           -----------------------GVKLISLAAGDPD---PELIPRAVLGEIAKEVLEKYTPANGIPELRE
2o1bA           -------------------------------VGIPDGPTPQGIIDHFQKALTIPENQKYGAFHGKEAFKQ
2douB           -----------------------GVGLIDLSIGSTDXXXXXXXXXXXXXXXNDPTTYGYCLKSCTLPFLE
2douA           -----------------------GVGLIDLSIGSTDXXXXXXXXXXXXXXXNDPTTYGYCLKSCTLPFLE
1ijiA           -----------------------------------------------------------TLNRYPECQPK
1geyA           -----------------------------------------------------------TLNRYPECQPK
1gexA           -----------------------------------------------------------TLNRYPECQPK
1gewA           -----------------------------------------------------------TLNRYPECQPK
1fg7A           -----------------------------------------------------------TLNRYPECQPK
3ezsB           ---------------------------LDLGIGEPQFETPKFIQDALKNHTHS--LNIYPKSAFEESLRA
3ezsA           ---------------------------LDLGIGEPQFETPKFIQDALKNHTHS--LNIYPKSAFEESLRA
1vp4B           ------KIGQNKSSIIREILKAADKDAISFGGGVPDPETFPRXXXXXXXXXXXXXXYHYTTTEGDPVLKQ
1vp4A           ------KIGQNKSSIIREILKAADKDAISFGGGVPDPETFPRXXXXXXXXXXXXXXYHYTTTEGDPVLKQ
1x0mA           ---FSKKALEMRASEVRELLKLVESDIISLAGGLPNPKTKEIIRDILVEIMEKYAALQYGTTKGFTPLRE
3fdbA           -----------------------GQGVLPLWVAESDFSTCPAVLQAITDAVQREAF-GYQPDG--SLLSQ
3jtxA           -------------------------EAVPLHIGEPKHPTPKVITDALTASLHE--LEKYPLTAGLPELRQ
3f6tB           ----------------------------------------------------------------------
3f6tA           ----------------------------------------------------------------------
3eucB           ----------------------------------------------------------------------
3eucA           ----------------------------------------------------------------------
2zy5F           ----------------------------------------------------------------------
2zy5E           ----------------------------------------------------------------------
2zy5D           ----------------------------------------------------------------------
2zy5B           ----------------------------------------------------------------------
2zy5A           ----------------------------------------------------------------------
2zy4F           ----------------------------------------------------------------------
2zy4E           ----------------------------------------------------------------------
2zy4D           ----------------------------------------------------------------------
2zy4C           ----------------------------------------------------------------------
2zy4B           ----------------------------------------------------------------------
2zy4A           ----------------------------------------------------------------------
2zy3F           ----------------------------------------------------------------------
2zy3E           ----------------------------------------------------------------------
2zy3D           ----------------------------------------------------------------------
2zy3C           ----------------------------------------------------------------------
2zy3B           ----------------------------------------------------------------------
2zy3A           ----------------------------------------------------------------------
1uu2A           -------------------YETEKRDKTYLALNENPFPFPEDLVDEVFRRLNSDALRIYYDSPD-----E
1uu1C           -------------------YETEKRDKTYLALNENPFPFPEDLVDEVFRRLNSDALRIYYDSPD-----E
1uu1B           -------------------YETEKRDKTYLALNENPFPFPEDLVDEVFRRLNSDALRIYYDSPD-----E
1uu1A           -------------------YETEKRDKTYLALNENPFPFPEDLVDEVFRRLNSDALRIYYDSPD-----E
1uu0D           -------------------YETEKRDKTYLALNENPFPFPEDLVDEVFRRLNSDALRIYYDSPD-----E
1uu0A           -------------------YETEKRDKTYLALNENPFPFPEDLVDEVFRRLNSDALRIYYDSPD-----E
2f8jB           -------------------YETEKRDKTYLALNENPFPFPEDLVDEVFRRLNSDALRIYYDSPD-----E
2f8jA           -------------------YETEKRDKTYLALNENPFPFPEDLVDEVFRRLNSDALRIYYDSPD-----E
3jtxB           -------------------------EAVPLHIGEPKHPTPKVITDALTASLHE--LEKYPLTAGLPELRQ
1uu2B           -------------------------DKTYLALNENPFPFPEDLVDEVFRRLNSDALRIYYDSPD-----E
1uu0C           -----------------------------LALNENPFPFPEDLVDEVFRRLNSDALRIYYDSPD-----E
1uu0B           -----------------------------LALNENPFPFPEDLVDEVFRRLNSDALRIYYDSPD-----E
1h1cD           -------------------YETEKRDKTYLALNENPFPFPEDLVDEVFRRLNSDALRIYYDSPD-----E
1h1cA           -------------------YETEKRDKTYLALNENPFPFPEDLVDEVFRRLNSDALRIYYDSPD-----E
2zyjA           -------------------------------------------REKGEVALQYSPTEGYAPLRAFVA---
2z1yB           -------------------------------------------REKGEVALQYSPTEGYAPLRAFVA---
2z1yA           -------------------------------------------REKGEVALQYSPTEGYAPLRAFVA---
2ogeB           ----------------------------------------------------------------------
2ogeA           ----------------------------------------------------------------------
2ogaC           ----------------------------------------------------------------------
2ogaB           ----------------------------------------------------------------------
2ogaA           ----------------------------------------------------------------------
1mdzA           ----------------------------------------------------------------------
1mdxA           ----------------------------------------------------------------------
1iayA           ----------------------------------------------------------------------
1iaxA           ----------------------------------------------------------------------
3fddA           ----------------------------------------------------------------------
2egyD           -------------------------------------------REKGEVALQYSPTEGYAPLRAFVA---
2egyC           -------------------------------------------REKGEVALQYSPTEGYAPLRAFVA---
2egyB           -------------------------------------------REKGEVALQYSPTEGYAPLRAFVA---
3cbfA           -------------------------------------------REKGEVALQYSPTEGYAPLRAFVA---
1ynuA           ------------------------------------------------------------------AMVD
1m7yA           ------------------------------------------------------------------AMVD
1m4nA           ------------------------------------------------------------------AMVD
3ihjA           ----------------------------------------------------------------------
1b8gB           ------------------------------------------------------------------AMVD
1b8gA           ------------------------------------------------------------------AMVD
1h1cC           -----------------------------LALNENPFPFPEDLVDEVFRRLNSDALRIYYDSPD-----E
1h1cB           -----------------------------LALNENPFPFPEDLVDEVFRRLNSDALRIYYDSPD-----E
3cq4A           -----------------------------------------------------------TELRDAVELRD
2zg5A           -------------------------------------------REKGEVALQYSPTEGYAPLRAFVA---
3cq5B           --------------------------------------------------------------RDAVELRD
3cq5A           --------------------------------------------------------------RDAVELRD
1c7nA           -----------------------GNEVVPLSVADMEFKNPPELIEGLKKYLDETVL-GYT---GPTEEYK
2zy2A           ----------------------------------------------------------------------
2vgzA           ----------------------------------------------------------------------
2qlrA           ----------------------------------------------------------------------
3dc1D           ----------------------------------------------------------------------
3dc1B           ----------------------------------------------------------------------
3dc1A           ----------------------------------------------------------------------
3frkB           ----------------------------------------------------------------------
3frkA           ----------------------------------------------------------------------
2r2nA           ----------------------------------------------------------------------
3cq4B           -------------------------------------------------------------------LRD
1mdoA           ----------------------------------------------------------------------
3cq6A           --------------------------------------------------------------RDAVELRD
3ffhB           ----------------------------------------------------------------------
3ffhA           ----------------------------------------------------------------------
3dzzB           ----------------------------------------------------------------------
3dzzA           ----------------------------------------------------------------------
1lkcA           ----------------------------------------------------------------------
1lc8A           ----------------------------------------------------------------------
1lc7A           ----------------------------------------------------------------------
1lc5A           ----------------------------------------------------------------------
3hdoB           ----------------------------------------------------------------------
3hdoA           ----------------------------------------------------------------------
3ei9B           ----------------------------------------------------------------------
3ei9A           ----------------------------------------------------------------------
3ei8A           ----------------------------------------------------------------------
2z1zA           ----------------------------------------------------------------------
3eiaB           ----------------------------------------------------------------------
3eiaA           ----------------------------------------------------------------------
3ei7B           ----------------------------------------------------------------------
3ei7A           ----------------------------------------------------------------------
3ei6B           ----------------------------------------------------------------------
3ei6A           ----------------------------------------------------------------------
2z20B           ----------------------------------------------------------------------
