[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for halo0:AAG19034.1

[Show Plain Result]


## Summary of Sequence Search
    1::373
    3::371     3e-65  39%  375 aa  AAT1_METJA RecName: Full=Probable aspartate aminotransferase 1;    
   10::386     8e-60  37%  391 aa  AAT_PYRHO RecName: Full=Aspartate aminotransferase;       
    4::379     3e-57  36%  389 aa  AAT_PYRAB RecName: Full=Aspartate aminotransferase;       
    2::383     2e-54  42%  393 aa  AAT_BACST RecName: Full=Aspartate aminotransferase;       
   26::383     1e-53  37%  393 aa  AAT1_BACSU RecName: Full=Aspartate aminotransferase;       
   15::376     3e-53  36%  383 aa  AAT_THEAQ RecName: Full=Aspartate aminotransferase;       
   28::385     2e-52  36%  392 aa  AAT_BACY2 RecName: Full=Aspartate aminotransferase;       
   29::390     2e-50  38%  394 aa  AAT_AQUAE RecName: Full=Aspartate aminotransferase;       
   15::388     1e-49  37%  400 aa  AATA_RHIME RecName: Full=Aspartate aminotransferase A;       
   27::329     3e-49  39%  397 aa  AAT_STRVG RecName: Full=Aspartate aminotransferase;       
   15::376     5e-49  35%  385 aa  AAT_THET8 RecName: Full=Aspartate aminotransferase;       
    4::378     1e-48  35%  389 aa  AAT_SYNY3 RecName: Full=Aspartate aminotransferase;       
   15::405     3e-48  36%  410 aa  AATB1_RHIME RecName: Full=Aspartate aminotransferase B;       
   15::405     1e-47  39%  410 aa  AATB2_RHIME RecName: Full=Aspartate aminotransferase B;       
   26::390     1e-45  35%  399 aa  AAT_SULTO RecName: Full=Aspartate aminotransferase;       
   38::332     3e-45  36%  402 aa  AAT_SULSO RecName: Full=Aspartate aminotransferase;       
   26::390     6e-45  34%  400 aa  AAT_SULAC RecName: Full=Aspartate aminotransferase;       
   28::378     7e-45  31%  390 aa  DAPAT_CARHZ RecName: Full=LL-diaminopimelate aminotransferase;     
    8::373     9e-45  33%  393 aa  PATA_BACSU RecName: Full=Putative aminotransferase A;       
   29::399     2e-44  35%  399 aa  AAT_RICBR RecName: Full=Aspartate aminotransferase;       
   15::388     2e-43  35%  400 aa  AAT_RHILP RecName: Full=Aspartate aminotransferase;       
   29::382     4e-43  28%  389 aa  DAPAT_HALOH RecName: Full=LL-diaminopimelate aminotransferase;     
    3::368     3e-42  33%  377 aa  AAT_THEMA RecName: Full=Aspartate aminotransferase;       
   29::388     1e-40  34%  409 aa  AAT_RICFE RecName: Full=Aspartate aminotransferase;       
    1::388     1e-40  33%  401 aa  AAT_RICCN RecName: Full=Aspartate aminotransferase;       
   20::384     2e-39  32%  388 aa  DAPAT_SYNFM RecName: Full=LL-diaminopimelate aminotransferase;     
   29::388     5e-39  33%  399 aa  AAT_RICPR RecName: Full=Aspartate aminotransferase;       
   29::388     6e-39  33%  399 aa  AAT_RICTY RecName: Full=Aspartate aminotransferase;       
   22::385     7e-38  30%  390 aa  DAPT2_ANASP RecName: Full=LL-diaminopimelate aminotransferase 2;   
   29::332     7e-38  32%  390 aa  DAPAT_MOOTA RecName: Full=LL-diaminopimelate aminotransferase;     
   27::386     7e-38  32%  392 aa  DAPAT_GLOVI RecName: Full=LL-diaminopimelate aminotransferase;     
   15::362     1e-37  29%  370 aa  AAT2_METJA RecName: Full=Probable aspartate aminotransferase 2;    
   22::333     9e-37  28%  390 aa  DAPT2_ANAVT RecName: Full=LL-diaminopimelate aminotransferase 2;   
   16::332     5e-36  29%  388 aa  DAPAT_DEHSB RecName: Full=LL-diaminopimelate aminotransferase;     
   29::379     6e-36  33%  398 aa  MTNE_BACSU RecName: Full=Transaminase mtnE;         EC=2.6.1.-;
   29::346     1e-35  32%  424 aa  KAT1_MOUSE RecName: Full=Kynurenine--oxoglutarate transaminase 1;  
   16::332     1e-35  29%  388 aa  DAPAT_DEHSC RecName: Full=LL-diaminopimelate aminotransferase;     
   63::380     3e-35  32%  457 aa  KAT1_RAT RecName: Full=Kynurenine--oxoglutarate transaminase 1,
    1::382     4e-35  28%  388 aa  DAPAT_DESAD RecName: Full=LL-diaminopimelate aminotransferase;     
   16::332     2e-34  28%  388 aa  DAPAT_DEHE1 RecName: Full=LL-diaminopimelate aminotransferase;     
   18::380     2e-34  28%  405 aa  AATC_RHIME RecName: Full=Putative aminotransferase aatC;       
   58::305     6e-34  34%  450 aa  KAT3_DANRE RecName: Full=Kynurenine--oxoglutarate transaminase 3;  
   39::351     1e-33  31%  435 aa  KAT_DICDI RecName: Full=Kynurenine--oxoglutarate transaminase;     
   60::383     5e-33  29%  454 aa  KAT3_RAT RecName: Full=Kynurenine--oxoglutarate transaminase 3;    
   26::379     5e-33  29%  386 aa  DAPAT_NATTJ RecName: Full=LL-diaminopimelate aminotransferase;     
    1::382     6e-33  28%  388 aa  DAPAT_DESDG RecName: Full=LL-diaminopimelate aminotransferase;     
   60::377     1e-32  29%  454 aa  KAT3_HUMAN RecName: Full=Kynurenine--oxoglutarate transaminase 3;  
    5::382     2e-32  29%  388 aa  DAPAT_DESVH RecName: Full=LL-diaminopimelate aminotransferase;     
    5::382     3e-32  29%  388 aa  DAPAT_DESVV RecName: Full=LL-diaminopimelate aminotransferase;     
   61::378     7e-32  29%  455 aa  KAT3_MOUSE RecName: Full=Kynurenine--oxoglutarate transaminase 3;  
   60::372     7e-32  29%  455 aa  KAT3_BOVIN RecName: Full=Kynurenine--oxoglutarate transaminase 3;  
   30::333     9e-32  30%  387 aa  DAPAT_AQUAE RecName: Full=LL-diaminopimelate aminotransferase;     
   25::346     3e-31  30%  422 aa  KAT1_HUMAN RecName: Full=Kynurenine--oxoglutarate transaminase 1;  
   38::213     2e-29  42%  213 aa  AAT_STRGR RecName: Full=Probable aspartate aminotransferase;       
    5::383     2e-29  28%  389 aa  DAPAT_DESVM RecName: Full=LL-diaminopimelate aminotransferase;     
   28::381     2e-29  27%  399 aa  AAT2_BACSU RecName: Full=Probable aspartate aminotransferase;      
   27::323     4e-29  29%  386 aa  YBDL_ECOLI RecName: Full=Aminotransferase ybdL;         EC=2.6.1.-;
   35::384     9e-29  26%  393 aa  AAT3_BACSU RecName: Full=Putative aspartate aminotransferase yhdR; 
   35::392     2e-28  27%  412 aa  YFDZ_ECOLI RecName: Full=Uncharacterized aminotransferase yfdZ;    
   53::283     2e-25  29%  444 aa  BNA3_YEAST RecName: Full=Probable kynurenine--oxoglutarate
   50::361     3e-25  29%  429 aa  AAT_MYCTU RecName: Full=Probable aspartate aminotransferase;       
   50::361     3e-25  29%  429 aa  AAT_MYCBO RecName: Full=Probable aspartate aminotransferase;       
   74::375     1e-24  27%  454 aa  ATTY_MOUSE RecName: Full=Tyrosine aminotransferase;       
   28::333     2e-24  31%  392 aa  DAPAT_DESAP RecName: Full=LL-diaminopimelate aminotransferase;     
   74::375     4e-24  27%  454 aa  ATTY_RAT RecName: Full=Tyrosine aminotransferase;       
   45::346     9e-24  27%  416 aa  Y1527_METMP RecName: Full=Uncharacterized aminotransferase MMP1527;
   45::335     3e-23  27%  418 aa  Y1391_METJA RecName: Full=Uncharacterized aminotransferase MJ1391; 
   14::266     3e-23  29%  417 aa  ATTY_DICDI RecName: Full=Tyrosine aminotransferase;       
   74::375     1e-22  27%  454 aa  ATTY_HUMAN RecName: Full=Tyrosine aminotransferase;       
   29::252     2e-22  31%  404 aa  Y286_HAEIN RecName: Full=Uncharacterized aminotransferase HI0286;  
   29::252     2e-22  31%  405 aa  YFBQ_SHIFL RecName: Full=Uncharacterized aminotransferase yfbQ;    
   29::252     2e-22  31%  405 aa  YFBQ_ECOLI RecName: Full=Uncharacterized aminotransferase yfbQ;    
   29::252     2e-22  31%  405 aa  YFBQ_ECOL6 RecName: Full=Uncharacterized aminotransferase yfbQ;    
   67::368     4e-21  26%  447 aa  ATTY_BOVIN RecName: Full=Tyrosine aminotransferase;       