2z20A           ----------------------------------------------------------------------
3dr7B           ----------------------------------------------------------------------
3dr4D           ----------------------------------------------------------------------
3dr4C           ----------------------------------------------------------------------
3dr4B           ----------------------------------------------------------------------
3dr4A           ----------------------------------------------------------------------
3bn1D           ----------------------------------------------------------------------
3bn1C           ----------------------------------------------------------------------
3bn1A           ----------------------------------------------------------------------
1d2fB           ----------------------------------------------------------------------
1d2fA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           AIVEKHARDQGVDVAPAGVIATAGGSEALHLAMEAHVDPGDEVLFPDPGFVSYDALTRMAGGNPVGLPLR
1gd9A           AIAEKLKKQNGIEADPTEIMVLLGANQAFLMGLSAFLKDGEEVLIPTPAFVSYAPAVILAGGKPVEVPTE
1djuA           AIAEKLKKQNGIEADPTEIMVLLGANQAFLMGLSAFLKDGEEVLIPTPAFVSYAPAVILAGGKPVEVPTE
1djuB           AIAEKLKKQNGIEADPTEIMVLLGANQAFLMGLSAFLKDGEEVLIPTPAFVSYAPAVILAGGKPVEVPTE
1j32A           AIAQKLQRDNGLCYGADNILVTNGGKQSIFNLMLAMIEPGDEVIIPAPFWVSYPEMVKLAEGTPVILPVE
1b5pA           ALAEKFRRENGLSVTPEETIVTVGGSQALFNLFQAILDPGDEVIVLSPYWVSYPEMVRFAGGVVVEVETE
1gc3A           ALAEKFRRENGLSVTPEETIVTVGGSQALFNLFQAILDPGDEVIVLSPYWVSYPEMVRFAGGVVVEVETE
1b5oA           ALAEKFRRENGLSVTPEETIVTVGGSQALFNLFQAILDPGDEVIVLSPYWVSYPEMVRFAGGVVVEVETE
5bj4A           ALAEKFRRENGLSVTPEETIVTVGGSQALFNLFQAILDPGDEVIVLSPYWVSYPEMVRFAGGVVVEVETE
1bkgA           ALAEKFRRENGLSVTPEETIVTVGGKQALFNLFQAILDPGDEVIVLSPYWVSYPEMVRFAGGVVVEVETE
5bj3A           ALAEKFRRENGLSVTPEETIVTVGGSQALFNLFQAILDPGDEVIVLSPYWVSYPEMVRFAGGVVVEVETE
1bjwA           ALAEKFRRENGLSVTPEETIVTVGGKQALFNLFQAILDPGDEVIVLSPYWVSYPEMVRFAGGVVVEVETE
1xi9C           AIVEREKRKNGVDITPDDVRVTAAVTEALQLIFGALLDPGDEILVPGPSYPPYTGLVKFYGGKPVEYRTI
1xi9B           AIVEREKRKNGVDITPDDVRVTAAVTEALQLIFGALLDPGDEILVPGPSYPPYTGLVKFYGGKPVEYRTI
1xi9A           AIVEREKRKNGVDITPDDVRVTAAVTEALQLIFGALLDPGDEILVPGPSYPPYTGLVKFYGGKPVEYRTI
1o4sB           GIAKRIGERYKKDISPDQVVVTNGAKQALFNAFMALLDPGDEVIVFSPVWVSYIPQIILAGGNVVETFMS
1o4sA           GIAKRIGERYKKDISPDQVVVTNGAKQALFNAFMALLDPGDEVIVFSPVWVSYIPQIILAGGNVVETFMS
2z61A           KISELYKDKYKADIIPDNIIITXXXXXXXXXXXXXIIDDGDEVLIQNPCYPCYKNFIRFLGAKPVFC---
3e2yA           ALSCLYGKIYQRQIDPEEILVAVGAYGSLFNSIQGLVDPGDEVIIMVPFYDCYEPMVRMAGAVPVFIPLR
1w7nA           ILASFFGELLGQEIDPLNVLVTVGGYGALFTAFQALVDEGDEVIIIEPFFDCYEPMTMMAGGRPVFVSLK
1w7lA           ILASFFGELLGQEIDPLNVLVTVGGYGALFTAFQALVDEGDEVIIIEPFFDCYEPMTMMAGGRPVFVSLK
1yiyA           ALSKLYSQLVDRTINPTEVLVTVGAYEALYATIQGHVDEGDEVIIIEPFFDCYEPMVKAAGGIPRFIPLK
2r5cB           ALSKLYSQLVDRTINPTEVLVTVGAYEALYATIQGHVDEGDEVIIIEPFFDCYEPMVKAAGGIPRFIPLK
3e2fA           ALSCLYGKIYQRQIDPEEILVAVGAYGSLFNSIQGLVDPGDEVIIMVPFYDCYEPMVRMAGAVPVFIPLR
3fvsA           ILASFFGELLGQEIDPLNVLVTVGGYGALFTAFQALVDEGDEVIIIEPFFDCYEPMTMMAGGRPVFVSLK
2o0rB           AIAAQRRRHFGVDYDPTEVLVTVGATEAIAAAVLGLVEPGSEVLLIEPFYDSYSPVVAMAGAHRVTVPLV
2o0rA           AIAAQRRRHFGVDYDPTEVLVTVGATEAIAAAVLGLVEPGSEVLLIEPFYDSYSPVVAMAGAHRVTVPLV
1u08B           AIAQKTERLYGYQPADSDITVTAGATEALYAAITALVRNGDEVICFDPSYDSYAPAIALSGGIVKRMALQ
1u08A           AIAQKTERLYGYQPADSDITVTAGATEALYAAITALVRNGDEVICFDPSYDSYAPAIALSGGIVKRMALQ
1yizA           ALSKLYSQLVDRTINPTEVLVTVGAYEALYATIQGHVDEGDEVIIIEPFFDCYEPMVKAAGGIPRFIPLK
2r5cA           ALSKLYSQLVDRTINPTEVLVTVGAYEALYATIQGHVDEGDEVIIIEPFFDCYEPMVKAAGGIPRFIPLK
2gb3F           AFASYYKRRQRVDVKPENVLVTNGGSEAILFSFAVIANPGDEILVLEPFYANYNAFAKIAGVKLIPVTRR
2gb3E           AFASYYKRRQRVDVKPENVLVTNGGSEAILFSFAVIANPGDEILVLEPFYANYNAFAKIAGVKLIPVTRR
2gb3D           AFASYYKRRQRVDVKPENVLVTNGGSEAILFSFAVIANPGDEILVLEPFYANYNAFAKIAGVKLIPVTRR
2gb3C           AFASYYKRRQRVDVKPENVLVTNGGSEAILFSFAVIANPGDEILVLEPFYANYNAFAKIAGVKLIPVTRR
2gb3B           AFASYYKRRQRVDVKPENVLVTNGGSEAILFSFAVIANPGDEILVLEPFYANYNAFAKIAGVKLIPVTRR
2gb3A           AFASYYKRRQRVDVKPENVLVTNGGSEAILFSFAVIANPGDEILVLEPFYANYNAFAKIAGVKLIPVTRR
1v2eB           ALAEEFA------VEPESVVVTSGATEALYVLLQSLVGPGDEVVVLEPFFDVYDAFLAGAKARLVRLDLT
1v2eA           ALAEEFA------VEPESVVVTSGATEALYVLLQSLVGPGDEVVVLEPFFDVYDAFLAGAKARLVRLDLT
1v2dA           ALAEEFA------VEPESVVVTSGATEALYVLLQSLVGPGDEVVVLEPFFDVYDAFLAGAKARLVRLDLT
3b46B           SLIKLYSPIYNTELKAENVTVTTGANEGILSCLMGLLNAGDEVIVFEPFFDQYIPNIELCGGKVVYVPIN
3b46A           SLIKLYSPIYNTELKAENVTVTTGANEGILSCLMGLLNAGDEVIVFEPFFDQYIPNIELCGGKVVYVPIN
3dydB           EIASYYHCPEA-PLEAKDVILTSGCSQAIDLCLAVLANPGQNILVPRPGFSLYKTLAESMGIEVKLYNLL
3dydA           EIASYYHCPEA-PLEAKDVILTSGCSQAIDLCLAVLANPGQNILVPRPGFSLYKTLAESMGIEVKLYNLL
3h14A           RIARLYGEWYGVDLDPGRVVITPGSSGGFLLAFTALFDSGDRVGIGAPGYPSYRQILRALGLVPVDLPTA
1bw0B           AVATVHKEELKSTIVKDNVVLCSGGSHGILMAITAICDAGDYALVPQPGFPHYETVCKAYG---IGMHFE
1bw0A           AVATVHKEELKSTIVKDNVVLCSGGSHGILMAITAICDAGDYALVPQPGFPHYETVCKAYG---IGMHFE
1wstA           ALARWMEKRYDIPMSKVEIMTVAGSQQALDLIGRVFLNPGDPIVVEAPTYLAAIQAFKYYDPEFISIPL-
3eleC           AIAEFLNNTHGTHFNADNLYT--GAAASLSICFRALTDAYDEFITIAPYFPEYKVFVNAAGARLVEVPAT
3eleA           AIAEFLNNTHGTHFNADNLYT--GAAASLSICFRALTDAYDEFITIAPYFPEYKVFVNAAGARLVEVPAT
2zc0A           ELAAFLKKYDHLEVSPENIVITIGGTGALDLLGRVLIDPGDVVITENPSYINTLLAFEQLGAKIEGVPVD
2o1bA           AIVDFYQRQYNVTLDKEDEVCILYGTKNGLVAVPTCVNPGDYVLLPDPGYTDYLAGVLLADGKPVPLNLE
2douB           EAARWYEGRYGVGLDPRRALALIGSQEGLAHXXXXXXXXXXXXXXXXVAYPSYFGAARVASLRTFLIPLR
2douA           EAARWYEGRYGVGLDPRRALALIGSQEGLAHXXXXXXXXXXXXXXXXVAYPSYFGAARVASLRTFLIPLR
1ijiA           AVIENYAQYAGVK--PEQVLVSRGADEGIELLIRAFCEPGDAILYCPPTYGMYSVSAETIGVECRTVPTL
1geyA           AVIENYAQYAGVK--PEQVLVSRGADEGIELLIRAFCEPGDAILYCPPTYGMYSVSAETIGVECRTVPTL
1gexA           AVIENYAQYAGVK--PEQVLVSRGADEGIELLIRAFCEPGDAILYCPPTYGMYSVSAETIGVECRTVPTL
1gewA           AVIENYAQYAGVK--PEQVLVSRGADEGIELLIRAFCEPGDAILYCPPTYGMYSVSAETIGVECRTVPTL
1fg7A           AVIENYAQYAGVK--PEQVLVSRGADEGIELLIRAFCEPGKDAILYCPPTYGYSVSAETIGVECRTVPTL
3ezsB           AQRGFFKRRFKIELKENELISTLGSREVLFFVLFDYQNP--TIAYPNPFYQIYEGAAKFIKAKSL-LPLT
3ezsA           AQRGFFKRRFKIELKENELISTLGSREVLFFVLFDYQNP--TIAYPNPFYQIYEGAAKFIKAKSL-LPLT
1vp4B           QILKLLERYGITGLDEDNLIFTVGSQQALDLIGKLFLDDESYCVLDDPAYLGAINAFRQYLANFVVVPLE
1vp4A           QILKLLERYGITGLDEDNLIFTVGSQQALDLIGKLFLDDESYCVLDDPAYLGAINAFRQYLANFVVVPLE
1x0mA           TLMKWLGKRYGIS-QDNDIMITSGSQQALDLIGRVFLNPGDIVVVEAPTYLAALQAFNFYEPQYIQIPLD
3fdbA           ATAEFYADRYGYQARPEWIFPIPDVVRGLYIAIDHFTPAQSKVIVPTPAYPPFFHLLSATQREGIFIDAT
3jtxA           ACANLKRRYDGLTVADNEILPVLGSREALFSFVQTVLNPGIKIVSPNPFYQIYEGATLLGGGE-IHFANC
3f6tB           ---------------------TEGGTAAIHSLAENHLKKGDKIAINEPIFTPYLRIPELKDYELVEVDLK
3f6tA           ---------------------TEGGTAAIHSLAENHLKKGDKIAINEPIFTPYLRIPELKDYELVEVDLK
3eucB           ---------------PAGEVLLGNGSDEIISLALAAARPGAKVA-PVPGFVYASA--QFAGLEFVGVPLR
3eucA           ---------------PAGEVLLGNGSDEIISLALAAARPGAKVA-PVPGFVYASA--QFAGLEFVGVPLR
2zy5F           -------REMGADAIPSNLFAVEGGTAAMSLKLNGLLKAGDKVAIGMPVFTPYIEIPELAQYALEEVAIN
2zy5E           -------REMGADAIPSNLFAVEGGTAAMSLKLNGLLKAGDKVAIGMPVFTPYIEIPELAQYALEEVAIN
2zy5D           -------REMGADAIPSNLFAVEGGTAAMSLKLNGLLKAGDKVAIGMPVFTPYIEIPELAQYALEEVAIN
2zy5B           -------REMGADAIPSNLFAVEGGTAAMSLKLNGLLKAGDKVAIGMPVFTPYIEIPELAQYALEEVAIN
2zy5A           -------REMGADAIPSNLFAVEGGTAAMSLKLNGLLKAGDKVAIGMPVFTPYIEIPELAQYALEEVAIN
2zy4F           -------REMGADAIPSNLFAVEGGTAAMSLKLNGLLKAGDKVAIGMPVFTPYIEIPELAQYALEEVAIN
2zy4E           -------REMGADAIPSNLFAVEGGTAAMSLKLNGLLKAGDKVAIGMPVFTPYIEIPELAQYALEEVAIN
2zy4D           -------REMGADAIPSNLFAVEGGTAAMSLKLNGLLKAGDKVAIGMPVFTPYIEIPELAQYALEEVAIN
2zy4C           -------REMGADAIPSNLFAVEGGTAAMSLKLNGLLKAGDKVAIGMPVFTPYIEIPELAQYALEEVAIN
2zy4B           -------REMGADAIPSNLFAVEGGTAAMSLKLNGLLKAGDKVAIGMPVFTPYIEIPELAQYALEEVAIN
2zy4A           -------REMGADAIPSNLFAVEGGTAAMSLKLNGLLKAGDKVAIGMPVFTPYIEIPELAQYALEEVAIN
2zy3F           -------REMGADAIPSNLFAVEGGTAAMSLKLNGLLKAGDKVAIGMPVFTPYIEIPELAQYALEEVAIN
2zy3E           -------REMGADAIPSNLFAVEGGTAAMSLKLNGLLKAGDKVAIGMPVFTPYIEIPELAQYALEEVAIN
2zy3D           -------REMGADAIPSNLFAVEGGTAAMSLKLNGLLKAGDKVAIGMPVFTPYIEIPELAQYALEEVAIN
2zy3C           -------REMGADAIPSNLFAVEGGTAAMSLKLNGLLKAGDKVAIGMPVFTPYIEIPELAQYALEEVAIN
2zy3B           -------REMGADAIPSNLFAVEGGTAAMSLKLNGLLKAGDKVAIGMPVFTPYIEIPELAQYALEEVAIN
2zy3A           -------REMGADAIPSNLFAVEGGTAAMSLKLNGLLKAGDKVAIGMPVFTPYIEIPELAQYALEEVAIN
1uu2A           ELIEKILSYLDTDFLSKNNVSVGNGADEIIYVMMLMFDRS--VFFP-PTYSCYRIFAKAVGAKFLEVPLT
1uu1C           ELIEKILSYLDTDFLSKNNVSVGNGADEIIYVMMLMFDRS--VFFP-PTYSCYRIFAKAVGAKFLEVPLT
1uu1B           ELIEKILSYLDTDFLSKNNVSVGNGADEIIYVMMLMFDRS--VFFP-PTYSCYRIFAKAVGAKFLEVPLT
1uu1A           ELIEKILSYLDTDFLSKNNVSVGNGADEIIYVMMLMFDRS--VFFP-PTYSCYRIFAKAVGAKFLEVPLT
1uu0D           ELIEKILSYLDTDFLSKNNVSVGNGADEIIYVMMLMFDRS--VFFP-PTYSCYRIFAKAVGAKFLEVPLT
1uu0A           ELIEKILSYLDTDFLSKNNVSVGNGADEIIYVMMLMFDRS--VFFP-PTYSCYRIFAKAVGAKFLEVPLT
2f8jB           ELIEKILSYLDTDFLSKNNVSVGNGADEIIYVMMLMFDRS--VFFP-PTYSCYRIFAKAVGAKFLEVPLT
2f8jA           ELIEKILSYLDTDFLSKNNVSVGNGADEIIYVMMLMFDRS--VFFP-PTYSCYRIFAKAVGAKFLEVPLT
3jtxB           ACANLKRRYDGLTVADNEILPVLGSREALFSFVQTVLNPKPAIVSPNPFYQIYEGATLLGGGE-IHFANC
1uu2B           ELIEKILSYLDTDFLSKNNVSVGNGADEIIYVMMLMFDRS--VFFP-PTYSCYRIFAKAVGAKFLEVPLT
1uu0C           ELIEKILSYLDTDFLSKNNVSVGNGADEIIYVMMLMFDRS--VFFP-PTYSCYRIFAKAVGAKFLEVPLT
1uu0B           ELIEKILSYLDTDFLSKNNVSVGNGADEIIYVMMLMFDRS--VFFP-PTYSCYRIFAKAVGAKFLEVPLT
1h1cD           ELIEKILSYLDTDFLSKNNVSVGNGADEIIYVLF------DRSVFFPPTYSCYRIFAKAVGAKFLEVPLT
1h1cA           ELIEKILSYLDTDFLSKNNVSVGNGADEIIYVLF------DRSVFFPPTYSCYRIFAKAVGAKFLEVPLT
2zyjA           ---------EWIGVRPEEVLITTGSQQALDLVGKVFLDEGSPVLLEAPSYMGAIQAFRLQGPRFLTVPAG
2z1yB           ---------EWIGVRPEEVLITTGSQQALDLVGKVFLDEGSPVLLEAPSYMGAIQAFRLQGPRFLTVPAG
2z1yA           ---------EWIGVRPEEVLITTGSQQALDLVGKVFLDEGSPVLLEAPSYMGAIQAFRLQGPRFLTVPAG
2ogeB           -------------------VGVNSGMDALQLALRGGIGPGDEVIVPSHTYIASWLAVSATGATPVPVPHE
2ogeA           -------------------VGVNSGMDALQLALRGGIGPGDEVIVPSHTYIASWLAVSATGATPVPVPHE
2ogaC           -------------------VGVNSGMDALQLALRGGIGPGDEVIVPSHTYIASWLAVSATGATPVPVPHE
2ogaB           -------------------VGVNSGMDALQLALRGGIGPGDEVIVPSHTYIASWLAVSATGATPVPVPHE
2ogaA           -------------------VGVNSGMDALQLALRGGIGPGDEVIVPSHTYIASWLAVSATGATPVPVPHE
1mdzA           -------------------VAVSSATAGMHIALMAGIGEGDEVITPSMTWVSTLNMIVLLGANPVMVDVR
1mdxA           -------------------VAVSSATAGMHIALMAGIGEGDEVITPSMTWVSTLNMIVLLGANPVMVDVR
1iayA           ---------------PERVVMAGGATGANETIIFCLADPGDAFLVPSPYYPAFNRDLRWRTGVPIHCESS
1iaxA           ---------------PERVVMAGGATGANETIIFCLADPGDAFLVPSPYYPAFNRDLRWRTGVPIHCESS
3fddA           -------REMGADAIPSNLFAVEGGTAAMAYIFESMLKAGDKVAIGMPVFTPYIEIPELAQYALEEVAIN
2egyD           ---------EWIGVRPEEVLITTGSQQALDLVGKVFLDEGSPVLLEAPSYMGAIQAFRLQGPRFLTVPAG
2egyC           ---------EWIGVRPEEVLITTGSQQALDLVGKVFLDEGSPVLLEAPSYMGAIQAFRLQGPRFLTVPAG
2egyB           ---------EWIGVRPEEVLITTGSQQALDLVGKVFLDEGSPVLLEAPSYMGAIQAFRLQGPRFLTVPAG
3cbfA           ---------EWIGVRPEEVLITTGSQQALDLVGKVFLDEGSPVLLEAPSYMGAIQAFRLQGPRFLTVPAG
1ynuA           FMAE--IRGNKVTFDPNHLVLTAGATSANETFIFCLADPGEAVLIPTPYYPGFDRDLKWRTGVPIHCTSS
1m7yA           FMAE--IRGNKVTFDPNHLVLTAGATSANETFIFCLADPGEAVLIPTPYYPGFDRDLKWRTGVPIHCTSS
1m4nA           FMAE--IRGNKVTFDPNHLVLTAGATSANETFIFCLADPGEAVLIPTPYYPGFDRDLKWRTGVPIHCTSS
3ihjA           -------RDGGVPADPDNIYLTTGASDGISTILKILVSGGGKVMIPIPQYPLYSAVISELDAIQVNYYLD
1b8gB           FMAE--IRGNKVTFDPNHLVLTAGATSANETFIFCLADPGEAVLIPTPYYPGFDRDLKWRTGVPIHCTSS
1b8gA           FMAE--IRGNKVTFDPNHLVLTAGATSANETFIFCLADPGEAVLIPTPYYPGFDRDLKWRTGVPIHCTSS
1h1cC           ELIEKILSYLDTDFLSKNNVSVGNGADEIIYVLF------DRSVFFPPTYSCYRIFAKAVGAKFLEVPLT
1h1cB           ELIEKILSYLDTDFLSKNNVSVGNGADEIIYVLF------DRSVFFPPTYSCYRIFAKAVGAKFLEVPLT
3cq4A           ELAAYITKQTGVAVTRDNLWAANGSNEILQQLLQAFGGPGRTALGFQPSYSMHPILAKGTHTEFIGADFR
2zg5A           ---------EWIGVRPEEVLITTGSQQALDLVGKVFLDEGSPVLLEAPSYMGAIQAFRLQGPRFLTVPAG
3cq5B           ELAAYITKQTGVAVTRDNLWAANGSNEILQQLLQAFGGPGRTALGFQPSYSMHPILAKGTHTEFIGADFR
3cq5A           ELAAYITKQTGVAVTRDNLWAANGSNEILQQLLQAFGGPGRTALGFQPSYSMHPILAKGTHTEFIGADFR
1c7nA           KTVKKWMKDRHQDIQTDWIINTAGVVPAVFNAVREFTKPGDGVIIITPVYYPFFMAIKNQERKIIECELL
2zy2A           ------------------LFAVEGGTAAMSLRISGLLKAGDKVAIGMPVFTPYIEIPELAQYDLKEVPIH
2vgzA           ---------------------TSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINV-AS
2qlrA           ---------------------TSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINV-AS
3dc1D           ---------------------TSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINV-AS
3dc1B           ---------------------TSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINV-AS
3dc1A           ---------------------TSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINV-AS
3frkB           -------------------IGCGNGLDALHLILKGYIGFGDEVIVPSNTFIATALAVSYTGAKPIFVPDI
3frkA           -------------------IGCGNGLDALHLILKGYIGFGDEVIVPSNTFIATALAVSYTGAKPIFVPDI
2r2nA           ---------------------TSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINV-AS
3cq4B           ELAAYITKQTGVAVTRDNLWAANGSNEILQQLLQAFGGPGRTALGFQPSYSMHPILAKGTHTEFIGADFR
1mdoA           ----------GNQYAVAVSSATAG-----HIALALGIGEGDEVITPSTWVSTLNIV--LLGANPV-VDVD
3cq6A           ELAAYITKQTGVAVTRDNLWAANGSNEILQQLLQAFGGPGRTALGFQPSYSMHPILAKGTHTEFIGADFR
3ffhB           ------------------LIFTAGVDELIELLTRVLLDXXXXXXXXXX-FVQYRQNALIEGAEVREIPLL
3ffhA           ------------------LIFTAGVDELIELLTRVLLDXXXXXXXXXX-FVQYRQNALIEGAEVREIPLL
3dzzB           -------------------------------AVRQFTSPGDQILVQEPVYNFYSVIERVISSDLIYENSK
3dzzA           -------------------------------AVRQFTSPGDQILVQEPVYNFYSVIERVISSDLIYENSK
1lkcA           ---------------PASWILAGNGETESIFTVASGLKPR-RAMIVTPGFAEYGRALAQSGCEIRRWSLR
1lc8A           ---------------PASWILAGNGETESIFTVASGLKPR-RAMIVTPGFAEYGRALAQSGCEIRRWSLR
1lc7A           ---------------PASWILAGNGETESIFTVASGLKPR-RAMIVTPGFAEYGRALAQSGCEIRRWSLR
1lc5A           ---------------PASWILAGNGETESIFTVASGLKPR-RAMIVTPGFAEYGRALAQSGCEIRRWSLR
3hdoB           ---------------PSWIIAN-GSDEVLNNLIRAFAAEGEEIGYVHPSYSYYGTLAEVQGARVRTFGLT
3hdoA           ---------------PSWIIAN-GSDEVLNNLIRAFAAEGEEIGYVHPSYSYYGTLAEVQGARVRTFGLT
3ei9B           ----------------------------------------------------------------------
3ei9A           ----------------------------------------------------------------------
3ei8A           ----------------------------------------------------------------------
2z1zA           ----------------------------------------------------------------------
3eiaB           ----------------------------------------------------------------------
3eiaA           ----------------------------------------------------------------------
3ei7B           ----------------------------------------------------------------------
3ei7A           ----------------------------------------------------------------------
3ei6B           ----------------------------------------------------------------------
3ei6A           ----------------------------------------------------------------------
2z20B           ----------------------------------------------------------------------
2z20A           ----------------------------------------------------------------------
3dr7B           -------------------IACNNGTTALHLALVAMIGPGDEVIVPSLTYIASANSVTYCGATPV-LVDN
3dr4D           -------------------IACNNGTTALHLALVAMIGPGDEVIVPSLTYIASANSVTYCGATPV-LVDN
3dr4C           -------------------IACNNGTTALHLALVAMIGPGDEVIVPSLTYIASANSVTYCGATPV-LVDN
3dr4B           -------------------IACNNGTTALHLALVAMIGPGDEVIVPSLTYIASANSVTYCGATPV-LVDN
3dr4A           -------------------IACNNGTTALHLALVAMIGPGDEVIVPSLTYIASANSVTYCGATPV-LVDN
3bn1D           -------------------IACNNGTTALHLALVAMIGPGDEVIVPSLTYIASANSVTYCGATPV-LVDN
3bn1C           -------------------IACNNGTTALHLALVAMIGPGDEVIVPSLTYIASANSVTYCGATPV-LVDN
3bn1A           -------------------IACNNGTTALHLALVAMIGPGDEVIVPSLTYIASANSVTYCGATPV-LVDN
1d2fB           ----------------------------------------------------------------------
1d2fA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           DDLTLAPETVEDHITDDTAAFVVNSPANPTGAVQSPADMRAFARIADEHDVLCISDEVYEHIVFEGEHRS
1gd9A           DEFRLNVDELKKYVTDKTRALIINSPCNPTGAVLTKKDLEEIADFVVEHDLIVISDEVYEHFIYDDARHY
1djuA           DEFRLNVDELKKYVTDKTRALIINSPCNPTGAVLTKKDLEEIADFVVEHDLIVISDEVYEHFIYDDARHY
1djuB           DEFRLNVDELKKYVTDKTRALIINSPCNPTGAVLTKKDLEEIADFVVEHDLIVISDEVYEHFIYDDARHY
1j32A           TQFKVSPEQIRQAITPKTKLLVFNTPSNPTGMVYTPDEVRAIAQVAVEAGLWVLSDEIYEKILYDDAQHL
1b5pA           EGFVPDPERVRRAITPRTKALVVNSPNNPTGAVYPKEVLEALARLAVEHDFYLVSDEIYEHLLYEGEHFS
1gc3A           EGFVPDPERVRRAITPRTKALVVNSPNNPTGAVYPKEVLEALARLAVEHDFYLVSDEIYEHLLYEGEHFS
1b5oA           EGFVPDPERVRRAITPRTKALVVNSPNNPTGAVYPKEVLEALARLAVEHDFYLVSDEIYEHLLYEGEHFS
5bj4A           EGFVPDPERVRRAITPRTKALVVNSPNNPTGAVYPKEVLEALARLAVEHDFYLVSDEIYEHLLYEGEHFS
1bkgA           EGFVPDPERVRRAITPRTKALVVNSPNNPTGAVYPKEVLEALARLAVEHDFYLVSDEIYEHLLYEGEHFS
5bj3A           EGFVPDPERVRRAITPRTKALVVNSPNNPTGAVYPKEVLEALARLAVEHDFYLVSDEIYEHLLYEGEHFS
1bjwA           EGFVPDPERVRRAITPRTKALVVNSPNNPTGAVYPKEVLEALARLAVEHDFYLVSDEIYEHLLYEGEHFS
1xi9C           EEEDWQPXXXXXXXXXXXXAIAVINPNNPTGALYDKKTLEEILNIAGEYEIPVISDEIYDLMTYEGEHIS
1xi9B           EEEDWQPXXXXXXXXXXXXAIAVINPNNPTGALYDKKTLEEILNIAGEYEIPVISDEIYDLMTYEGEHIS
1xi9A           EEEDWQPXXXXXXXXXXXXAIAVINPNNPTGALYDKKTLEEILNIAGEYEIPVISDEIYDLMTYEGEHIS
1o4sB           KNFQPSLEEVEGLLVGKTKAVLINSPNNPTGVVYRREFLEGLVRLAKKRNFYIISDEVYDSLVYTDEFTS
1o4sA           KNFQPSLEEVEGLLVGKTKAVLINSPNNPTGVVYRREFLEGLVRLAKKRNFYIISDEVYDSLVYTDEFTS
2z61A           -DFTV--ESLEEALSDKTKAIIINSPSNPLGEVID----REIYEFAYENIPYIISDEIYNGLVYEGKCYS
3e2yA           SDWTFDPRELESKFSSKTKAIILNTPHNPLGKVYTRQELQVIADLCVKHDTLCISDEVYEWLVYTGHTHV
1w7nA           SNWQLDPMELAGKFTSRTKALVLNTPNNPLGKVFSREELELVASLCQQHDVVCITDEVYQWMVYDGQHIS
1w7lA           SNWQLDPMELAGKFTSRTKALVLNTPNNPLGKVFSREELELVASLCQQHDVVCITDEVYQWMVYDGQHIS
1yiyA           PNKTGGTISSADWVLDNTKMIIINTPHNPLGKVMDRAELEVVANLCKKWNVLCVSDEVYEHMVFEPEHIR
2r5cB           PNKTGGTISSADWVLDNTKMIIINTPHNPLGKVMDRAELEVVANLCKKWNVLCVSDEVYEHMVFEPEHIR
3e2fA           SDWTFDPRELESKFSSKTKAIILNTPHNPLGKVYTRQELQVIADLCVKHDTLCISDEVYEWLVYTGHHVK
3fvsA           SNWQLDPMELAGKFTSRTKALVLNTPNNPLGKVFSREELELVASLCQQHDVVCITDEVYQWMVYDGQHIS
2o0rB           PDFALDADALRRAVTPRTRALIINSPHNPTGAVLSXXXXXXXXXXXXXXXXXXXTDEVYEHLVFDHARHL
2o0rA           PDFALDADALRRAVTPRTRALIINSPHNPTGAVLSXXXXXXXXXXXXXXXXXXXTDEVYEHLVFDHARHL
1u08B           PPFRVDWQEFAALLSERTRLVILNTPHNPSATVWQQADFAALWQAIAGHEIFVISDEVYEHINFSQQHAS
1u08A           PPFRVDWQEFAALLSERTRLVILNTPHNPSATVWQQADFAALWQAIAGHEIFVISDEVYEHINFSQQHAS
1yizA           PNKTGGTISSADWVLDNTKMIIINTPHNPLGKVMDRAELEVVANLCKKWNVLCVSDEVYEHMVFEPEHIR
2r5cA           PNKTGGTISSADWVLDNTKMIIINTPHNPLGKVMDRAELEVVANLCKKWNVLCVSDEVYEHMVFEPEHIR
2gb3F           EEGFAIPQNLESFINERTKGIVLSNPCNPTGVVYG-KDERYLVEIAERHGLFLIVDEVYSEIVFRGEFAS
2gb3E           EEGFAIPQNLESFINERTKGIVLSNPCNPTGVVYG-KDERYLVEIAERHGLFLIVDEVYSEIVFRGEFAS
2gb3D           EEGFAIPQNLESFINERTKGIVLSNPCNPTGVVYG-KDERYLVEIAERHGLFLIVDEVYSEIVFRGEFAS
2gb3C           EEGFAIPQNLESFINERTKGIVLSNPCNPTGVVYG-KDERYLVEIAERHGLFLIVDEVYSEIVFRGEFAS
2gb3B           EEGFAIPQNLESFINERTKGIVLSNPCNPTGVVYG-KDERYLVEIAERHGLFLIVDEVYSEIVFRGEFAS
2gb3A           EEGFAIPQNLESFINERTKGIVLSNPCNPTGVVYG-KDERYLVEIAERHGLFLIVDEVYSEIVFRGEFAS
1v2eB           EGFRLDLSALEKALTPRTRALLLNTPMNPTGLVFGXXXXXXXXXXXXXHDLFLISDEVYDELYYGERPRR
1v2eA           EGFRLDLSALEKALTPRTRALLLNTPMNPTGLVFGXXXXXXXXXXXXXHDLFLISDEVYDELYYGERPRR
1v2dA           EGFRLDLSALEKALTPRTRALLLNTPMNPTGLVFGXXXXXXXXXXXXXHDLFLISDEVYDELYYGERPRR
3b46B           EEWTIDFEQFEKAITSKTKAVIINTPHNPIGKVFTREELTTLGNICVKHNVVIISDEVYEHLYFDSFTRI