   61::408     2e-20  27%  416 aa  ATTY_TRYCR RecName: Full=Tyrosine aminotransferase;       
   77::257     3e-20  32%  378 aa  HIS8_AZOC5 RecName: Full=Histidinol-phosphate aminotransferase;    
   44::245     4e-20  34%  361 aa  HIS8_SILPO RecName: Full=Histidinol-phosphate aminotransferase;    
   20::315     4e-19  30%  364 aa  AAT_PYRKO RecName: Full=Aspartate aminotransferase;       
   72::242     7e-19  34%  352 aa  PATR_PROAC RecName: Full=Putative phenylalanine aminotransferase;  
   35::265     9e-19  28%  421 aa  YDT4_SCHPO RecName: Full=Uncharacterized aminotransferase
   46::232     1e-18  31%  361 aa  HIS8_UNCMA RecName: Full=Histidinol-phosphate aminotransferase;    
   73::256     1e-18  32%  378 aa  HIS8_BEII9 RecName: Full=Histidinol-phosphate aminotransferase;    
   48::239     2e-18  33%  359 aa  PATR_STRGG RecName: Full=Putative phenylalanine aminotransferase;  
   40::248     2e-18  33%  370 aa  HIS8_METS4 RecName: Full=Histidinol-phosphate aminotransferase;    
   77::246     2e-18  28%  358 aa  HIS8_CALS8 RecName: Full=Histidinol-phosphate aminotransferase;    
   17::248     3e-18  35%  360 aa  HIS8_HALMA RecName: Full=Histidinol-phosphate aminotransferase;    
   82::245     4e-18  34%  363 aa  HIS8_MAGSA RecName: Full=Histidinol-phosphate aminotransferase;    
   80::261     1e-17  31%  392 aa  HIS8_XANP2 RecName: Full=Histidinol-phosphate aminotransferase;    
   64::242     3e-17  33%  359 aa  HIS8_ROSDO RecName: Full=Histidinol-phosphate aminotransferase;    
   27::377     5e-17  25%  401 aa  Y104_SULSO RecName: Full=Uncharacterized aminotransferase SSO0104; 
   28::242     5e-17  34%  371 aa  HIS8_SPHAL RecName: Full=Histidinol-phosphate aminotransferase;    
   70::225     1e-16  34%  347 aa  PATR_MYCA9 RecName: Full=Putative phenylalanine aminotransferase;  
  122::474     2e-16  25%  484 aa  YISV_BACSU RecName: Full=Uncharacterized HTH-type transcriptional
   80::239     2e-16  34%  359 aa  PATR_STRCO RecName: Full=Putative phenylalanine aminotransferase;  
   41::249     2e-16  29%  368 aa  HIS81_RHIME RecName: Full=Histidinol-phosphate aminotransferase 1; 
   40::248     2e-16  30%  370 aa  HIS8_METNO RecName: Full=Histidinol-phosphate aminotransferase;    
   79::248     3e-16  36%  351 aa  HIS8_RUBXD RecName: Full=Histidinol-phosphate aminotransferase;    
   29::248     4e-16  29%  369 aa  HIS8_ZYMMO RecName: Full=Histidinol-phosphate aminotransferase;    
   56::240     5e-16  34%  358 aa  PATR_RHOSR RecName: Full=Putative phenylalanine aminotransferase;  
   88::255     7e-16  35%  368 aa  HIS8_METFL RecName: Full=Histidinol-phosphate aminotransferase;    
   65::229     7e-16  34%  361 aa  HIS8_DINSH RecName: Full=Histidinol-phosphate aminotransferase;    
   82::314     7e-16  31%  366 aa  HIS82_RALEJ RecName: Full=Histidinol-phosphate aminotransferase 2; 
   69::234     9e-16  33%  357 aa  HIS8_PELLD RecName: Full=Histidinol-phosphate aminotransferase;    
   26::248     9e-16  28%  365 aa  HIS8_BRUME RecName: Full=Histidinol-phosphate aminotransferase;    
   65::243     1e-15  33%  362 aa  HIS8_SILST RecName: Full=Histidinol-phosphate aminotransferase;    
   26::248     1e-15  28%  365 aa  HIS8_BRUSU RecName: Full=Histidinol-phosphate aminotransferase;    
   26::248     1e-15  28%  365 aa  HIS8_BRUO2 RecName: Full=Histidinol-phosphate aminotransferase;    
   26::248     1e-15  28%  365 aa  HIS8_BRUAB RecName: Full=Histidinol-phosphate aminotransferase;    
   26::248     1e-15  28%  365 aa  HIS8_BRUA2 RecName: Full=Histidinol-phosphate aminotransferase;    
   89::235     2e-15  33%  359 aa  PATR_THEFY RecName: Full=Putative phenylalanine aminotransferase;  
   20::235     2e-15  33%  364 aa  HIS8_BURM1 RecName: Full=Histidinol-phosphate aminotransferase;    
  146::335     2e-15  30%  468 aa  YDCR_ECOLI RecName: Full=Uncharacterized HTH-type transcriptional
   48::239     3e-15  31%  359 aa  PATR_STRAW RecName: Full=Putative phenylalanine aminotransferase;  
   22::229     3e-15  31%  360 aa  HIS8_PROVI RecName: Full=Histidinol-phosphate aminotransferase;    
   40::248     3e-15  28%  366 aa  HIS8_MESSB RecName: Full=Histidinol-phosphate aminotransferase;    
   47::246     3e-15  30%  367 aa  HIS8_ERYLH RecName: Full=Histidinol-phosphate aminotransferase;    
   56::231     3e-15  36%  357 aa  HIS81_BURS3 RecName: Full=Histidinol-phosphate aminotransferase 1; 
   78::233     4e-15  29%  355 aa  HIS8_CHLL2 RecName: Full=Histidinol-phosphate aminotransferase;    
   76::237     6e-15  34%  372 aa  HIS8_NOVAD RecName: Full=Histidinol-phosphate aminotransferase;    
   26::252     8e-15  28%  368 aa  HIS8_METMA RecName: Full=Histidinol-phosphate aminotransferase;    
   72::240     1e-14  28%  358 aa  PATR_RHOE4 RecName: Full=Putative phenylalanine aminotransferase;  
   94::256     1e-14  30%  373 aa  HIS8_METJA RecName: Full=Histidinol-phosphate aminotransferase;    
   28::251     1e-14  26%  387 aa  CBL_BACSU RecName: Full=Cystathionine beta-lyase patB;       
   50::275     1e-14  29%  386 aa  HIS8_MOOTA RecName: Full=Histidinol-phosphate aminotransferase;    
   91::253     1e-14  30%  371 aa  HIS8_METM7 RecName: Full=Histidinol-phosphate aminotransferase;    
   87::236     1e-14  30%  367 aa  HIS8_HYPNA RecName: Full=Histidinol-phosphate aminotransferase;    
   38::229     2e-14  33%  351 aa  PATR_MYCVP RecName: Full=Putative phenylalanine aminotransferase;  
   38::229     2e-14  32%  361 aa  PATR_MYCS2 RecName: Full=Putative phenylalanine aminotransferase;  
   26::233     2e-14  29%  365 aa  HIS8_RHOP2 RecName: Full=Histidinol-phosphate aminotransferase;    
   87::251     2e-14  28%  371 aa  HIS8_ALKOO RecName: Full=Histidinol-phosphate aminotransferase;    
   78::233     2e-14  31%  355 aa  HIS8_PELPB RecName: Full=Histidinol-phosphate aminotransferase;    
    5::248     2e-14  31%  364 aa  HIS8_HALLT RecName: Full=Histidinol-phosphate aminotransferase;    
   67::228     3e-14  31%  353 aa  PATR_MYCTU RecName: Full=Putative phenylalanine aminotransferase;  
   67::228     3e-14  31%  353 aa  PATR_MYCTA RecName: Full=Putative phenylalanine aminotransferase;  
   67::228     3e-14  31%  353 aa  PATR_MYCBT RecName: Full=Putative phenylalanine aminotransferase;  
   67::228     3e-14  31%  353 aa  PATR_MYCBP RecName: Full=Putative phenylalanine aminotransferase;  
   67::228     3e-14  31%  353 aa  PATR_MYCBO RecName: Full=Putative phenylalanine aminotransferase;  
   27::246     3e-14  28%  365 aa  HIS8_RHOPB RecName: Full=Histidinol-phosphate aminotransferase;    
   91::253     3e-14  30%  371 aa  HIS8_METMP RecName: Full=Histidinol-phosphate aminotransferase;    
   81::244     3e-14  29%  362 aa  HIS8_MARMM RecName: Full=Histidinol-phosphate aminotransferase;    
   71::226     3e-14  31%  348 aa  HIS8_CHLTE RecName: Full=Histidinol-phosphate aminotransferase;    
   74::228     4e-14  31%  351 aa  HIS8_THETN RecName: Full=Histidinol-phosphate aminotransferase;    
   54::242     4e-14  27%  359 aa  HIS8_SALPK RecName: Full=Histidinol-phosphate aminotransferase;    
   54::242     4e-14  27%  359 aa  HIS8_SALPA RecName: Full=Histidinol-phosphate aminotransferase;    
   22::229     4e-14  27%  357 aa  HIS8_PROA2 RecName: Full=Histidinol-phosphate aminotransferase;    
    3::256     4e-14  31%  366 aa  HIS8_HALSA RecName: Full=Histidinol-phosphate aminotransferase;    
    3::256     4e-14  31%  366 aa  HIS8_HALS3 RecName: Full=Histidinol-phosphate aminotransferase;    