3b46A           EEWTIDFEQFEKAITSKTKAVIINTPHNPIGKVFTREELTTLGNICVKHNVVIISDEVYEHLYFDSFTRI
3dydB           PEKSIDLKQLEYLIDEKTACLIVNNPSNPCGSVFSKRHLQKILAVAARQCVPILADEIYGDMVFSDCKYE
3dydA           PEKSIDLKQLEYLIDEKTACLIVNNPSNPCGSVFSKRHLQKILAVAARQCVPILADEIYGDMVFSDCKYE
3h14A           PENRLQPVPADFAGLD--LAGLVASPANPTGTLDHXXXXXXXXXXXXXXSF--ISDEIYHGIEYEAKAVT
1bw0B           NDWEADLDEIRRLKDDKTKLLIVTNPSNPCGSNFSRKHVEDIVRLAEELRLPLFSDEIYAGMVFKGKNAT
1bw0A           NDWEADLDEIRRLKDDKTKLLIVTNPSNPCGSNFSRKHVEDIVRLAEELRLPLFSDEIYAGMVFKGKNAT
1wstA           DDKGMRVDXXXXXXXXXRKVYTVSTFQNPAGVTMSVDRRKKLLELANEYDFLIVEDGPYSELRYSGEPTP
3eleC           EHFQIDFDALEERINAHTRGVIINSPNNPSGTVYSEETIXXXXXXXXXRPIFIIADEPYREIVYDG-IKV
3eleA           EHFQIDFDALEERINAHTRGVIINSPNNPSGTVYSEETIXXXXXXXXXRPIFIIADEPYREIVYDG-IKV
2zc0A           NDGMRVDXXXXXXXXXXAKGYTIPTGQNPMGVTMSMERRKALLEIASKYDLLIIEDTAYNFMRYEGGDIV
2o1bA           PPHYLPDSKVDSQIIDKTKLIYLTYPNNPTGSTATKEVFDEAIAKFKGTDTKIVHDFAYGAFGFDAKNPS
2douB           EDGLADLKAVPEGVWREAKVLLLNYPNNPTGAVADWGYFEEALGLARKHGLWLIHDNPYVDQVYEGEAPS
2douA           EDGLADLKAVPEGVWREAKVLLLNYPNNPTGAVADWGYFEEALGLARKHGLWLIHDNPYVDQVYEGEAPS
1ijiA           DNWQLDLQGISDKL-DGVKVVYVCSPNNPTGQLINPQDFRTLLELT-RGKAIVVADEAY--IEFCPQASL
1geyA           DNWQLDLQGISDKL-DGVKVVYVCSPNNPTGQLINPQDFRTLLELT-RGKAIVVADEAY--IEFCPQASL
1gexA           DNWQLDLQGISDKL-DGVKVVYVCSPNNPTGQLINPQDFRTLLELT-RGKAIVVADEAY--IEFCPQASL
1gewA           DNWQLDLQGISDKL-DGVKVVYVCSPNNPTGQLINPQDFRTLLELT-RGKAIVVADEAY--IEFCPQASL
1fg7A           DNWQLDLQGISDKL-DGVKVVYVCSPNNPTGQLINPQDFRTLLELT-RGKAIVVADEAY--IEFCPQASL
3ezsB           KENDFTPSLNEKEL-QEVDLVILNSPNNPTGRTLSLEELISWVKLALKHDFILINDECYSEIY---ENTP
3ezsA           KENDFTPSLNEKEL-QEVDLVILNSPNNPTGRTLSLEELISWVKLALKHDFILINDECYSEIY---ENTP
1vp4B           DDRKLSEFDKNGKIKQVKFIYVVSNFHNPAGVTTSLEKRKALVEIAEKYDLFIVEDDPYGALRYEGETVD
1vp4A           DDRKLSEFDKNGKIKQVKFIYVVSNFHNPAGVTTSLEKRKALVEIAEKYDLFIVEDDPYGALRYEGETVD
1x0mA           DEXXXXXXXXXXXXXXXXXVYTVPTFQNPAGVTMNEDRRKYLLELASEYDFIVVEDDPYGELRYSGNPEK
3fdbA           GGINL--HDVEKGFQAGARSILLCNPYNPLG-VFAPEWLNELCDLAHRYDARVLVDEIHAPLVFDGQHTV
3jtxA           PAPSFNPDSISEEVWKRTKLVFVCSPNNPSGSVLDLDGWKEVFDLQDKYGFIIASDECYSEIYFDGNKQA
3f6tB           NDWEIEPNEIEKLKDPSIKALIVVNPTNPTSKEFDTNALNAIKQAVEKNPKLIISDEVYGAFV-------
3f6tA           NDWEIEPNEIEKLKDPSIKALIVVNPTNPTSKEFDTNALNAIKQAVEKNPKLIISDEVYGAFV-------
3eucB           ADFTLGALAAAEH---QPAIVYLAYPNNPTGNLFDAAD-EAIVRAAQGSRSLVVVDEAYQPFAQESWSR-
3eucA           ADFTLGALAAAEH---QPAIVYLAYPNNPTGNLFDAAD-EAIVRAAQGSRSLVVVDEAYQPFAQESWSR-
2zy5F           ADPSLNPDSELDKLKDPAIKFCVN-PSNPPSVKMDQRSLERVRNIVAEHDLMILTDDVYG--TFADDFQS
2zy5E           ADPSLNPDSELDKLKDPAIKFCVN-PSNPPSVKMDQRSLERVRNIVAEHDLMILTDDVYG--TFADDFQS
2zy5D           ADPSLNPDSELDKLKDPAIKFCVN-PSNPPSVKMDQRSLERVRNIVAEHDLMILTDDVYG--TFADDFQS
2zy5B           ADPSLNPDSELDKLKDPAIKFCVN-PSNPPSVKMDQRSLERVRNIVAEHDLMILTDDVYG--TFADDFQS
2zy5A           ADPSLNPDSELDKLKDPAIKFCVN-PSNPPSVKMDQRSLERVRNIVAEHDLMILTDDVYG--TFADDFQS
2zy4F           ADPSLNPDSELDKLKDPAIKFCVN-PSNPPSVKMDQRSLERVRNIVAEHDLMILTDDVYG--TFADDFQS
2zy4E           ADPSLNPDSELDKLKDPAIKFCVN-PSNPPSVKMDQRSLERVRNIVAEHDLMILTDDVYG--TFADDFQS
2zy4D           ADPSLNPDSELDKLKDPAIKFCVN-PSNPPSVKMDQRSLERVRNIVAEHDLMILTDDVYG--TFADDFQS
2zy4C           ADPSLNPDSELDKLKDPAIKFCVN-PSNPPSVKMDQRSLERVRNIVAEHDLMILTDDVYG--TFADDFQS
2zy4B           ADPSLNPDSELDKLKDPAIKFCVN-PSNPPSVKMDQRSLERVRNIVAEHDLMILTDDVYG--TFADDFQS
2zy4A           ADPSLNPDSELDKLKDPAIKFCVN-PSNPPSVKMDQRSLERVRNIVAEHDLMILTDDVYG--TFADDFQS
2zy3F           ADPSLNPDSELDKLKDPAIKFCVN-PSNPPSVKMDQRSLERVRNIVAEHDLMILTDDVYG--TFADDFQS
2zy3E           ADPSLNPDSELDKLKDPAIKFCVN-PSNPPSVKMDQRSLERVRNIVAEHDLMILTDDVYG--TFADDFQS
2zy3D           ADPSLNPDSELDKLKDPAIKFCVN-PSNPPSVKMDQRSLERVRNIVAEHDLMILTDDVYG--TFADDFQS
2zy3C           ADPSLNPDSELDKLKDPAIKFCVN-PSNPPSVKMDQRSLERVRNIVAEHDLMILTDDVYG--TFADDFQS
2zy3B           ADPSLNPDSELDKLKDPAIKFCVN-PSNPPSVKMDQRSLERVRNIVAEHDLMILTDDVYG--TFADDFQS
2zy3A           ADPSLNPDSELDKLKDPAIKFCVN-PSNPPSVKMDQRSLERVRNIVAEHDLMILTDDVYG--TFADDFQS
1uu2A           KDLRIP----EVNVGEGDVVFIPN-PNNPTGHVFEREEIE---RILKTGAFVALDEAYYE---FHGE--S
1uu1C           KDLRIP----EVNVGEGDVVFIPN-PNNPTGHVFEREEIE---RILKTGAFVALDEAYYE---FHGE--S
1uu1B           KDLRIP----EVNVGEGDVVFIPN-PNNPTGHVFEREEIE---RILKTGAFVALDEAYYE---FHGE--S
1uu1A           KDLRIP----EVNVGEGDVVFIPN-PNNPTGHVFEREEIE---RILKTGAFVALDEAYYE---FHGE--S
1uu0D           KDLRIP----EVNVGEGDVVFIPN-PNNPTGHVFEREEIE---RILKTGAFVALDEAYYE---FHGE--S
1uu0A           KDLRIP----EVNVGEGDVVFIPN-PNNPTGHVFEREEIE---RILKTGAFVALDEAYYE---FHGE--S
2f8jB           KDLRIP----EVNVGEGDVVFIPN-PNNPTGHVFEREEIE---RILKTGAFVALDEAYYE---FHGE--S
2f8jA           KDLRIP----EVNVGEGDVVFIPN-PNNPTGHVFEREEIE---RILKTGAFVALDEAYYE---FHGE--S
3jtxB           PAPSFNPDSISEEVWKRTKLVFVCSPNNPSGSVLDLDGWKEVFDLQDKYGFIIASDECYSEIYFDGNKQA
1uu2B           KDLRIP----EVNVGEGDVVFIPN-PNNPTGHVFEREEIE---RILKTGAFVALDEAYYE---FHGE--S
1uu0C           KDLRIP----EVNVGEGDVVFIPN-PNNPTGHVFEREEIE---RILKTGAFVALDEAYYE---FHGE--S
1uu0B           KDLRIP----EVNVGEGDVVFIPN-PNNPTGHVFEREEIE---RILKTGAFVALDEAYYE---FHGE--S
1h1cD           KDLRIP----EVNVGEGDVVFIPN-PNNPTGHVFEREEIE---RILKTGAFVALDEAYYE---FHGE--S
1h1cA           KDLRIP----EVNVGEGDVVFIPN-PNNPTGHVFEREEIE---RILKTGAFVALDEAYYE---FHGE--S
2zyjA           EE---GPDALEEVLKRERPRFLYLIPSNPTGGLTPLPARKRLLQMVMERGLVVVEDDAYRELYF-GEARL
2z1yB           EE---GPDALEEVLKRERPRFLYLIPSNPTGGLTPLPARKRLLQMVMERGLVVVEDDAYRELYF-GEARL
2z1yA           EE---GPDALEEVLKRERPRFLYLIPSNPTGGLTPLPARKRLLQMVMERGLVVVEDDAYRELYF-GEARL
2ogeB           DHPTLDPLLVEKAITPRTRALL------PVHLYGHPADMDALRELADRHGLHIVED--------------
2ogeA           DHPTLDPLLVEKAITPRTRALL------PVHLYGHPADMDALRELADRHGLHIVED--------------
2ogaC           DHPTLDPLLVEKAITPRTRALL------PVHLYGHPADMDALRELADRHGLHIVED--------------
2ogaB           DHPTLDPLLVEKAITPRTRALL------PVHLYGHPADMDALRELADRHGLHIVED--------------
2ogaA           DHPTLDPLLVEKAITPRTRALL------PVHLYGHPADMDALRELADRHGLHIVED--------------
1mdzA           DTLMVTPEHIEAAITPQTKAII---PVHYAGA---PADLDAIYALGERYGIPVIEDAAH-----------
1mdxA           DTLMVTPEHIEAAITPQTKAII---PVHYAGA---PADLDAIYALGERYGIPVIEDAAH-----------
1iayA           NNFKITSKAVKEAYENKVKGLILTNPSNPLGTTLDKDTLKSVLSFTNQHNIHLVCDEIYAATVFDTPQEQ
1iaxA           NNFKITSKAVKEAYENKVKGLILTNPSNPLGTTLDKDTLKSVLSFTNQHNIHLVCDEIYAATVFDTPQEQ
3fddA           ADPALNPDSELDKLKDPAIKFCVN-PSNPPSVKMDERSLERVRKIVAEHDLMILTDDVYG--TFADGFQS
2egyD           EE---GPDALEEVLKRERPRFLYLIPSNPTGGLTPLPARKRLLQMVMERGLVVVEDDAYRELYF-GEARL
2egyC           EE---GPDALEEVLKRERPRFLYLIPSNPTGGLTPLPARKRLLQMVMERGLVVVEDDAYRELYF-GEARL
2egyB           EE---GPDALEEVLKRERPRFLYLIPSNPTGGLTPLPARKRLLQMVMERGLVVVEDDAYRELYF-GEARL
3cbfA           EE---GPDALEEVLKRERPRFLYLIPSNPTGGLTPLPARKRLLQMVMERGLVVVEDDAYRELYF-GEARL
1ynuA           NGFQITETALEEAYQERVKGVLVTNPSNPLGTTMTRNELYLLLSFVEDKGIHLISDEIYSGTAFSSSFIS
1m7yA           NGFQITETALEEAYQERVKGVLVTNPSNPLGTTMTRNELYLLLSFVEDKGIHLISDEIYSGTAFSSSFIS
1m4nA           NGFQITETALEEAYQERVKGVLVTNPSNPLGTTMTRNELYLLLSFVEDKGIHLISDEIYSGTAFSSSFIS
3ihjA           EELRRAVQEAKDHC--DPKVLCIINPGNPTGQVQSRKCIEDVIHFAWEEKLFLLADEVYQDNVYSPDCR-
1b8gB           NGFQITETALEEAYQERVKGVLVTNPSNPLGTTMTRNELYLLLSFVEDKGIHLISDEIYSGTAFSSSFIS
1b8gA           NGFQITETALEEAYQERVKGVLVTNPSNPLGTTMTRNELYLLLSFVEDKGIHLISDEIYSGTAFSSSFIS
1h1cC           KDLRIP----EVNVGEGDVVFIPN-PNNPTGHVFEREEIE---RILKTGAFVALDEAYYE---FHGE--S
1h1cB           KDLRIP----EVNVGEGDVVFIPN-PNNPTGHVFEREEIE---RILKTGAFVALDEAYYE---FHGE--S
3cq4A           IDMDVALEEIRAKQPD---IVFVTTPNNPTGDVTSLDDVERIINVAPG---IVIVDEAYAEFSPSPSATT
2zg5A           EE---GPDALEEVLKRERPRFLYLIPSNPTGGLTPLPARKRLLQMVMERGLVVVEDDAYRELYF-GEARL
3cq5B           IDMDVALEEIRAKQPD---IVFVTTPNNPTGDVTSLDDVERIINVAPG---IVIVDEAYAEFSPSPSATT
3cq5A           IDMDVALEEIRAKQPD---IVFVTTPNNPTGDVTSLDDVERIINVAPG---IVIVDEAYAEFSPSPSATT
1c7nA           EKYTIDFQKLEKLSKDNNKALLFCSPHNPVGRVWKKDELQKIKDIVLKSDLMLWSDEIHFDLIMPGYEHT
2zy2A           ADPDNGWQYSDDKLKDDVKIFFCVNPSNPPSVKMDQRSLRVRAIVAEQRDLLILTDDVYG--TFADEFQS
2vgzA           DESGIVPDSLRDILSKNTPKFLYTVPNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQF-NKFRV
2qlrA           DESGIVPDSLRDILSKNTPKFLYTVPNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQF-NKFRV
3dc1D           DESGIVPDSLRDILSKNTPKFLYTVPNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQF-NKFRV
3dc1B           DESGIVPDSLRDILSKNTPKFLYTVPNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQF-NKFRV
3dc1A           DESGIVPDSLRDILSKNTPKFLYTVPNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQF-NKFRV
3frkB           RTYNIDPSLIESAITEKTKAIIA------VHLYGQPADMDEIKRIAKKYNLKLIEDAAQAH---------
3frkA           RTYNIDPSLIESAITEKTKAIIA------VHLYGQPADMDEIKRIAKKYNLKLIEDAAQAH---------
2r2nA           DESGIVPDSLRDILSKNTPKFLYTVPNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNKFRVP
3cq4B           IDMDVALEEIRAKQPD---IVFVTTPNNPTGDVTSLDDVERIINVAPG---IVIVDEAYAEFSPSPSATT
1mdoA           RDTLVTPEHIEAAITPQTKAII---PVHYAGA---PADLDAIYALGERYGIPVIEDAAH-----------
3cq6A           IDMDVALEEIRAKQPD---IVFVTTPNNPTGDVTSLDDVERIINVAPG---IVIVDEAYAEFSPSPSATT
3ffhB           QDGEHDLEGL-NAIDEKTTIVWICNPNNPTGNYIELADIQAFLRVPS--DVLVVLDEAYIEYVTPQPEKH
3ffhA           QDGEHDLEGL-NAIDEKTTIVWICNPNNPTGNYIELADIQAFLRVPS--DVLVVLDEAYIEYVTPQPEKH
3dzzB           YSVNWAD--LEEKLATPSVRVFCN-PHNPIGYAWSEEEVKRIAELCAKHQVLLISDEIHGDLVLTDEDIT
3dzzA           YSVNWAD--LEEKLATPSVRVFCN-PHNPIGYAWSEEEVKRIAELCAKHQVLLISDEIHGDLVLTDEDIT
1lkcA           EDGWQLTDAILEALTPDLDCLFLCTPNNPTGLLPERPLLQAIADRCKSLNINLILDEAFIDFIPHETGFI
1lc8A           EDGWQLTDAILEALTPDLDCLFLCTPNNPTGLLPERPLLQAIADRCKSLNINLILDEAFIDFIPHETGFI
1lc7A           EDGWQLTDAILEALTPDLDCLFLCTPNNPTGLLPERPLLQAIADRCKSLNINLILDEAFIDFIPHETGFI
1lc5A           EDGWQLTDAILEALTPDLDCLFLCTPNNPTGLLPERPLLQAIADRCKSLNINLILDEAFIDFIPHETGFI
3hdoB           GDFRIAPERYEGKV------FFLTTPNAPLG----PSFPLEYIDELARRCAGLVLDETYAEFA---ESNA
3hdoA           GDFRIAPERYEGKV------FFLTTPNAPLG----PSFPLEYIDELARRCAGLVLDETYAEFA---ESNA
3ei9B           ------------------------SPNNPTGAAATREQLTQLVEFAKKNGSIIVYDSAYAMYMSDDNPRS
3ei9A           ------------------------SPNNPTGAAATREQLTQLVEFAKKNGSIIVYDSAYAMYMSDDNPRS
3ei8A           ------------------------SPNNPTGAAATREQLTQLVEFAKKNGSIIVYDSAYAMYMSDDNPRS
2z1zA           ------------------------SPNNPTGAAATREQLTQLVEFAKKNGSIIVYDSAYAMYMSDDNPRS
3eiaB           ------------------------SPNNPTGAAATREQLTQLVEFAKKNGSIIVYDSAYAMYMSDDNPRS
3eiaA           ------------------------SPNNPTGAAATREQLTQLVEFAKKNGSIIVYDSAYAMYMSDDNPRS
3ei7B           ------------------------SPNNPTGAAATREQLTQLVEFAKKNGSIIVYDSAYAMYMSDDNPRS
3ei7A           ------------------------SPNNPTGAAATREQLTQLVEFAKKNGSIIVYDSAYAMYMSDDNPRS
3ei6B           ------------------------SPNNPTGAAATREQLTQLVEFAKKNGSIIVYDSAYAMYMSDDNPRS
3ei6A           ------------------------SPNNPTGAAATREQLTQLVEFAKKNGSIIVYDSAYAMYMSDDNPRS
2z20B           ------------------------SPNNPTGAAATREQLTQLVEFAKKNGSIIVYDSAYAY--SDDNPRS
2z20A           ------------------------SPNNPTGAAATREQLTQLVEFAKKNGSIIVYDSAYAY--SDDNPRS
3dr7B           DPRTLDAAKLEALITPRTKAIM---PVHLYGQI---CDMDPILEVARRHNLLVIED--------------
3dr4D           DPRTLDAAKLEALITPRTKAIM---PVHLYGQI---CDMDPILEVARRHNLLVIED--------------
3dr4C           DPRTLDAAKLEALITPRTKAIM---PVHLYGQI---CDMDPILEVARRHNLLVIED--------------
3dr4B           DPRTLDAAKLEALITPRTKAIM---PVHLYGQI---CDMDPILEVARRHNLLVIED--------------
3dr4A           DPRTLDAAKLEALITPRTKAIM---PVHLYGQI---CDMDPILEVARRHNLLVIED--------------
3bn1D           DPRTLDAAKLEALITPRTKAIM---PVHLYGQI---CDMDPILEVARRHNLLVIED--------------
3bn1C           DPRTLDAAKLEALITPRTKAIM---PVHLYGQI---CDMDPILEVARRHNLLVIED--------------
3bn1A           DPRTLDAAKLEALITPRTKAIM---PVHLYGQI---CDMDPILEVARRHNLLVIED--------------
1d2fB           ------------------------SPQNPTGKVWTCDELEIMADLCERHGVRVISDEIHMDMVWGEQPHI
1d2fA           ------------------------SPQNPTGKVWTCDELEIMADLCERHGVRVISDEIHMDMVWGEQPHI


                         .         .         .         +         .         .         .:280
query           PMEFADTDNVVVVNACSKTYSMTGWRLGWVAASERRAERMLRVHQYVQXXXXXXXXXXXXXXLSGPQGVV
1gd9A           SIASLDFERTITVNGFSKTFAMTGWRLGFVAAPSWIIERMVKFQMYNATCPVTFIQYAAAKALKDERSAV
1djuA           SIASLDFERTITVNGFSKTFAMTGWRLGFVAAPSWIIERMVKFQMYNATCPVTFIQYAAAKALKDERSAV
1djuB           SIASLDFERTITVNGFSKTFAMTGWRLGFVAAPSWIIERMVKFQMYNATCPVTFIQYAAAKALKDERSAV
1j32A           SIGAASPERSVVCSGFAKTYAMTGWRVGFLAGPVPLVKAATKIQGHSTSNVCTFAQYGAIAAYENSQDCV
1b5pA           PGRVA-PEHTLTVNGAAKAFAMTGWRIGYACGPKEVIKAMASVSRQSTTSPDTIAQWATLEALTNQEAFV
1gc3A           PGRVA-PEHTLTVNGAAKAFAMTGWRIGYACGPKEVIKAMASVSRQSTTSPDTIAQWATLEALTNQEAFV
1b5oA           PGRVA-PEHTLTVNGAAKAFAMTGWRIGYACGPKEVIKAMASVSSQSTTSPDTIAQWATLEALTNQEAFV
5bj4A           PGRVA-PEHTLTVNGAAKAFAMTGWRIGYACGPKEVIKAMASVSRQSTTSPDTIAQWATLEALTNQEAFV
1bkgA           PGRVA-PEHTLTVNGAAKAFAMTGWRIGYACGPKEVIKAMASVSSQSTTSPDTIAQWATLEALTNQEAFV
5bj3A           PGRVA-PEHTLTVNGAAKAFAMTGWRIGYACGPKEVIKAMASVSRQSTTSPDTIAQWATLEALTNQEAFV
1bjwA           PGRVAPEHTLTVNGAAA--FAMTGWRIGYACGPKEVIKAMASVSSQSTTSPDTIAQWATLEALTNQEAFV
1xi9C           PGSLTKDVPVIVMNGLSKVYFATGWRLGYMKLSEVRIDRLAR----IRLCPNTPAQFAAIAGLTGPMDYL
1xi9B           PGSLTKDVPVIVMNGLSKVYFATGWRLGYMKLSEVRIDRLAR----IRLCPNTPAQFAAIAGLTGPMDYL
1xi9A           PGSLTKDVPVIVMNGLSKVYFATGWRLGYMKLSEVRIDRLAR----IRLCPNTPAQFAAIAGLTGPMDYL
1o4sB           ILDVSEFDRIVYINGFSKSHSMTGWRVGYLISSEKVATAVSKIQSHTTSCINTVAQYAALKALEVDNSY-
1o4sA           ILDVSEFDRIVYINGFSKSHSMTGWRVGYLISSEKVATAVSKIQSHTTSCINTVAQYAALKALEVDNSY-
2z61A           AIEFDENEKTILINGFS-LYAMTGWRIGYVISNDEIIEAILKLQQNLFISAPTISQYAALKAFKETEREI
3e2yA           KIATLPWERTITIGSAGKTFSVTGWKLGWSIGPAHLIKHLQTVQQTPLQAALAEAFWIDIKRMDDPECYF
1w7nA           IASLPGMERTLTIGSAGKTFSATGWKVGWVLGPDHIMKHLRTVHQTQSQAAVAESFEREQLLFRQPSSYF
1w7lA           IASLPGMWERTLTIGSAGTFSATGWKVGWVLGPDHIMKHLRTVHQTQSQAAVAESFEREQLLFRQPSSYF
1yiyA           ICTLPGMERTITIGSAGKTFSLTGWKIGWAYGPEALLKNLQMVHQNCVQEAIAVGFETELKRLKSPECYF
2r5cB           ICTLPGMERTITIGSAGKTFSLTGWKIGWAYGPEALLKNLQMVHQNCVQEAIAVGFETELKRLKSPECYF
3e2fA           IATLPGMWERTITIGSAGTFSVTGWKLGWSIGPAHLIKHLQTVQQTPLQAALAEAFWIDIKRMDDPECYF
3fvsA           IASLPGMWERTLTIGSAGTFSATGWKVGWVLGPDHIMKHLRTVHQTQSQAAVAESFEREQLLFRQPSSYF
2o0rB           PLAGFDAERTITISSAA-MFNCTGWKIGWACGPAELIAGVRAAKQYL-----------------------
2o0rA           PLAGFDAERTITISSAA-MFNCTGWKIGWACGPAELIAGVRAAKQYL-----------------------
1u08B           VLAHPQRERAVAVSSFGKTYHMTGWKVGYCVAPAPISAEIRKVHQYLTFSVNTPAQLALADMLRAEPEHY
1u08A           VLAHPQRERAVAVSSFGKTYHMTGWKVGYCVAPAPISAEIRKVHQYLTFSVNTPAQLALADMLRAEPEHY
1yizA           ICTLPGMWERTITIGSAGTFSLTGWKIGWAYGPEALLKNLQMVHQNCVQEAIAVGFETELKRLKSPECYF
2r5cA           ICTLPGMWERTITIGSAGTFSLTGWKIGWAYGPEALLKNLQMVHQNCVQEAIAVGFETELKRLKSPECYF
2gb3F           AL--XXXXXXXXXXXXXXXFSACGARVGCLIT---RNEELISHAKLAQLAPPLLEQIGSVGLLNLDDSFF
2gb3E           AL--XXXXXXXXXXXXXXXFSACGARVGCLIT---RNEELISHAKLAQLAPPLLEQIGSVGLLNLDDSFF
2gb3D           AL--XXXXXXXXXXXXXXXFSACGARVGCLIT---RNEELISHAKLAQLAPPLLEQIGSVGLLNLDDSFF
2gb3C           AL--XXXXXXXXXXXXXXXFSACGARVGCLIT---RNEELISHAKLAQLAPPLLEQIGSVGLLNLDDSFF
2gb3B           AL--XXXXXXXXXXXXXXXFSACGARVGCLIT---RNEELISHAKLAQLAPPLLEQIGSVGLLNLDDSFF
2gb3A           AL--XXXXXXXXXXXXXXXFSACGARVGCLIT---RNEELISHAKLAQLAPPLLEQIGSVGLLNLDDSFF
1v2eB           LREFA-PERTFTVGSAGKRLEATGYRVGWIVGPKEFMPRLAGMRQW------------------------
1v2eA           LREFA-PERTFTVGSAGKRLEATGYRVGWIVGPKEFMPRLAGMRQW------------------------
1v2dA           LREFA-PERTFTVGSAGKRLEATGYRVGWIVGPKEFMPRLAGMRQW------------------------
3b46B           ATLSPEIGQLTLTVGSAGSFAATGWRIGWV----------------------------------------
3b46A           ATLSPEIGQLTLTVGSAGSFAATGWRIGWV----------------------------------------
3dydB           PLATLSTDPILSCGGLAKRWLVPGWRLGWILIHDRRRDGLVKLSQRILGPCTIVQGALKSILCRTPGEFY
3dydA           PLATLSTDPILSCGGLAKRWLVPGWRLGWILIHDRRRDGLVKLSQRILGPCTIVQGALKSILCRTPGEFY
3h14A           ALEL--TDECYVINSFSKYFS-TGWRVGWVVPEDRVVERIAQ-----NFICAPHASQVXXXXXXXXXXXX
1bw0B           FTSVADFETTVVILGGTANLVVPGWRLGWLLYVDPHGEGLKRVGMLVCGPCTVVQAALGEALLNTPQEHL
1bw0A           FTSVADFETTVVILGGTANLVVPGWRLGWLLYVDPHGEGLKRVGMLVCGPCTVVQAALGEALLNTPQEHL
1wstA           PIKFDDYGRVIYLGTFSKILA-PGFRIGWVAAHPHLIRKMEIAKQSIDLCTNTFGQAIAWKYVE--NGYL
3eleC           PFVTKYYDNTLVCYSYSKSLSLPGERIGYVLVPD-------EVYDKAELYAAVCGAGRALGYVCAPQGAT
3eleA           PFVTKYYDNTLVCYSYSKSLSLPGERIGYVLVPD-------EVYDKAELYAAVCGAGRALGYVCAPQGAT
2zc0A           PLKALDNEGRVIVAGTLSKVLGTGFRIGWIIAEGEILKKVLMQKQPIDFCAPAISQYIALEYLKREKYHL
2o1bA           ILASENGKDVAIIYSLSKGYN-SGFRVGFAVGN--KDIQALKKYQTHTNAGFGALQDAAIYALNHYDDFL
2douB           PLALPGAERVVELFSLSKSYNLAGFRLGFALGSEEALARLERVKGVIDFNQYAGVLRMGVEALKTPKEVV
2douA           PLALPGAERVVELFSLSKSYNLAGFRLGFALGSEEALARLERVKGVIDFNQYAGVLRMGVEALKTPKEVV
1ijiA           AGWLAEYPHLAILRTLSKAFALAGLRCGFTLANEEVINLLMKV---IAPYPLSTPVADIAAQALSPQGIV
1geyA           AGWLAEYPHLAILRTLSKAFALAGLRCGFTLANEEVINLLMKV---IAPYPLSTPVADIAAQALSPQGIV
1gexA           AGWLAEYPHLAILRTLSKAFALAGLRCGFTLANEEVINLLMKV---IAPYPLSTPVADIAAQALSPQGIV
1gewA           AGWLAEYPHLAILRTLSKAFALAGLRCGFTLANEEVINLLMKV---IAPYPLSTPVADIAAQALSPQGIV
1fg7A           AGWLAEYPHLAILRTLSKAFALAGLRCGFTLAN----EEVINLLKVIAPYPLSTPVADIAAQALSPQGIV
3ezsB           PPSLLEAKNVLVIHSLSKRSSAPGLRSGFIAGDSRLLEKYKAFRAYL-----------------------
3ezsA           PPSLLEAKNVLVIHSLSKRSSAPGLRSGFIAGDSRLLEKYKAFRAYL-----------------------
1vp4B           PIKIGGPERVVLLNTFSKVLA-PGLRIG-VAGSKEFIRKIVQAKQSADLCSPAITHRLAARYLE-RYDLL
1vp4A           PIKIGGPERVVLLNTFSKVLA-PGLRIG-VAGSKEFIRKIVQAKQSADLCSPAITHRLAARYLE-RYDLL
1x0mA           KIKALDNEGRVIYLGTFSKILAPGFRIGWMVGDPGIIRKMEIAKQSTDLCTNVFGQVVAWRYVDGGEKHI
3fdbA           AAGVSDTASVCITITAPSAWNIAGLKCAQIIFSNSDAEHWQQLSPVIKDGASTLGLIAAEAAYRYGTDFL
3jtxA           AAQLGRSRQKLLFTSLSRS-NVPGLRSGFVAGDAELLKNFLLYRTY-HGSASIPVQRASIAAWDDEQHVI
3f6tB           -PNFKSIYSVVPYNTLVYSYSLTGWRLGVIALNEK-----------------------------------
3f6tA           -PNFKSIYSVVPYNTLVYSYSLTGWRLGVIALNEK-----------------------------------
3eucB           ---LTDFGN-LLVRTVSK-LGLAGIRLGYVAGDPQWLEQLDKVRPPYNVNVLTEATALFALE---HVAVL
3eucA           ---LTDFGN-LLVRTVSK-LGLAGIRLGYVAGDPQWLEQLDKVRPPYNVNVLTEATALFALE---HVAVL
2zy5F           LFAICP-ENTLLVYSFSKYFGATGWRLGVVAAHQQ-----------------------------------
2zy5E           LFAICP-ENTLLVYSFSKYFGATGWRLGVVAAHQQ-----------------------------------
2zy5D           LFAICP-ENTLLVYSFSKYFGATGWRLGVVAAHQQ-----------------------------------
2zy5B           LFAICP-ENTLLVYSFSKYFGATGWRLGVVAAHQQ-----------------------------------
2zy5A           LFAICP-ENTLLVYSFSKYFGATGWRLGVVAAHQQ-----------------------------------
2zy4F           LFAICP-ENTLLVYSFSKYFGATGWRLGVVAAHQQ-----------------------------------
2zy4E           LFAICP-ENTLLVYSFSKYFGATGWRLGVVAAHQQ-----------------------------------
2zy4D           LFAICP-ENTLLVYSFSKYFGATGWRLGVVAAHQQ-----------------------------------
2zy4C           LFAICP-ENTLLVYSFSKYFGATGWRLGVVAAHQQ-----------------------------------
2zy4B           LFAICP-ENTLLVYSFSKYFGATGWRLGVVAAHQQ-----------------------------------
2zy4A           LFAICP-ENTLLVYSFSKYFGATGWRLGVVAAHQQ-----------------------------------
2zy3F           LFAICP-ENTLLVYSFSKYFGATGWRLGVVAAHQQ-----------------------------------
2zy3E           LFAICP-ENTLLVYSFSKYFGATGWRLGVVAAHQQ-----------------------------------
2zy3D           LFAICP-ENTLLVYSFSKYFGATGWRLGVVAAHQQ-----------------------------------
2zy3C           LFAICP-ENTLLVYSFSKYFGATGWRLGVVAAHQQ-----------------------------------
2zy3B           LFAICP-ENTLLVYSFSKYFGATGWRLGVVAAHQQ-----------------------------------
2zy3A           LFAICP-ENTLLVYSFSKYFGATGWRLGVVAAHQQ-----------------------------------
1uu2A           YVDFLKKENLAVIRTFSKAFSLAAQRVGYVVASEKFIDAYNRV---------------------------
1uu1C           YVDFLKKENLAVIRTFSKAFSLAAQRVGYVVASEKFIDAYNRV---------------------------
1uu1B           YVDFLKKENLAVIRTFSKAFSLAAQRVGYVVASEKFIDAYNRV---------------------------