   48::280     4e-14  27%  360 aa  HIS8_ENTS8 RecName: Full=Histidinol-phosphate aminotransferase;    
   91::299     5e-14  35%  358 aa  PATR_RHOOB RecName: Full=Putative phenylalanine aminotransferase;  
   90::232     5e-14  34%  361 aa  HIS8_SYMTH RecName: Full=Histidinol-phosphate aminotransferase;    
   54::242     5e-14  27%  359 aa  HIS8_SALTY RecName: Full=Histidinol-phosphate aminotransferase;    
   54::242     5e-14  27%  359 aa  HIS8_SALSV RecName: Full=Histidinol-phosphate aminotransferase;    
   54::242     5e-14  27%  359 aa  HIS8_SALPC RecName: Full=Histidinol-phosphate aminotransferase;    
   54::242     5e-14  27%  359 aa  HIS8_SALHS RecName: Full=Histidinol-phosphate aminotransferase;    
   54::242     5e-14  27%  359 aa  HIS8_SALG2 RecName: Full=Histidinol-phosphate aminotransferase;    
   54::242     5e-14  27%  359 aa  HIS8_SALEP RecName: Full=Histidinol-phosphate aminotransferase;    
   54::242     5e-14  27%  359 aa  HIS8_SALDC RecName: Full=Histidinol-phosphate aminotransferase;    
   54::242     5e-14  27%  359 aa  HIS8_SALA4 RecName: Full=Histidinol-phosphate aminotransferase;    
   91::253     5e-14  30%  371 aa  HIS8_METVS RecName: Full=Histidinol-phosphate aminotransferase;    
   63::245     5e-14  33%  370 aa  HIS8_GRABC RecName: Full=Histidinol-phosphate aminotransferase;    
   84::234     5e-14  36%  365 aa  HIS82_BORPA RecName: Full=Histidinol-phosphate aminotransferase 2; 
   84::234     5e-14  36%  365 aa  HIS82_BORBR RecName: Full=Histidinol-phosphate aminotransferase 2; 
   54::242     7e-14  27%  359 aa  HIS8_SALCH RecName: Full=Histidinol-phosphate aminotransferase;    
   15::250     7e-14  27%  366 aa  HIS8_METBF RecName: Full=Histidinol-phosphate aminotransferase;    
   51::284     7e-14  26%  356 aa  HIS8_ECOSE RecName: Full=Histidinol-phosphate aminotransferase;    
   51::284     7e-14  26%  356 aa  HIS8_ECOLI RecName: Full=Histidinol-phosphate aminotransferase;    
   51::284     7e-14  26%  356 aa  HIS8_ECOHS RecName: Full=Histidinol-phosphate aminotransferase;    
   51::284     7e-14  26%  356 aa  HIS8_ECODH RecName: Full=Histidinol-phosphate aminotransferase;    
   51::284     7e-14  26%  356 aa  HIS8_ECOBW RecName: Full=Histidinol-phosphate aminotransferase;    
   51::284     7e-14  26%  356 aa  HIS8_ECO8A RecName: Full=Histidinol-phosphate aminotransferase;    
   67::236     7e-14  28%  350 aa  HIS81_ANAVT RecName: Full=Histidinol-phosphate aminotransferase 1; 
   91::253     9e-14  29%  371 aa  HIS8_METM5 RecName: Full=Histidinol-phosphate aminotransferase;    
   76::232     9e-14  29%  360 aa  HIS8_CHLPD RecName: Full=Histidinol-phosphate aminotransferase;    
   50::225     9e-14  28%  350 aa  HIS82_MANSM RecName: Full=Histidinol-phosphate aminotransferase 2; 
   84::234     9e-14  36%  365 aa  HIS82_BORPE RecName: Full=Histidinol-phosphate aminotransferase 2; 
   45::245     1e-13  31%  362 aa  HIS8_RHOCS RecName: Full=Histidinol-phosphate aminotransferase;    
   80::235     1e-13  29%  364 aa  HIS8_ACICJ RecName: Full=Histidinol-phosphate aminotransferase;    
   20::224     1e-13  29%  341 aa  PATR_CORGL RecName: Full=Probable phenylalanine aminotransferase;  
   52::240     1e-13  28%  382 aa  HIS8_YERPS RecName: Full=Histidinol-phosphate aminotransferase;    
   52::240     1e-13  28%  382 aa  HIS8_YERPB RecName: Full=Histidinol-phosphate aminotransferase;    
   51::284     1e-13  26%  356 aa  HIS8_SHIDS RecName: Full=Histidinol-phosphate aminotransferase;    
   51::284     1e-13  26%  356 aa  HIS8_SHIB3 RecName: Full=Histidinol-phosphate aminotransferase;    
   54::242     1e-13  27%  359 aa  HIS8_SALPB RecName: Full=Histidinol-phosphate aminotransferase;    
   54::242     1e-13  27%  359 aa  HIS8_SALNS RecName: Full=Histidinol-phosphate aminotransferase;    
   51::284     1e-13  26%  356 aa  HIS8_ECO27 RecName: Full=Histidinol-phosphate aminotransferase;    
  105::236     2e-13  35%  358 aa  PATR_MYCSS RecName: Full=Putative phenylalanine aminotransferase;  
  105::236     2e-13  35%  358 aa  PATR_MYCSK RecName: Full=Putative phenylalanine aminotransferase;  
  105::236     2e-13  35%  358 aa  PATR_MYCSJ RecName: Full=Putative phenylalanine aminotransferase;  
   36::224     2e-13  28%  341 aa  PATR_CORGB RecName: Full=Putative phenylalanine aminotransferase;  
   51::284     2e-13  26%  356 aa  HIS8_SHIBS RecName: Full=Histidinol-phosphate aminotransferase;    
   16::238     2e-13  29%  367 aa  HIS8_METAC RecName: Full=Histidinol-phosphate aminotransferase;    
   51::284     2e-13  26%  356 aa  HIS8_ECO55 RecName: Full=Histidinol-phosphate aminotransferase;    
   51::284     2e-13  26%  356 aa  HIS8_ECO24 RecName: Full=Histidinol-phosphate aminotransferase;    
   54::242     2e-13  27%  359 aa  HIS8_CITK8 RecName: Full=Histidinol-phosphate aminotransferase;    
   41::238     2e-13  28%  368 aa  HIS8_AGRT5 RecName: Full=Histidinol-phosphate aminotransferase;    
   51::284     3e-13  26%  356 aa  HIS8_SHISS RecName: Full=Histidinol-phosphate aminotransferase;    
   51::284     3e-13  26%  356 aa  HIS8_ECOLU RecName: Full=Histidinol-phosphate aminotransferase;    
   51::284     3e-13  26%  356 aa  HIS8_ECO5E RecName: Full=Histidinol-phosphate aminotransferase;    
   51::284     3e-13  26%  356 aa  HIS8_ECO57 RecName: Full=Histidinol-phosphate aminotransferase;    
   51::284     3e-13  26%  356 aa  HIS8_ECO45 RecName: Full=Histidinol-phosphate aminotransferase;    
   74::229     3e-13  29%  351 aa  HIS8_THEPX RecName: Full=Histidinol-phosphate aminotransferase;    
   74::229     3e-13  29%  351 aa  HIS8_THEP3 RecName: Full=Histidinol-phosphate aminotransferase;    
   51::284     3e-13  26%  356 aa  HIS8_SHIFL RecName: Full=Histidinol-phosphate aminotransferase;    
   51::284     3e-13  26%  356 aa  HIS8_SHIF8 RecName: Full=Histidinol-phosphate aminotransferase;    
   54::242     3e-13  27%  359 aa  HIS8_SALTI RecName: Full=Histidinol-phosphate aminotransferase;    
   50::233     3e-13  29%  368 aa  HIS8_RHORT RecName: Full=Histidinol-phosphate aminotransferase;    
   51::284     3e-13  26%  356 aa  HIS8_ECOLC RecName: Full=Histidinol-phosphate aminotransferase;    
   52::240     4e-13  28%  382 aa  HIS8_YERPY RecName: Full=Histidinol-phosphate aminotransferase;    
   52::240     4e-13  28%  382 aa  HIS8_YERPP RecName: Full=Histidinol-phosphate aminotransferase;    
   52::240     4e-13  28%  382 aa  HIS8_YERPN RecName: Full=Histidinol-phosphate aminotransferase;    
   52::240     4e-13  28%  382 aa  HIS8_YERPG RecName: Full=Histidinol-phosphate aminotransferase;    
   52::240     4e-13  28%  382 aa  HIS8_YERPE RecName: Full=Histidinol-phosphate aminotransferase;    
   52::240     4e-13  28%  382 aa  HIS8_YERPA RecName: Full=Histidinol-phosphate aminotransferase;    
   52::240     4e-13  28%  382 aa  HIS8_YERP3 RecName: Full=Histidinol-phosphate aminotransferase;    
   38::233     4e-13  28%  365 aa  HIS8_RHOP5 RecName: Full=Histidinol-phosphate aminotransferase;    
   88::245     4e-13  27%  373 aa  HIS82_THICR RecName: Full=Histidinol-phosphate aminotransferase 2; 
   54::242     6e-13  27%  359 aa  HIS8_SALAR RecName: Full=Histidinol-phosphate aminotransferase;    
   51::284     6e-13  26%  356 aa  HIS8_ECOUT RecName: Full=Histidinol-phosphate aminotransferase;    
   51::284     6e-13  26%  356 aa  HIS8_ECOL6 RecName: Full=Histidinol-phosphate aminotransferase;    