1uu1A           YVDFLKKENLAVIRTFSKAFSLAAQRVGYVVASEKFIDAYNRV---------------------------
1uu0D           YVDFLKKENLAVIRTFSKAFSLAAQRVGYVVASEKFIDAYNRV---------------------------
1uu0A           YVDFLKKENLAVIRTFSKAFSLAAQRVGYVVASEKFIDAYNRV---------------------------
2f8jB           YVDFLKKENLAVIRTFSKAFSLAAQRVGYVVASEKFIDAYNRV---------------------------
2f8jA           YVDFLKKENLAVIRTFSKAFSLAAQRVGYVVASEKFIDAYNRV---------------------------
3jtxB           AAQLGRSRQKLLFTSLSRS-NVPGLRSGFVAGDAELLKNFLLYRTY-HGSASIPVQRASIAAWDDEQHVI
1uu2B           YVDFLKKENLAVIRTFSKAFSLAAQRVGYVVASEKFIDAYNRV---------------------------
1uu0C           YVDFLKKENLAVIRTFSKAFSLAAQRVGYVVASEKFIDAYNRV---------------------------
1uu0B           YVDFLKKENLAVIRTFSKAFSLAAQRVGYVVASEKFIDAYNRV---------------------------
1h1cD           YVDFLKKENLAVIRTFSKAFSLAAQRVGYVVASEKFIDAYNRV---------------------------
1h1cA           YVDFLKKENLAVIRTFSKAFSLAAQRVGYVVASEKFIDAYNRV---------------------------
2zyjA           PSLFAGYPGVIYLGSFSKVLS-PGLRVAFAVAHPEALQKLVQAKQ-------------------------
2z1yB           PSLFAGYPGVIYLGSFSKVLS-PGLRVAFAVAHPEALQKLVQAKQ-------------------------
2z1yA           PSLFAGYPGVIYLGSFSKVLS-PGLRVAFAVAHPEALQKLVQAKQ-------------------------
2ogeB           ----------------------------------------------------------------------
2ogeA           ----------------------------------------------------------------------
2ogaC           ----------------------------------------------------------------------
2ogaB           ----------------------------------------------------------------------
2ogaA           ----------------------------------------------------------------------
1mdzA           ----------------------------------------------------------------------
1mdxA           ----------------------------------------------------------------------
1iayA           EMTYCNKDLVHIVYSLSKDMGLPGFRVG------------------------------------------
1iaxA           EMTYCNKDLVHIVYSLSKDMGLPGFRVG------------------------------------------
3fddA           LFAICPA-NTLLVYSFSKYFGATGWRLGVVAA--------------------------------------
2egyD           PSLFAGYPGVIYLGSFSKVLS-PGLRVAFAVAHPEALQKLVQAKQ-------------------------
2egyC           PSLFAGYPGVIYLGSFSKVLS-PGLRVAFAVAHPEALQKLVQAKQ-------------------------
2egyB           PSLFAGYPGVIYLGSFSKVLS-PGLRVAFAVAHPEALQKLVQAKQ-------------------------
3cbfA           PSLFAGYPGVIYLGSFSKVLS-PGLRVAFAVAHPEALQKLVQAKQ-------------------------
1ynuA           VMELKDSERVHVVYSLSKDLGLPGFRVGAIYSND------------------------------------
1m7yA           VMEVLKDRNVHVVYSLSKDLGLPGFRVGAIYSND------------------------------------
1m4nA           VMEVLKDRNVHVVYSLSKDLGLPGFRVGAIYSND------------------------------------
3ihjA           ----------------------------------------------------------------------
1b8gB           VMEVLKDRNVHVVYSLSKDLGLPGFRVGAIYSND------------------------------------
1b8gA           VMEVLKDRNVHVVYSLSKDLGLPGFRVGAIYSND------------------------------------
1h1cC           YVDFLKKENLAVIRTFSKAFSLAAQRVGYVVASEKFIDAYNRV---------------------------
1h1cB           YVDFLKKENLAVIRTFSKAFSLAAQRVGYVVASEKFIDAYNRV---------------------------
3cq4A           LLEKYPT-KLVVSRTMSKAFDFAGGRLGYFVAN-------------------------------------
2zg5A           PSLF------------------------------------------------------------------
3cq5B           LLEKYPT-KLVVSRTMSKAFDFAGGRLGYFVAN-------------------------------------
3cq5A           LLEKYPT-KLVVSRTMSKAFDFAGGRLGYFVAN-------------------------------------
1c7nA           VFQSIDADKTITFTAPSKTFNIAG----------------------------------------------
2zy2A           LFSVCPR-NTLLVYSFSKYFGATGWRLGVIAA--------------------------------------
2vgzA           PTFLSMDVDGRVIRADSFSIISSGLRIGFLTGPKPLIERVI-----------------------------
2qlrA           PTFLSMDVDGRVIRADSFSIISSGLRIGFLTGPKPLIERVI-----------------------------
3dc1D           PTFLSMDVDGRVIRADSFSIISSGLRIGFLTGPKPLIERVI-----------------------------
3dc1B           PTFLSMDVDGRVIRADSFSIISSGLRIGFLTGPKPLIERVI-----------------------------
3dc1A           PTFLSMDVDGRVIRADSFSIISSGLRIGFLTGPKPLIERVI-----------------------------
3frkB           ----------------------------------------------------------------------
3frkA           ----------------------------------------------------------------------
2r2nA           TFLSMDVDRVIRADSFSKIIS-SGLRIGFLTGPKPLIERVI-----------------------------
3cq4B           LLEKYPT-KLVVSRTMSKAFDFAGGRLGYFVAN-------------------------------------
1mdoA           ----------------------------------------------------------------------
3cq6A           LLEKYPTK--LVVSRTMSAFDFAGGRLGYFVAN-------------------------------------
3ffhB           EKLVRTYKNLIITRTFSKIYGLASARVGYGIADK------------------------------------
3ffhA           EKLVRTYKNLIITRTFSKIYGLASARVGYGIADK------------------------------------
3dzzB           PAFTVDWDNWVVSLISPSTFNL------------------------------------------------
3dzzA           PAFTVDWDNWVVSLISPSTFNL------------------------------------------------
1lkcA           P-ALKDNPHIWVLRSLTKFYAIPGLRLGYLVNSDDAAMARMRRQQ-------------------------
1lc8A           P-ALKDNPHIWVLRSLTKFYAIPGLRLGYLVNSDDAAMARMRRQQ-------------------------
1lc7A           P-ALKDNPHIWVLRSLTKFYAIPGLRLGYLVNSDDAAMARMRRQQ-------------------------
1lc5A           P-ALKDNPHIWVLRSLTKFYAIPGLRLGYLVNSDDAAMARMRRQQ-------------------------
3hdoB           LELVRRHENVVVTRTLSKSYSLAG-RIGLAIA---RPEVIAALDKIRDHYNLDRLAQAACVAALRDQAYL
3hdoA           LELVRRHENVVVTRTLSKSYSLAG-RIGLAIA---RPEVIAALDKIRDHYNLDRLAQAACVAALRDQAYL
3ei9B           IFEIPGAEEVAMETASFSNYAFTGVRLGWTVIPKK-----------------------------------
3ei9A           IFEIPGAEEVAMETASFSNYAFTGVRLGWTVIPKK-----------------------------------
3ei8A           IFEIPGAEEVAMETASFSNYAFTGVRLGWTVIPKK-----------------------------------
2z1zA           IFEIPGAEEVAMETASSKYAGFTGVRLGWTVIPKK-----------------------------------
3eiaB           IFEIPGAEEVAMETASFSQYAFTGVRLGWTVIPKK-----------------------------------
3eiaA           IFEIPGAEEVAMETASFSQYAFTGVRLGWTVIPKK-----------------------------------
3ei7B           IFEIPGAEEVAMETASSKYAGFTGVRLGWTVIPKK-----------------------------------
3ei7A           IFEIPGAEEVAMETASSKYAGFTGVRLGWTVIPKK-----------------------------------
3ei6B           IFEIPGAEEVAMETASSKYAGFTGVRLGWTVIPKK-----------------------------------
3ei6A           IFEIPGAEEVAMETASSKYAGFTGVRLGWTVIPKK-----------------------------------
2z20B           IFEIPGAEEVAETASFSKYAGFTGVRLGWTVIPKK-----------------------------------
2z20A           IFEIPGAEEVAETASFSKYAGFTGVRLGWTVIPKK-----------------------------------
3dr7B           ----------------------------------------------------------------------
3dr4D           ----------------------------------------------------------------------
3dr4C           ----------------------------------------------------------------------
3dr4B           ----------------------------------------------------------------------
3dr4A           ----------------------------------------------------------------------
3bn1D           ----------------------------------------------------------------------
3bn1C           ----------------------------------------------------------------------
3bn1A           ----------------------------------------------------------------------
1d2fB           PWSNVARGDWALLTSGSKSFNI------------------------------------------------
1d2fA           PWSNVARGDWALLTSGSKSFNI------------------------------------------------


                         .         *         .         .         .         .         +:350
query           DEMVAAFEARRDVLLDGLEAMGLDVPTPGGAFYAMPTVPDGWIDEXXXXXXXXXPGSAFGDHGAGTARIS
1gd9A           EEMRKEYDRRRKLVWKRLNEMGLPTVKPKGAFYIFPRIRDTGLTSLKEARVAVVPGSAFGKAGEGYVRIS
1djuA           EEMRKEYDRRRKLVWKRLNEMGLPTVKPKGAFYIFPRIRDTGLTSLKEARVAVVPGSAFGKAGEGYVRIS
1djuB           EEMRKEYDRRRKLVWKRLNEMGLPTVKPKGAFYIFPRIRDTGLTSLKEARVAVVPGSAFGKAGEGYVRIS
1j32A           QEMLAAFAERRRYMLDALNAMGLECPKPDGAFYMFPSIADFCSELLDQHQVATVPGAAFG--ADDCIRLS
1b5pA           EMAREAYRRRRDXXXXXXXXXXXKAVRPSGAFYVLPIAPDRAAERLLEAGVAVVPGTDFA--AFGHVRLS
1gc3A           EMAREAYRRRRDXXXXXXXXXXXKAVRPSGAFYVLPIAPDRAAERLLEAGVAVVPGTDFA--AFGHVRLS
1b5oA           EMAREAYRRRRDXXXXXXXXXXXKAVRPSGAFYVLPIAPDRAAERLLEAGVAVVPGTDFA--AFGHVRLS
5bj4A           EMAREAYRRRRDXXXXXXXXXXXKAVRPSGAFYVLPIAPDRAAERLLEAGVAVVPGTDFA--AFGHVRLS
1bkgA           EMAREAYRRRRDXXXXXXXXXXXKAVRPSGAFYVLPIAPDRAAERLLEAGVAVVPGTDFA--AFGHVRLS
5bj3A           EMAREAYRRRRDXXXXXXXXXXXKAVRPSGAFYVLPIAPDRAAERLLEAGVAVVPGTDFA--AFGHVRLS
1bjwA           EMAREAYRRRRDXXXXXXXXXXXKAVRPSGAFYVLPIAPDRAAERLLEAGVAVVPGTDFA--AFGHVRLS
1xi9C           KEYMKKLKERRDYIYKRLEIPGISTTKPQGAFYIFPKIEVGWLDVLHNAHVLFVHGSGFGEYGAGHFRAV
1xi9B           KEYMKKLKERRDYIYKRLEIPGISTTKPQGAFYIFPKIEVGWLDVLHNAHVLFVHGSGFGEYGAGHFRAV
1xi9A           KEYMKKLKERRDYIYKRLEIPGISTTKPQGAFYIFPKIEVGWLDVLHNAHVLFVHGSGFGEYGAGHFRAV
1o4sB           --MVQTFKERKNFVVERLKKMGVKFVEPEGAFYLFFKVRGDDVKLLEEKKVALVPGSAF--LKPGFVRLS
1o4sA           --MVQTFKERKNFVVERLKKMGVKFVEPEGAFYLFFKVRGDDVKLLEEKKVALVPGSAF--LKPGFVRLS
2z61A           NSMIKEFDRRRRLVLKYVKDFGWEVNNPIGAYYVFPNIGEDGRELLKEKFVALTPGIGFGSKGKNYIRIS
3e2yA           NSLPKELEVKRDRMVRLLNSVGLKPIVPDGGYFIIADV--------------------------------
1w7nA           VQFPQAMQRCRDHMIRSLQSVGLKPLIPQGSYFLITDISD------------------------------
1w7lA           VQFPQAMQRCRDHMIRSLQSVGLKPLIPQGSYFLITDISD------------------------------
1yiyA           NSISGELMAKRDYMASFLAEVGMNPTVPQGGYF-------------------------------------
2r5cB           NSISGELMAKRDYMASFLAEVGMNPTVPQGGYF-------------------------------------
3e2fA           NSLPKELEVKRDRMVRLLNSVGLKPIVPDGGYFIIADV--------------------------------
3fvsA           VQFPQAMQRCRDHMIRSLQSVGLKPIIPQGSYFLITDISD------------------------------
2o0rB           ----------------------------------------------------------------------
2o0rA           ----------------------------------------------------------------------
1u08B           LALPDFYRQKRDILVNALNESRLEILPCEGTYFLL-----------------------------------
1u08A           LALPDFYRQKRDILVNALNESRLEILPCEGTYFLL-----------------------------------
1yizA           NSISGELMAKRDYMASFLAEVGMNPTVPQGGYF-------------------------------------
2r5cA           NSISGELMAKRDYMASFLAEVGMNPTVPQGGYF-------------------------------------
2gb3F           DFVRETYRERVETVLKKLEEHGLKRFTPSGAFYITAELP-------------------------------
2gb3E           DFVRETYRERVETVLKKLEEHGLKRFTPSGAFYITAELP-------------------------------
2gb3D           DFVRETYRERVETVLKKLEEHGLKRFTPSGAFYITAELP-------------------------------
2gb3C           DFVRETYRERVETVLKKLEEHGLKRFTPSGAFYITAELP-------------------------------
2gb3B           DFVRETYRERVETVLKKLEEHGLKRFTPSGAFYITAELP-------------------------------
2gb3A           DFVRETYRERVETVLKKLEEHGLKRFTPSGAFYITAELP-------------------------------
1v2eB           ----------------------------------------------------------------------
1v2eA           ----------------------------------------------------------------------
1v2dA           ----------------------------------------------------------------------
3b46B           ----------------------------------------------------------------------
3b46A           ----------------------------------------------------------------------
3dydB           HNTLSFLKSNADLCYGALAAIGLRPVRPSGAMYLM-----------------------------------
3dydA           HNTLSFLKSNADLCYGALAAIGLRPVRPSGAMYLM-----------------------------------
3h14A           XXNLDVYKANRK-LLERLPKAGFTIAPPDGAFYVYADVSDLTDDSLEKAGVAVTPGLDFDERGAGTLRFS
1bw0B           DQIVAKIEESAMYLYNHIECIGLAPTMPRGAMYLMSRIDEFFEKLLEEENVQVLPGTIF--HAPGFTRLT
1bw0A           DQIVAKIEESAMYLYNHIECIGLAPTMPRGAMYLMSRIDEFFEKLLEEENVQVLPGTIF--HAPGFTRLT
1wstA           DEIIEFYKPRRDAMLEALEEYGVEWTKPEGGMFVRVTLPEGMMERAVAKGVAYVPGEAFFVH--------
3eleC           GD-INAYKENRDLLYEGLTRIGYHCFKPDGAFYFVKALEDAFCEKAKEEDVLIVAADGFG--CPGWVRIS
3eleA           GD-INAYKENRDLLYEGLTRIGYHCFKPDGAFYFVKALEDAFCEKAKEEDVLIVAADGFG--CPGWVRIS
2zc0A           EGALLGYKEKRDIMLKALELPNAEFTKPIAGMFVMFFLPEG-----------------------------
2o1bA           EEQSNVFKTRRD-RFEALAKADLPFVHAKGGIYVWLETPPGYDSEVQEKSILVAPGKPFGENGNRYVRIS
2douB           RGYARVYRERALGMAEALKGV-LSLLPPRATMYLWGRLPEG-----------------------------
2douA           RGYARVYRERALGMAEALKGV-LSLLPPRATMYLWGRLPEG-----------------------------
1ijiA           RERVAQIIAEREYLIAALK---------------------------------------------------
1geyA           RERVAQIIAEREYLIAALK---------------------------------------------------
1gexA           RERVAQIIAEREYLIAALK---------------------------------------------------
1gewA           RERVAQIIAEREYLIAALK---------------------------------------------------
1fg7A           RERVAQIIAEREYLIAALK---------------------------------------------------
3ezsB           ----------------------------------------------------------------------
3ezsA           ----------------------------------------------------------------------
1vp4B           EQLKPTIERRKRTVLNALEEYFSDIPSEGGLFIWL-TLPEGF----------------------------
1vp4A           EQLKPTIERRKRTVLNALEEYFSDIPSEGGLFIWL-TLPEGF----------------------------
1x0mA           PEIRKFYKPRRDAMLEALEEFGVKWTKPEGGMFIWVTLPDGMLERAIKKGVAYVPGEAFYAH--------
3fdbA           NQEVAYLKNNHDFLLHEIRIPGAKI-TPQATYFRDTTIEGSPSEFFIEKAKVANDGAWFGEDGTGFCRLN
3jtxA           DNR-RLYQEKFERVIPILQQV-FDVKLPDASFYIWLKVPDG-----------------------------
3f6tB           ----------------------------------------------------------------------
3f6tA           ----------------------------------------------------------------------
3eucB           DEQAAQLRAERSRVAEGAAHGGVTV-FPSAANFLLARVPD------------------------------
3eucA           DEQAAQLRAERSRVAEGAAHGGVTV-FPSAANFLLARVPD------------------------------
2zy5F           ----------------------------------------------------------------------
2zy5E           ----------------------------------------------------------------------
2zy5D           ----------------------------------------------------------------------
2zy5B           ----------------------------------------------------------------------
2zy5A           ----------------------------------------------------------------------
2zy4F           ----------------------------------------------------------------------
2zy4E           ----------------------------------------------------------------------
2zy4D           ----------------------------------------------------------------------
2zy4C           ----------------------------------------------------------------------
2zy4B           ----------------------------------------------------------------------
2zy4A           ----------------------------------------------------------------------
2zy3F           ----------------------------------------------------------------------
2zy3E           ----------------------------------------------------------------------
2zy3D           ----------------------------------------------------------------------
2zy3C           ----------------------------------------------------------------------
2zy3B           ----------------------------------------------------------------------
2zy3A           ----------------------------------------------------------------------
1uu2A           ----------------------------------------------------------------------
1uu1C           ----------------------------------------------------------------------
1uu1B           ----------------------------------------------------------------------
1uu1A           ----------------------------------------------------------------------
1uu0D           ----------------------------------------------------------------------
1uu0A           ----------------------------------------------------------------------
2f8jB           ----------------------------------------------------------------------
2f8jA           ----------------------------------------------------------------------
3jtxB           DNR-RLYQEKFERVIPILQQV-FDVKLPDASFYIWLKVPDG-----------------------------
1uu2B           ----------------------------------------------------------------------
1uu0C           ----------------------------------------------------------------------
1uu0B           ----------------------------------------------------------------------
1h1cD           ----------------------------------------------------------------------
1h1cA           ----------------------------------------------------------------------
2zyjA           ----------------------------------------------------------------------
2z1yB           ----------------------------------------------------------------------
2z1yA           ----------------------------------------------------------------------
2ogeB           ----------------------------------------------------------------------
2ogeA           ----------------------------------------------------------------------
2ogaC           ----------------------------------------------------------------------
2ogaB           ----------------------------------------------------------------------
2ogaA           ----------------------------------------------------------------------
1mdzA           ----------------------------------------------------------------------
1mdxA           ----------------------------------------------------------------------
1iayA           ----------------------------------------------------------------------
1iaxA           ----------------------------------------------------------------------
3fddA           ----------------------------------------------------------------------
2egyD           ----------------------------------------------------------------------
2egyC           ----------------------------------------------------------------------
2egyB           ----------------------------------------------------------------------
3cbfA           ----------------------------------------------------------------------
1ynuA           ----------------------------------------------------------------------
1m7yA           ----------------------------------------------------------------------
1m4nA           ----------------------------------------------------------------------
3ihjA           ----------------------------------------------------------------------
1b8gB           ----------------------------------------------------------------------
1b8gA           ----------------------------------------------------------------------
1h1cC           ----------------------------------------------------------------------
1h1cB           ----------------------------------------------------------------------
3cq4A           ----------------------------------------------------------------------
2zg5A           ----------------------------------------------------------------------
3cq5B           ----------------------------------------------------------------------
3cq5A           ----------------------------------------------------------------------
1c7nA           ----------------------------------------------------------------------
2zy2A           ----------------------------------------------------------------------
2vgzA           ----------------------------------------------------------------------
2qlrA           ----------------------------------------------------------------------
3dc1D           ----------------------------------------------------------------------
3dc1B           ----------------------------------------------------------------------
3dc1A           ----------------------------------------------------------------------
3frkB           ----------------------------------------------------------------------
3frkA           ----------------------------------------------------------------------
2r2nA           ----------------------------------------------------------------------
3cq4B           ----------------------------------------------------------------------
1mdoA           ----------------------------------------------------------------------