   51::284     6e-13  26%  356 aa  HIS8_ECOL5 RecName: Full=Histidinol-phosphate aminotransferase;    
   51::284     6e-13  26%  356 aa  HIS8_ECO81 RecName: Full=Histidinol-phosphate aminotransferase;    
   48::235     6e-13  27%  351 aa  HIS81_PASMU RecName: Full=Histidinol-phosphate aminotransferase 1; 
   77::245     7e-13  28%  358 aa  PATR_NOCFA RecName: Full=Putative phenylalanine aminotransferase;  
   24::232     7e-13  26%  361 aa  PATR_MYCMM RecName: Full=Putative phenylalanine aminotransferase;  
   48::281     7e-13  26%  353 aa  HIS8_ENT38 RecName: Full=Histidinol-phosphate aminotransferase;    
   24::232     1e-12  26%  361 aa  PATR_MYCUA RecName: Full=Putative phenylalanine aminotransferase;  
   71::228     1e-12  32%  355 aa  PATR_MYCPA RecName: Full=Putative phenylalanine aminotransferase;  
   71::228     1e-12  32%  355 aa  PATR_MYCA1 RecName: Full=Putative phenylalanine aminotransferase;  
   91::243     1e-12  30%  363 aa  HIS8_AKKM8 RecName: Full=Histidinol-phosphate aminotransferase;    
   80::229     1e-12  25%  360 aa  HIS8_PELUB RecName: Full=Histidinol-phosphate aminotransferase;    
   41::248     1e-12  28%  376 aa  HIS8_HALWD RecName: Full=Histidinol-phosphate aminotransferase;    
   28::221     2e-12  31%  367 aa  HIS8_PARDP RecName: Full=Histidinol-phosphate aminotransferase;    
   51::284     2e-12  25%  356 aa  HIS8_ECO7I RecName: Full=Histidinol-phosphate aminotransferase;    
   78::229     2e-12  30%  355 aa  HIS8_CHLP8 RecName: Full=Histidinol-phosphate aminotransferase;    
   36::253     2e-12  26%  365 aa  HIS82_PASMU RecName: Full=Histidinol-phosphate aminotransferase 2; 
   52::240     2e-12  28%  374 aa  HIS8_YERE8 RecName: Full=Histidinol-phosphate aminotransferase;    
   38::233     2e-12  28%  365 aa  HIS8_RHOPT RecName: Full=Histidinol-phosphate aminotransferase;    
   38::233     2e-12  28%  365 aa  HIS8_RHOPA RecName: Full=Histidinol-phosphate aminotransferase;    
    7::247     2e-12  26%  366 aa  HIS8_METS3 RecName: Full=Histidinol-phosphate aminotransferase;    
   48::236     2e-12  28%  353 aa  HIS8_KLEP3 RecName: Full=Histidinol-phosphate aminotransferase;    
   51::284     2e-12  26%  356 aa  HIS8_ECOSM RecName: Full=Histidinol-phosphate aminotransferase;    
   20::225     3e-12  27%  342 aa  PATR_COREF RecName: Full=Putative phenylalanine aminotransferase;  
   26::246     3e-12  26%  365 aa  HIS8_NITWN RecName: Full=Histidinol-phosphate aminotransferase;    
   91::253     3e-12  29%  371 aa  HIS8_META3 RecName: Full=Histidinol-phosphate aminotransferase;    
   49::237     3e-12  28%  357 aa  HIS8_ERWCT RecName: Full=Histidinol-phosphate aminotransferase;    
   38::246     3e-12  27%  365 aa  HIS82_BRAJA RecName: Full=Histidinol-phosphate aminotransferase 2; 
   46::236     3e-12  27%  352 aa  HIS81_HAEI8 RecName: Full=Histidinol-phosphate aminotransferase 1; 
   36::247     3e-12  26%  394 aa  DAPAT_CHLTB RecName: Full=LL-diaminopimelate aminotransferase;     
   36::247     3e-12  26%  394 aa  DAPAT_CHLT2 RecName: Full=LL-diaminopimelate aminotransferase;     
   49::237     4e-12  28%  357 aa  HIS8_PECCP RecName: Full=Histidinol-phosphate aminotransferase;    
   13::236     4e-12  24%  350 aa  HIS8_MACCJ RecName: Full=Histidinol-phosphate aminotransferase;    
   51::284     4e-12  25%  356 aa  HIS8_ESCF3 RecName: Full=Histidinol-phosphate aminotransferase;    
   88::231     4e-12  36%  356 aa  HIS8_CHRVO RecName: Full=Histidinol-phosphate aminotransferase;    
   53::198     4e-12  31%  319 aa  HIS81_ARCFU RecName: Full=Histidinol-phosphate aminotransferase 1; 
   81::236     4e-12  30%  353 aa  HIS81_ANASP RecName: Full=Histidinol-phosphate aminotransferase 1; 
   69::242     5e-12  28%  352 aa  HIS8_STAAW RecName: Full=Histidinol-phosphate aminotransferase;    
   69::242     5e-12  28%  352 aa  HIS8_STAAS RecName: Full=Histidinol-phosphate aminotransferase;    
   46::236     5e-12  27%  352 aa  HIS8_HAEIG RecName: Full=Histidinol-phosphate aminotransferase;    
   46::236     5e-12  27%  352 aa  HIS8_HAEIE RecName: Full=Histidinol-phosphate aminotransferase;    
   51::284     5e-12  25%  356 aa  HIS8_ECOK1 RecName: Full=Histidinol-phosphate aminotransferase;    
   36::256     5e-12  24%  373 aa  HIS82_NITEU RecName: Full=Histidinol-phosphate aminotransferase 2; 
   46::320     5e-12  28%  374 aa  HIS81_RALSO RecName: Full=Histidinol-phosphate aminotransferase 1; 
   61::251     5e-12  27%  367 aa  HIS81_HAEIN RecName: Full=Histidinol-phosphate aminotransferase 1; 
   48::236     6e-12  28%  353 aa  HIS8_KLEP7 RecName: Full=Histidinol-phosphate aminotransferase;    
   78::290     6e-12  26%  363 aa  HIS8_CHLCH RecName: Full=Histidinol-phosphate aminotransferase;    
   26::301     8e-12  28%  361 aa  PATR_LEIXX RecName: Full=Putative phenylalanine aminotransferase;  
   57::244     8e-12  27%  356 aa  HIS8_LACPL RecName: Full=Histidinol-phosphate aminotransferase;    
   51::263     8e-12  26%  379 aa  HIS8_DESPS RecName: Full=Histidinol-phosphate aminotransferase;    
   29::238     8e-12  24%  371 aa  HIS8_ANOFW RecName: Full=Histidinol-phosphate aminotransferase;    
   36::247     8e-12  26%  394 aa  DAPAT_CHLTR RecName: Full=LL-diaminopimelate aminotransferase;     
   36::247     8e-12  26%  394 aa  DAPAT_CHLTA RecName: Full=LL-diaminopimelate aminotransferase;     
  115::339     8e-12  30%  505 aa  ALAT_SCHPO RecName: Full=Putative alanine aminotransferase;        
   78::233     1e-11  26%  357 aa  HIS8_LEUMM RecName: Full=Histidinol-phosphate aminotransferase;    
  102::262     1e-11  29%  376 aa  HIS81_RALEJ RecName: Full=Histidinol-phosphate aminotransferase 1; 
   35::405     1e-11  26%  409 aa  DAPAT_BACV8 RecName: Full=LL-diaminopimelate aminotransferase;     
   70::224     1e-11  32%  344 aa  PATR_CORDI RecName: Full=Putative phenylalanine aminotransferase;  
   69::242     1e-11  26%  352 aa  HIS8_STAAR RecName: Full=Histidinol-phosphate aminotransferase;    
   78::238     1e-11  25%  354 aa  HIS8_LEUCK RecName: Full=Histidinol-phosphate aminotransferase;    
    9::259     1e-11  28%  372 aa  HIS8_COREF RecName: Full=Histidinol-phosphate aminotransferase;    
   52::251     1e-11  28%  369 aa  HIS82_RHILO RecName: Full=Histidinol-phosphate aminotransferase 2; 
  103::262     1e-11  27%  380 aa  HIS81_PSYA2 RecName: Full=Histidinol-phosphate aminotransferase 1; 
   22::397     1e-11  22%  402 aa  CBL_MYCLE RecName: Full=Putative cystathionine beta-lyase;       
   75::229     2e-11  30%  340 aa  HIS8_THEGJ RecName: Full=Histidinol-phosphate aminotransferase;    
   38::233     2e-11  28%  365 aa  HIS8_RHOPS RecName: Full=Histidinol-phosphate aminotransferase;    
   26::233     2e-11  27%  365 aa  HIS8_NITHX RecName: Full=Histidinol-phosphate aminotransferase;    
   36::253     2e-11  25%  366 aa  HIS81_MANSM RecName: Full=Histidinol-phosphate aminotransferase 1; 
   27::407     2e-11  30%  408 aa  DAPAT_SYNPW RecName: Full=LL-diaminopimelate aminotransferase;     
  216::378     2e-11  29%  592 aa  ALAM_YEAST RecName: Full=Probable alanine aminotransferase,
   69::242     2e-11  26%  352 aa  HIS8_STAAT RecName: Full=Histidinol-phosphate aminotransferase;    
   69::242     2e-11  26%  352 aa  HIS8_STAAN RecName: Full=Histidinol-phosphate aminotransferase;    
   69::242     2e-11  26%  352 aa  HIS8_STAAM RecName: Full=Histidinol-phosphate aminotransferase;    
   69::242     2e-11  26%  352 aa  HIS8_STAAE RecName: Full=Histidinol-phosphate aminotransferase;    