3cq6A           ----------------------------------------------------------------------
3ffhB           ----------------------------------------------------------------------
3ffhA           ----------------------------------------------------------------------
3dzzB           ----------------------------------------------------------------------
3dzzA           ----------------------------------------------------------------------
1lkcA           ----------------------------------------------------------------------
1lc8A           ----------------------------------------------------------------------
1lc7A           ----------------------------------------------------------------------
1lc5A           ----------------------------------------------------------------------
3hdoB           SECCRRIRETREWFTTELRSIGYDVPSQGNYLFATPPDRDG-----------------------------
3hdoA           SECCRRIRETREWFTTELRSIGYDVPSQGNYLFATPPDRDG-----------------------------
3ei9B           ----------------------------------------------------------------------
3ei9A           ----------------------------------------------------------------------
3ei8A           ----------------------------------------------------------------------
2z1zA           ----------------------------------------------------------------------
3eiaB           ----------------------------------------------------------------------
3eiaA           ----------------------------------------------------------------------
3ei7B           ----------------------------------------------------------------------
3ei7A           ----------------------------------------------------------------------
3ei6B           ----------------------------------------------------------------------
3ei6A           ----------------------------------------------------------------------
2z20B           ----------------------------------------------------------------------
2z20A           ----------------------------------------------------------------------
3dr7B           ----------------------------------------------------------------------
3dr4D           ----------------------------------------------------------------------
3dr4C           ----------------------------------------------------------------------
3dr4B           ----------------------------------------------------------------------
3dr4A           ----------------------------------------------------------------------
3bn1D           ----------------------------------------------------------------------
3bn1C           ----------------------------------------------------------------------
3bn1A           ----------------------------------------------------------------------
1d2fB           ----------------------------------------------------------------------
1d2fA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           YATDMATLRDAIDVMRAATAxxx
1gd9A           YATAYEKLEEAMDRM--------
1djuA           YATAYEKLEEAMERM--------
1djuB           YATAYEKLEEAMERM--------
1j32A           YATDLDTIKRGME----------
1b5pA           YATSEENLRKALE----------
1gc3A           YATSEENLRKALE----------
1b5oA           YATSEENLRKALE----------
5bj4A           YATSEENLRKALE----------
1bkgA           YATSEENLRKALE----------
5bj3A           YATSEENLRKALE----------
1bjwA           YATSEENLRKALE----------
1xi9C           FLPPIEILEEAMD----------
1xi9B           FLPPIEILEEAMD----------
1xi9A           FLPPIEILEEAMD----------
1o4sB           FATSIERLTEALD----------
1o4sA           FATSIERLTEALD----------
2z61A           YANSYENIKEGLE----------
3e2yA           -----------------------
1w7nA           -----------------------
1w7lA           -----------------------
1yiyA           -----------------------
2r5cB           -----------------------
3e2fA           -----------------------
3fvsA           -----------------------
2o0rB           -----------------------
2o0rA           -----------------------
1u08B           -----------------------
1u08A           -----------------------
1yizA           -----------------------
2r5cA           -----------------------
2gb3F           -----------------------
2gb3E           -----------------------
2gb3D           -----------------------
2gb3C           -----------------------
2gb3B           -----------------------
2gb3A           -----------------------
1v2eB           -----------------------
1v2eA           -----------------------
1v2dA           -----------------------
3b46B           -----------------------
3b46A           -----------------------
3dydB           -----------------------
3dydA           -----------------------
3h14A           YARATADIEEGLDRLEAFQA---
1bw0B           TTRPVEVYREAVERIKA------
1bw0A           TTRPVEVYREAVERIKA------
1wstA           -----------------------
3eleC           YCVD-------------------
3eleA           YCVD-------------------
2zc0A           -----------------------
2o1bA           LALDDQKLDEA------------
2douB           -----------------------
2douA           -----------------------
1ijiA           -----------------------
1geyA           -----------------------
1gexA           -----------------------
1gewA           -----------------------
1fg7A           -----------------------
3ezsB           -----------------------
3ezsA           -----------------------
1vp4B           -----------------------
1vp4A           -----------------------
1x0mA           -----------------------
3fdbA           FATSREVLEEAIDRAKAVS----
3jtxA           -----------------------
3f6tB           -----------------------
3f6tA           -----------------------
3eucB           -----------------------
3eucA           -----------------------
2zy5F           -----------------------
2zy5E           -----------------------
2zy5D           -----------------------
2zy5B           -----------------------
2zy5A           -----------------------
2zy4F           -----------------------
2zy4E           -----------------------
2zy4D           -----------------------
2zy4C           -----------------------
2zy4B           -----------------------
2zy4A           -----------------------
2zy3F           -----------------------
2zy3E           -----------------------
2zy3D           -----------------------
2zy3C           -----------------------
2zy3B           -----------------------
2zy3A           -----------------------
1uu2A           -----------------------
1uu1C           -----------------------
1uu1B           -----------------------
1uu1A           -----------------------
1uu0D           -----------------------
1uu0A           -----------------------
2f8jB           -----------------------
2f8jA           -----------------------
3jtxB           -----------------------
1uu2B           -----------------------
1uu0C           -----------------------
1uu0B           -----------------------
1h1cD           -----------------------
1h1cA           -----------------------
2zyjA           -----------------------
2z1yB           -----------------------
2z1yA           -----------------------
2ogeB           -----------------------
2ogeA           -----------------------
2ogaC           -----------------------
2ogaB           -----------------------
2ogaA           -----------------------
1mdzA           -----------------------
1mdxA           -----------------------
1iayA           -----------------------
1iaxA           -----------------------
3fddA           -----------------------
2egyD           -----------------------
2egyC           -----------------------
2egyB           -----------------------
3cbfA           -----------------------
1ynuA           -----------------------
1m7yA           -----------------------
1m4nA           -----------------------
3ihjA           -----------------------
1b8gB           -----------------------
1b8gA           -----------------------
1h1cC           -----------------------
1h1cB           -----------------------
3cq4A           -----------------------
2zg5A           -----------------------
3cq5B           -----------------------
3cq5A           -----------------------
1c7nA           -----------------------
2zy2A           -----------------------
2vgzA           -----------------------
2qlrA           -----------------------
3dc1D           -----------------------
3dc1B           -----------------------
3dc1A           -----------------------
3frkB           -----------------------
3frkA           -----------------------
2r2nA           -----------------------
3cq4B           -----------------------
1mdoA           -----------------------
3cq6A           -----------------------
3ffhB           -----------------------
3ffhA           -----------------------
3dzzB           -----------------------
3dzzA           -----------------------
1lkcA           -----------------------
1lc8A           -----------------------
1lc7A           -----------------------
1lc5A           -----------------------
3hdoB           -----------------------
3hdoA           -----------------------
3ei9B           -----------------------
3ei9A           -----------------------
3ei8A           -----------------------
2z1zA           -----------------------
3eiaB           -----------------------
3eiaA           -----------------------
3ei7B           -----------------------
3ei7A           -----------------------
3ei6B           -----------------------
3ei6A           -----------------------
2z20B           -----------------------
2z20A           -----------------------
3dr7B           -----------------------
3dr4D           -----------------------
3dr4C           -----------------------
3dr4B           -----------------------
3dr4A           -----------------------
3bn1D           -----------------------
3bn1C           -----------------------
3bn1A           -----------------------
1d2fB           -----------------------
1d2fA           -----------------------