   69::242     2e-11  26%  352 aa  HIS8_STAAC RecName: Full=Histidinol-phosphate aminotransferase;    
   69::242     2e-11  26%  352 aa  HIS8_STAAB RecName: Full=Histidinol-phosphate aminotransferase;    
   69::242     2e-11  26%  352 aa  HIS8_STAA9 RecName: Full=Histidinol-phosphate aminotransferase;    
   69::242     2e-11  26%  352 aa  HIS8_STAA8 RecName: Full=Histidinol-phosphate aminotransferase;    
   69::242     2e-11  26%  352 aa  HIS8_STAA3 RecName: Full=Histidinol-phosphate aminotransferase;    
   69::242     2e-11  26%  352 aa  HIS8_STAA2 RecName: Full=Histidinol-phosphate aminotransferase;    
   69::242     2e-11  26%  352 aa  HIS8_STAA1 RecName: Full=Histidinol-phosphate aminotransferase;    
   71::229     2e-11  29%  336 aa  HIS8_PYRKO RecName: Full=Histidinol-phosphate aminotransferase;    
   67::300     2e-11  31%  350 aa  HIS8_GEOBB RecName: Full=Histidinol-phosphate aminotransferase;    
   35::222     2e-11  30%  369 aa  HIS83_RHILO RecName: Full=Histidinol-phosphate aminotransferase 3; 
   27::402     2e-11  28%  408 aa  DAPAT_SYNS9 RecName: Full=LL-diaminopimelate aminotransferase;     
  492::680     3e-11  27%  807 aa  HIS8_PHOLL RecName: Full=Putative histidine biosynthesis
    8::247     3e-11  24%  367 aa  HIS8_METST RecName: Full=Histidinol-phosphate aminotransferase;    
   75::249     3e-11  30%  360 aa  HIS8_METBU RecName: Full=Histidinol-phosphate aminotransferase;    
   43::300     3e-11  30%  350 aa  HIS8_GEOSM RecName: Full=Histidinol-phosphate aminotransferase;    
   22::254     3e-11  31%  374 aa  HIS82_RALSO RecName: Full=Histidinol-phosphate aminotransferase 2; 
   76::255     3e-11  29%  392 aa  HIS82_NITMU RecName: Full=Histidinol-phosphate aminotransferase 2; 
   81::243     4e-11  30%  363 aa  HIS8_HAHCH RecName: Full=Histidinol-phosphate aminotransferase;    
   96::256     4e-11  26%  367 aa  HIS81_IDILO RecName: Full=Histidinol-phosphate aminotransferase 1; 
   79::249     5e-11  26%  364 aa  HIS8_BREBN RecName: Full=Histidinol-phosphate aminotransferase;    
   73::307     5e-11  27%  370 aa  HIS83_BURS3 RecName: Full=Histidinol-phosphate aminotransferase 3; 
   79::244     5e-11  31%  384 aa  HIS81_THIDA RecName: Full=Histidinol-phosphate aminotransferase 1; 
  129::300     7e-11  27%  413 aa  HIS8_TOBAC RecName: Full=Histidinol-phosphate aminotransferase,
   63::244     7e-11  31%  366 aa  HIS8_LYSSC RecName: Full=Histidinol-phosphate aminotransferase;    
   54::254     7e-11  28%  370 aa  HIS81_NITOC RecName: Full=Histidinol-phosphate aminotransferase 1; 
   67::233     9e-11  26%  346 aa  HIS8_VIBFM RecName: Full=Histidinol-phosphate aminotransferase;    
   44::242     9e-11  29%  351 aa  HIS8_STAS1 RecName: Full=Histidinol-phosphate aminotransferase;    
   28::219     9e-11  27%  361 aa  HIS8_RHOS1 RecName: Full=Histidinol-phosphate aminotransferase;    
  129::300     9e-11  27%  413 aa  HIS8_NICPL RecName: Full=Histidinol-phosphate aminotransferase,
   60::238     9e-11  24%  356 aa  HIS8_CLONN RecName: Full=Histidinol-phosphate aminotransferase;    
   29::239     9e-11  25%  360 aa  HIS8_BACA2 RecName: Full=Histidinol-phosphate aminotransferase;    
   59::242     9e-11  25%  362 aa  HIS82_CARHZ RecName: Full=Histidinol-phosphate aminotransferase 2; 
   35::404     9e-11  26%  410 aa  DAPAT_BACFR RecName: Full=LL-diaminopimelate aminotransferase;     
  161::325     1e-10  26%  470 aa  YJIR_ECOLI RecName: Full=Uncharacterized HTH-type transcriptional
   48::233     1e-10  26%  346 aa  HIS8_VIBPA RecName: Full=Histidinol-phosphate aminotransferase;    
   59::242     1e-10  27%  351 aa  HIS8_STAHJ RecName: Full=Histidinol-phosphate aminotransferase;    
   25::299     1e-10  28%  362 aa  HIS8_RHOBA RecName: Full=Histidinol-phosphate aminotransferase;    
   80::248     1e-10  28%  361 aa  HIS8_HALVO RecName: Full=Histidinol-phosphate aminotransferase;    
  148::425     1e-10  26%  495 aa  1A112_ARATH RecName: Full=Probable aminotransferase ACS12;       
  151::343     2e-10  27%  493 aa  MOCR_RHIME RecName: Full=Probable rhizopine catabolism regulatory
   69::242     2e-10  26%  351 aa  HIS8_STAES RecName: Full=Histidinol-phosphate aminotransferase;    
   69::242     2e-10  26%  351 aa  HIS8_STAEQ RecName: Full=Histidinol-phosphate aminotransferase;    
   77::244     2e-10  27%  369 aa  HIS8_BACHD RecName: Full=Histidinol-phosphate aminotransferase;    
   61::287     2e-10  25%  356 aa  HIS8_ACEPA RecName: Full=Histidinol-phosphate aminotransferase;    
   74::311     2e-10  26%  371 aa  HIS82_METCA RecName: Full=Histidinol-phosphate aminotransferase 2; 
   27::407     2e-10  28%  408 aa  DAPAT_SYNR3 RecName: Full=LL-diaminopimelate aminotransferase;     
   35::404     2e-10  26%  410 aa  DAPAT_BACFN RecName: Full=LL-diaminopimelate aminotransferase;     
   48::233     3e-10  26%  346 aa  HIS8_VIBCM RecName: Full=Histidinol-phosphate aminotransferase;    
   48::233     3e-10  26%  346 aa  HIS8_VIBC3 RecName: Full=Histidinol-phosphate aminotransferase;    
   46::314     3e-10  24%  376 aa  HIS8_SULSO RecName: Full=Histidinol-phosphate aminotransferase;    
   28::195     3e-10  27%  361 aa  HIS8_RHOS5 RecName: Full=Histidinol-phosphate aminotransferase;    
   38::234     3e-10  26%  368 aa  HIS8_RHISN RecName: Full=Histidinol-phosphate aminotransferase;    
   30::167     3e-10  36%  379 aa  ARNB_ESCF3 RecName:
  101::371     3e-10  25%  482 aa  ALA2_PANMI RecName: Full=Alanine aminotransferase 2;       
   48::233     3e-10  26%  346 aa  HIS8_VIBCH RecName: Full=Histidinol-phosphate aminotransferase;    
   28::219     3e-10  27%  361 aa  HIS8_RHOSK RecName: Full=Histidinol-phosphate aminotransferase;    
   28::219     3e-10  27%  361 aa  HIS8_RHOS4 RecName: Full=Histidinol-phosphate aminotransferase;    
   80::249     3e-10  28%  364 aa  HIS8_ANADF RecName: Full=Histidinol-phosphate aminotransferase;    
  164::328     3e-10  25%  534 aa  ALAM_DICDI RecName: Full=Probable alanine aminotransferase,
   68::233     4e-10  26%  346 aa  HIS8_VIBVY RecName: Full=Histidinol-phosphate aminotransferase;    
   68::233     4e-10  26%  346 aa  HIS8_VIBHB RecName: Full=Histidinol-phosphate aminotransferase;    
   49::243     4e-10  29%  371 aa  HIS8_METPP RecName: Full=Histidinol-phosphate aminotransferase;    
   81::265     4e-10  27%  383 aa  HIS8_DESDG RecName: Full=Histidinol-phosphate aminotransferase;    
   27::402     4e-10  26%  411 aa  DAPT1_ANAVT RecName: Full=LL-diaminopimelate aminotransferase 1;   
   25::407     4e-10  28%  409 aa  DAPAT_ACAM1 RecName: Full=LL-diaminopimelate aminotransferase;     
   89::266     4e-10  28%  482 aa  ALA2_HORVU RecName: Full=Alanine aminotransferase 2;       
   75::229     6e-10  28%  338 aa  HIS8_PYRFU RecName: Full=Histidinol-phosphate aminotransferase;    
   68::238     8e-10  26%  365 aa  HIS8_GEOTN RecName: Full=Histidinol-phosphate aminotransferase;    
   74::258     8e-10  26%  373 aa  HIS8_DESVV RecName: Full=Histidinol-phosphate aminotransferase;    
   74::258     8e-10  26%  373 aa  HIS8_DESVH RecName: Full=Histidinol-phosphate aminotransferase;    
   89::256     8e-10  27%  372 aa  HIS8_BDEBA RecName: Full=Histidinol-phosphate aminotransferase;    
   37::411     8e-10  28%  411 aa  DAPAT_SYNP6 RecName: Full=LL-diaminopimelate aminotransferase;     
   37::411     8e-10  28%  411 aa  DAPAT_SYNE7 RecName: Full=LL-diaminopimelate aminotransferase;     
   36::247     8e-10  27%  393 aa  DAPAT_CHLMU RecName: Full=LL-diaminopimelate aminotransferase;     
    5::247     8e-10  26%  398 aa  DAPAT_CHLAB RecName: Full=LL-diaminopimelate aminotransferase;     
   26::254     1e-09  27%  373 aa  HIS8_METTH RecName: Full=Histidinol-phosphate aminotransferase;    
   32::239     1e-09  29%  365 aa  HIS8_BACP2 RecName: Full=Histidinol-phosphate aminotransferase;    
   89::218     1e-09  33%  360 aa  HIS82_NITOC RecName: Full=Histidinol-phosphate aminotransferase 2; 
   83::303     1e-09  25%  359 aa  HIS81_CAUCR RecName: Full=Histidinol-phosphate aminotransferase 1; 
   95::280     1e-09  32%  496 aa  ALAT1_HUMAN RecName: Full=Alanine aminotransferase 1;       
   48::236     1e-09  26%  362 aa  HIS8_SERP5 RecName: Full=Histidinol-phosphate aminotransferase;    
   84::238     1e-09  28%  360 aa  HIS8_LISW6 RecName: Full=Histidinol-phosphate aminotransferase;    
   26::243     1e-09  26%  365 aa  HIS8_CAMC5 RecName: Full=Histidinol-phosphate aminotransferase;    
   35::306     1e-09  26%  356 aa  HIS81_BURPS RecName: Full=Histidinol-phosphate aminotransferase 1; 
   35::306     1e-09  26%  356 aa  HIS81_BURP1 RecName: Full=Histidinol-phosphate aminotransferase 1; 
   27::402     1e-09  26%  411 aa  DAPT1_ANASP RecName: Full=LL-diaminopimelate aminotransferase 1;   
   27::403     1e-09  26%  411 aa  DAPAT_MICAN RecName: Full=LL-diaminopimelate aminotransferase;     
   34::404     1e-09  25%  410 aa  DAPAT_BACTN RecName: Full=LL-diaminopimelate aminotransferase;     
   68::233     2e-09  25%  346 aa  HIS8_VIBF1 RecName: Full=Histidinol-phosphate aminotransferase;    
   84::244     2e-09  27%  360 aa  HIS8_LISMF RecName: Full=Histidinol-phosphate aminotransferase;    
   84::244     2e-09  27%  360 aa  HIS8_LISMC RecName: Full=Histidinol-phosphate aminotransferase;    
   32::235     2e-09  28%  361 aa  HIS8_LACF3 RecName: Full=Histidinol-phosphate aminotransferase;    
   83::238     2e-09  24%  354 aa  HIS8_STACT RecName: Full=Histidinol-phosphate aminotransferase;    
   73::232     2e-09  29%  348 aa  HIS8_MICAN RecName: Full=Histidinol-phosphate aminotransferase;    
   84::244     2e-09  27%  360 aa  HIS8_LISMH RecName: Full=Histidinol-phosphate aminotransferase;    
   86::229     2e-09  26%  358 aa  HIS8_DEHE1 RecName: Full=Histidinol-phosphate aminotransferase;    
   24::232     2e-09  27%  348 aa  HIS8_CYAP8 RecName: Full=Histidinol-phosphate aminotransferase;    
  133::304     2e-09  25%  417 aa  HIS8_ARATH RecName: Full=Histidinol-phosphate aminotransferase,
   78::256     3e-09  28%  374 aa  HIS8_METI4 RecName: Full=Histidinol-phosphate aminotransferase;    
   85::302     3e-09  24%  353 aa  HIS8_MARMS RecName: Full=Histidinol-phosphate aminotransferase;    
   75::236     3e-09  25%  360 aa  HIS8_BUCBP RecName: Full=Histidinol-phosphate aminotransferase;    
   64::241     3e-09  24%  361 aa  HIS8_BACLD RecName: Full=Histidinol-phosphate aminotransferase;    
  122::311     3e-09  26%  522 aa  ALAT2_MOUSE RecName: Full=Alanine aminotransferase 2;       
   68::233     4e-09  25%  346 aa  HIS8_VIBVU RecName: Full=Histidinol-phosphate aminotransferase;    
   19::239     4e-09  23%  360 aa  HIS8_BACSU RecName: Full=Histidinol-phosphate aminotransferase;    
   19::239     4e-09  23%  360 aa  HIS8_BACNA RecName: Full=Histidinol-phosphate aminotransferase;    
   13::167     4e-09  33%  356 aa  HIS82_BURPS RecName: Full=Histidinol-phosphate aminotransferase 2; 
   13::167     4e-09  33%  356 aa  HIS82_BURP1 RecName: Full=Histidinol-phosphate aminotransferase 2; 
   88::253     4e-09  25%  362 aa  HIS81_DECAR RecName: Full=Histidinol-phosphate aminotransferase 1; 
   13::167     4e-09  33%  356 aa  HIS81_BURMA RecName: Full=Histidinol-phosphate aminotransferase 1; 
   27::257     4e-09  29%  408 aa  DAPAT_SYNSC RecName: Full=LL-diaminopimelate aminotransferase;     
   50::255     5e-09  21%  432 aa  Y1479_METJA RecName: Full=Uncharacterized aminotransferase MJ1479; 
   58::225     5e-09  25%  351 aa  HIS8_CLOK5 RecName: Full=Histidinol-phosphate aminotransferase;    
   58::225     5e-09  25%  351 aa  HIS8_CLOK1 RecName: Full=Histidinol-phosphate aminotransferase;    
   83::253     5e-09  23%  366 aa  HIS82_HAEIN RecName: Full=Histidinol-phosphate aminotransferase 2; 
   83::253     5e-09  23%  366 aa  HIS82_HAEI8 RecName: Full=Histidinol-phosphate aminotransferase 2; 
   93::271     5e-09  25%  401 aa  HIS81_GLUOX RecName: Full=Histidinol-phosphate aminotransferase 1; 
   72::260     6e-09  33%  380 aa  HIS8_RHOSR RecName: Full=Histidinol-phosphate aminotransferase;    
   77::223     6e-09  33%  347 aa  HIS8_GEOUR RecName: Full=Histidinol-phosphate aminotransferase;    
   77::297     6e-09  31%  347 aa  HIS8_GEOSF RecName: Full=Histidinol-phosphate aminotransferase;    
   38::234     6e-09  27%  361 aa  HIS8_FRAP2 RecName: Full=Histidinol-phosphate aminotransferase;    
   66::222     6e-09  28%  345 aa  HIS8_BACFN RecName: Full=Histidinol-phosphate aminotransferase;    
   94::253     6e-09  29%  377 aa  HIS82_PSYA2 RecName: Full=Histidinol-phosphate aminotransferase 2; 
   98::255     6e-09  28%  378 aa  HIS82_CAUCR RecName: Full=Histidinol-phosphate aminotransferase 2; 
   27::265     6e-09  32%  411 aa  DAPAT_GEOSM RecName: Full=LL-diaminopimelate aminotransferase;     
   27::265     6e-09  30%  411 aa  DAPAT_GEOBB RecName: Full=LL-diaminopimelate aminotransferase;     
   52::157     6e-09  36%  379 aa  ARNB_ERWT9 RecName:
   14::227     8e-09  27%  335 aa  HIS8_THEMA RecName: Full=Histidinol-phosphate aminotransferase;    
   71::222     8e-09  27%  349 aa  HIS8_STRMU RecName: Full=Histidinol-phosphate aminotransferase;    
   79::232     8e-09  30%  365 aa  HIS8_NEIMF RecName: Full=Histidinol-phosphate aminotransferase;    
   79::232     8e-09  30%  365 aa  HIS8_NEIMA RecName: Full=Histidinol-phosphate aminotransferase;    
   79::232     8e-09  30%  365 aa  HIS8_NEIM0 RecName: Full=Histidinol-phosphate aminotransferase;    
   44::232     8e-09  30%  352 aa  HIS8_METMJ RecName: Full=Histidinol-phosphate aminotransferase;    
   84::238     8e-09  27%  360 aa  HIS8_LISIN RecName: Full=Histidinol-phosphate aminotransferase;    
   81::229     8e-09  26%  358 aa  HIS8_DEHSC RecName: Full=Histidinol-phosphate aminotransferase;    
   81::229     8e-09  26%  358 aa  HIS8_DEHSB RecName: Full=Histidinol-phosphate aminotransferase;    
   61::234     8e-09  26%  358 aa  HIS8_CLOCE RecName: Full=Histidinol-phosphate aminotransferase;    
   97::257     8e-09  26%  370 aa  HIS82_PSEF5 RecName: Full=Histidinol-phosphate aminotransferase 2; 
   35::306     8e-09  26%  356 aa  HIS82_BURMA RecName: Full=Histidinol-phosphate aminotransferase 2; 
  192::414     1e-08  24%  482 aa  YDFD_BACSU RecName: Full=Uncharacterized HTH-type transcriptional
    7::224     1e-08  22%  286 aa  HIS8_SULTO RecName: Full=Histidinol-phosphate aminotransferase;    
   84::238     1e-08  26%  360 aa  HIS8_LISMO RecName: Full=Histidinol-phosphate aminotransferase;    
   66::222     1e-08  28%  345 aa  HIS8_BACFR RecName: Full=Histidinol-phosphate aminotransferase;    
   75::239     1e-08  27%  356 aa  HIS8_AZOSE RecName: Full=Histidinol-phosphate aminotransferase;    
   27::265     1e-08  32%  410 aa  DAPAT_GEOLS RecName: Full=LL-diaminopimelate aminotransferase;     
   14::227     1e-08  26%  335 aa  HIS8_THESQ RecName: Full=Histidinol-phosphate aminotransferase;    
   79::232     1e-08  30%  365 aa  HIS8_NEIMB RecName: Full=Histidinol-phosphate aminotransferase;    
    5::248     1e-08  29%  355 aa  HIS8_NATPD RecName: Full=Histidinol-phosphate aminotransferase;    
  149::253     1e-08  33%  371 aa  HIS8_METM6 RecName: Full=Histidinol-phosphate aminotransferase;    
   72::238     1e-08  25%  360 aa  HIS8_BAUCH RecName: Full=Histidinol-phosphate aminotransferase;    
   82::245     1e-08  25%  372 aa  HIS8_ARTAT RecName: Full=Histidinol-phosphate aminotransferase;    
   73::225     1e-08  26%  346 aa  HIS8_ALISL RecName: Full=Histidinol-phosphate aminotransferase;    
   73::286     1e-08  29%  350 aa  HIS81_BRAJA RecName: Full=Histidinol-phosphate aminotransferase 1; 
  122::312     1e-08  27%  523 aa  ALAT2_HUMAN RecName: Full=Alanine aminotransferase 2;       
  135::294     1e-08  27%  476 aa  1A14_SOLLC RecName: Full=1-aminocyclopropane-1-carboxylate synthase
   28::167     2e-08  30%  189 aa  HIS8_THIRO RecName: Full=Histidinol-phosphate aminotransferase;    
   79::230     2e-08  29%  359 aa  HIS8_NEIG2 RecName: Full=Histidinol-phosphate aminotransferase;    
   79::230     2e-08  29%  359 aa  HIS8_NEIG1 RecName: Full=Histidinol-phosphate aminotransferase;    
   71::238     2e-08  25%  365 aa  HIS8_GEOSW RecName: Full=Histidinol-phosphate aminotransferase;    
   89::238     2e-08  25%  365 aa  HIS8_GEOKA RecName: Full=Histidinol-phosphate aminotransferase;    
   37::405     2e-08  26%  409 aa  DAPAT_PARD8 RecName: Full=LL-diaminopimelate aminotransferase;     
  110::291     2e-08  26%  496 aa  1A12_ARATH RecName: Full=1-aminocyclopropane-1-carboxylate synthase
   93::256     2e-08  30%  370 aa  HIS8_ROSS1 RecName: Full=Histidinol-phosphate aminotransferase;    
   32::225     2e-08  27%  350 aa  HIS8_GRAFK RecName: Full=Histidinol-phosphate aminotransferase;    
   96::248     2e-08  25%  364 aa  HIS82_OCEIH RecName: Full=Histidinol-phosphate aminotransferase 2; 
   35::238     2e-08  27%  355 aa  HIS82_BURS3 RecName: Full=Histidinol-phosphate aminotransferase 2; 
   27::406     2e-08  27%  408 aa  DAPAT_SYNS3 RecName: Full=LL-diaminopimelate aminotransferase;     
   27::257     2e-08  28%  411 aa  DAPAT_SYNJA RecName: Full=LL-diaminopimelate aminotransferase;     
   52::157     2e-08  33%  379 aa  ARNB_KLEP7 RecName:
   86::289     2e-08  29%  484 aa  1A1C_SOYBN RecName: Full=1-aminocyclopropane-1-carboxylate
   37::240     2e-08  26%  368 aa  1A1C_PHAAU RecName: Full=1-aminocyclopropane-1-carboxylate
   73::219     3e-08  29%  352 aa  HIS8_STRSV RecName: Full=Histidinol-phosphate aminotransferase;    
   52::157     3e-08  33%  379 aa  ARNB_KLEP3 RecName:
   52::167     3e-08  32%  379 aa  ARNB_ECO5E RecName:
   52::167     3e-08  32%  379 aa  ARNB_ECO57 RecName:
   85::285     3e-08  25%  460 aa  1A111_ARATH RecName: Full=1-aminocyclopropane-1-carboxylate
   69::273     4e-08  27%  391 aa  HIS8_SHEON RecName: Full=Histidinol-phosphate aminotransferase;    
   83::247     4e-08  30%  362 aa  HIS8_SHEAM RecName: Full=Histidinol-phosphate aminotransferase;    
   63::220     4e-08  27%  345 aa  HIS8_PARD8 RecName: Full=Histidinol-phosphate aminotransferase;    
   78::240     4e-08  25%  368 aa  HIS8_BUCAT RecName: Full=Histidinol-phosphate aminotransferase;    
   78::240     4e-08  25%  368 aa  HIS8_BUCAI RecName: Full=Histidinol-phosphate aminotransferase;    
   78::240     4e-08  25%  368 aa  HIS8_BUCA5 RecName: Full=Histidinol-phosphate aminotransferase;    
   97::257     4e-08  26%  370 aa  HIS82_PSEPF RecName: Full=Histidinol-phosphate aminotransferase 2; 
   37::402     4e-08  25%  416 aa  DAPAT_SYNJB RecName: Full=LL-diaminopimelate aminotransferase;     
   24::265     4e-08  29%  410 aa  DAPAT_GEOUR RecName: Full=LL-diaminopimelate aminotransferase;     
   29::240     4e-08  23%  407 aa  CBL_MYCTU RecName: Full=Putative cystathionine beta-lyase;       
   29::240     4e-08  23%  407 aa  CBL_MYCBO RecName: Full=Putative cystathionine beta-lyase;       
  167::481     4e-08  25%  557 aa  1A110_ARATH RecName: Full=Probable aminotransferase ACS10;       
   58::211     5e-08  34%  373 aa  PATR_CORJK RecName: Full=Putative phenylalanine aminotransferase;  
   83::219     5e-08  32%  360 aa  HIS8_JANSC RecName: Full=Histidinol-phosphate aminotransferase;    
   80::226     5e-08  33%  350 aa  HIS8_GEOSL RecName: Full=Histidinol-phosphate aminotransferase;    
   78::232     5e-08  25%  348 aa  HIS8_CYAA5 RecName: Full=Histidinol-phosphate aminotransferase;    
   75::237     5e-08  26%  359 aa  HIS8_BUCSC RecName: Full=Histidinol-phosphate aminotransferase;    
   52::167     5e-08  32%  379 aa  ARNB_SHISS RecName:
   52::167     5e-08  32%  379 aa  ARNB_SHIFL RecName:
   52::167     5e-08  32%  379 aa  ARNB_SHIF8 RecName:
   52::167     5e-08  32%  379 aa  ARNB_SHIBS RecName:
   52::157     5e-08  34%  381 aa  ARNB_PROMH RecName:
   52::167     5e-08  32%  379 aa  ARNB_ECOSM RecName:
   52::167     5e-08  32%  379 aa  ARNB_ECOSE RecName:
   52::167     5e-08  32%  379 aa  ARNB_ECOLU RecName:
   52::167     5e-08  32%  379 aa  ARNB_ECOLC RecName:
   52::167     5e-08  32%  379 aa  ARNB_ECO8A RecName:
   52::167     5e-08  32%  379 aa  ARNB_ECO81 RecName:
   52::167     5e-08  32%  379 aa  ARNB_ECO7I RecName:
   52::167     5e-08  32%  379 aa  ARNB_ECO55 RecName:
   52::167     5e-08  32%  379 aa  ARNB_ECO24 RecName:
  105::320     5e-08  27%  474 aa  AATR1_SCHPO RecName: Full=Aromatic amino acid aminotransferase
  126::309     5e-08  26%  447 aa  1A17_ARATH RecName: Full=1-aminocyclopropane-1-carboxylate synthase
  121::305     5e-08  24%  494 aa  1A12_CUCPE RecName: Full=1-aminocyclopropane-1-carboxylate synthase
   14::219     7e-08  25%  335 aa  HIS8_THEP1 RecName: Full=Histidinol-phosphate aminotransferase;    
   84::244     7e-08  20%  366 aa  HIS82_BACC1 RecName: Full=Histidinol-phosphate aminotransferase 2; 
   37::402     7e-08  25%  408 aa  DAPAT_LEPIC RecName: Full=LL-diaminopimelate aminotransferase;     
   35::257     7e-08  30%  409 aa  DAPAT_HELMI RecName: Full=LL-diaminopimelate aminotransferase;     
   52::157     7e-08  33%  379 aa  ARNB_SALTY RecName:
   52::157     7e-08  33%  379 aa  ARNB_SALSV RecName:
   52::157     7e-08  33%  379 aa  ARNB_SALPK RecName:
   52::157     7e-08  33%  379 aa  ARNB_SALPC RecName:
   52::157     7e-08  33%  379 aa  ARNB_SALPA RecName:
   52::157     7e-08  33%  379 aa  ARNB_SALNS RecName:
   52::157     7e-08  33%  379 aa  ARNB_SALHS RecName:
   52::157     7e-08  33%  379 aa  ARNB_SALCH RecName:
   52::167     7e-08  32%  379 aa  ARNB_ECOLI RecName:
   52::167     7e-08  32%  379 aa  ARNB_ECOHS RecName:
   52::167     7e-08  32%  379 aa  ARNB_ECODH RecName:
   52::167     7e-08  32%  379 aa  ARNB_ECOBW RecName:
  118::288     7e-08  22%  485 aa  1A12_SOLLC RecName: Full=1-aminocyclopropane-1-carboxylate synthase
   77::174     9e-08  36%  372 aa  MFNA_METKA RecName: Full=L-tyrosine decarboxylase;       
   86::256     9e-08  30%  369 aa  HIS82_PSEAE RecName: Full=Histidinol-phosphate aminotransferase 2; 
   37::408     9e-08  27%  410 aa  DAPAT_THEEB RecName: Full=LL-diaminopimelate aminotransferase;     
   37::402     9e-08  24%  408 aa  DAPAT_LEPIN RecName: Full=LL-diaminopimelate aminotransferase;     
   24::265     9e-08  29%  410 aa  DAPAT_GEOSF RecName: Full=LL-diaminopimelate aminotransferase;     
   37::390     9e-08  24%  410 aa  DAPAT_CLOTH RecName: Full=LL-diaminopimelate aminotransferase;     
   52::167     9e-08  32%  379 aa  ARNB_ENT38 RecName:
   52::167     9e-08  32%  379 aa  ARNB_ECOUT RecName:
   52::167     9e-08  32%  379 aa  ARNB_ECOL6 RecName:
   52::167     9e-08  32%  379 aa  ARNB_ECOL5 RecName:
   52::167     9e-08  32%  379 aa  ARNB_ECOK1 RecName:
   52::167     9e-08  32%  379 aa  ARNB_ECO45 RecName:
   52::167     9e-08  32%  379 aa  ARNB_ECO27 RecName:
  111::287     9e-08  25%  517 aa  1A1C_DIACA RecName: Full=1-aminocyclopropane-1-carboxylate
   87::290     9e-08  27%  474 aa  1A14_ARATH RecName: Full=1-aminocyclopropane-1-carboxylate synthase
  117::247     1e-07  27%  395 aa  DAPAT_CHLCV RecName: Full=LL-diaminopimelate aminotransferase;     
   80::303     2e-07  24%  350 aa  HIS8_GEOMG RecName: Full=Histidinol-phosphate aminotransferase;    
   96::261     2e-07  26%  397 aa  HIS8_FRASC RecName: Full=Histidinol-phosphate aminotransferase;    
   81::242     2e-07  25%  368 aa  HIS8_COLP3 RecName: Full=Histidinol-phosphate aminotransferase;    
   89::240     2e-07  20%  367 aa  HIS81_RHILO RecName: Full=Histidinol-phosphate aminotransferase 1; 
   55::157     2e-07  36%  372 aa  DEGT_BACST RecName: Full=Pleiotropic regulatory protein;
   27::259     2e-07  29%  408 aa  DAPAT_DESDA RecName: Full=LL-diaminopimelate aminotransferase;     
   37::401     2e-07  26%  411 aa  DAPAT_CYAP7 RecName: Full=LL-diaminopimelate aminotransferase;     
  112::255     2e-07  29%  366 aa  HIS8_PSEST RecName: Full=Histidinol-phosphate aminotransferase;    
   80::226     2e-07  27%  349 aa  HIS8_FLAJ1 RecName: Full=Histidinol-phosphate aminotransferase;    
   37::384     2e-07  30%  411 aa  DAPAT_PARUW RecName: Full=LL-diaminopimelate aminotransferase;     
   95::280     2e-07  28%  496 aa  ALAT1_BOVIN RecName: Full=Alanine aminotransferase 1;       
   94::289     2e-07  26%  473 aa  1A1C_MALDO RecName: Full=1-aminocyclopropane-1-carboxylate
   94::288     2e-07  25%  469 aa  1A18_ARATH RecName: Full=1-aminocyclopropane-1-carboxylate synthase
  121::305     2e-07  23%  493 aa  1A11_CUCPE RecName: Full=1-aminocyclopropane-1-carboxylate synthase
   67::255     3e-07  27%  377 aa  HIS8_MYCLE RecName: Full=Histidinol-phosphate aminotransferase;    
   67::255     3e-07  27%  377 aa  HIS8_MYCLB RecName: Full=Histidinol-phosphate aminotransferase;    
   71::254     3e-07  26%  370 aa  HIS8_HELHP RecName: Full=Histidinol-phosphate aminotransferase;    
   80::226     3e-07  30%  348 aa  HIS8_CYTH3 RecName: Full=Histidinol-phosphate aminotransferase;    
   27::407     3e-07  27%  408 aa  DAPAT_PROM3 RecName: Full=LL-diaminopimelate aminotransferase;     
   70::247     3e-07  25%  398 aa  DAPAT_CHLFF RecName: Full=LL-diaminopimelate aminotransferase;     
   52::157     3e-07  32%  381 aa  ARNB_EDWI9 RecName:
   77::230     4e-07  22%  355 aa  HIS8_BUCAP RecName: Full=Histidinol-phosphate aminotransferase;    
   88::227     4e-07  26%  354 aa  HIS8_BRAHW RecName: Full=Histidinol-phosphate aminotransferase;    
   40::245     4e-07  26%  369 aa  HIS8_BACSK RecName: Full=Histidinol-phosphate aminotransferase;    
   84::244     4e-07  20%  366 aa  HIS82_BACCR RecName: Full=Histidinol-phosphate aminotransferase 2; 
   84::244     4e-07  20%  366 aa  HIS82_BACAN RecName: Full=Histidinol-phosphate aminotransferase 2; 
   37::261     4e-07  26%  408 aa  DAPAT_LEPBL RecName: Full=LL-diaminopimelate aminotransferase;     
   37::261     4e-07  26%  408 aa  DAPAT_LEPBJ RecName: Full=LL-diaminopimelate aminotransferase;     
   52::157     4e-07  33%  384 aa  ARNB_SERP5 RecName:
   52::157     4e-07  32%  379 aa  ARNB_SALPB RecName:
   52::157     4e-07  32%  379 aa  ARNB_SALG2 RecName:
   52::157     4e-07  32%  379 aa  ARNB_SALEP RecName:
   52::157     4e-07  32%  379 aa  ARNB_SALDC RecName:
   52::157     4e-07  32%  379 aa  ARNB_SALA4 RecName:
   14::227     5e-07  23%  335 aa  HIS8_THENN RecName: Full=Histidinol-phosphate aminotransferase;    
   78::239     5e-07  29%  356 aa  HIS82_DECAR RecName: Full=Histidinol-phosphate aminotransferase 2; 
   84::244     5e-07  19%  366 aa  HIS82_BACHK RecName: Full=Histidinol-phosphate aminotransferase 2; 
   71::178     5e-07  35%  424 aa  GLDSA_STRRI RecName: Full=L-glutamine:2-deoxy-scyllo-inosose
   37::402     5e-07  26%  408 aa  DAPAT_PROMA RecName: Full=LL-diaminopimelate aminotransferase;     
   19::404     5e-07  25%  411 aa  DAPAT_METS3 RecName: Full=LL-diaminopimelate aminotransferase;     
   27::265     5e-07  29%  410 aa  DAPAT_GEOSL RecName: Full=LL-diaminopimelate aminotransferase;     
   25::386     5e-07  26%  404 aa  DAPAT_EUBE2 RecName: Full=LL-diaminopimelate aminotransferase;     
   27::410     5e-07  24%  411 aa  DAPAT_CYAP4 RecName: Full=LL-diaminopimelate aminotransferase;     
   37::402     5e-07  24%  411 aa  DAPAT_CYAA5 RecName: Full=LL-diaminopimelate aminotransferase;     
   74::235     5e-07  22%  367 aa  COBD_THETN RecName: Full=Putative threonine-phosphate
   52::157     5e-07  31%  382 aa  ARNB_PECCP RecName:
  117::305     5e-07  23%  493 aa  1A11_CUCMA RecName: Full=1-aminocyclopropane-1-carboxylate synthase
   72::232     6e-07  26%  349 aa  HIS8_SYNY3 RecName: Full=Histidinol-phosphate aminotransferase;    
   83::218     6e-07  29%  356 aa  HIS8_LACLS RecName: Full=Histidinol-phosphate aminotransferase;    
   85::235     6e-07  30%  352 aa  HIS8_CLOAB RecName: Full=Histidinol-phosphate aminotransferase;    
   19::355     6e-07  25%  408 aa  DAPAT_PROM4 RecName: Full=LL-diaminopimelate aminotransferase;     
   52::157     6e-07  32%  384 aa  ARNB_YERPY RecName:
   52::157     6e-07  32%  384 aa  ARNB_YERPS RecName:
   52::157     6e-07  32%  384 aa  ARNB_YERPP RecName:
   52::157     6e-07  32%  384 aa  ARNB_YERPN RecName:
   52::157     6e-07  32%  384 aa  ARNB_YERPG RecName:
   52::157     6e-07  32%  384 aa  ARNB_YERPE RecName:
   52::157     6e-07  32%  384 aa  ARNB_YERPB RecName:
   52::157     6e-07  32%  384 aa  ARNB_YERPA RecName:
   52::157     6e-07  32%  384 aa  ARNB_YERP3 RecName:
   95::335     6e-07  28%  496 aa  ALAT1_MOUSE RecName: Full=Alanine aminotransferase 1;       
  253::334     6e-07  39%  502 aa  1A1L1_MOUSE RecName: Full=1-aminocyclopropane-1-carboxylate
  103::288     6e-07  23%  470 aa  1A19_ARATH RecName: Full=1-aminocyclopropane-1-carboxylate synthase
  114::437     6e-07  22%  495 aa  1A16_ARATH RecName: Full=1-aminocyclopropane-1-carboxylate synthase
   31::226     8e-07  25%  374 aa  HIS8_PHOPR RecName: Full=Histidinol-phosphate aminotransferase;    
   73::304     8e-07  25%  356 aa  HIS81_BORPA RecName: Full=Histidinol-phosphate aminotransferase 1; 
   73::304     8e-07  25%  356 aa  HIS81_BORBR RecName: Full=Histidinol-phosphate aminotransferase 1; 
   27::244     8e-07  31%  408 aa  DAPAT_SYNPX RecName: Full=LL-diaminopimelate aminotransferase;     
   27::402     8e-07  24%  411 aa  DAPAT_NOSP7 RecName: Full=LL-diaminopimelate aminotransferase;     
   73::233     1e-06  25%  361 aa  HIS8_ACIBS RecName: Full=Histidinol-phosphate aminotransferase;    
   27::407     1e-06  27%  408 aa  DAPAT_PROMM RecName: Full=LL-diaminopimelate aminotransferase;     
   27::265     1e-06  28%  410 aa  DAPAT_GEOMG RecName: Full=LL-diaminopimelate aminotransferase;     
   33::259     1e-06  28%  409 aa  DAPAT_DESAH RecName: Full=LL-diaminopimelate aminotransferase;     
  125::391     1e-06  23%  397 aa  DAPAT_CHLPN RecName: Full=LL-diaminopimelate aminotransferase;     
   52::157     1e-06  31%  382 aa  ARNB_YERE8 RecName:
   52::167     1e-06  31%  379 aa  ARNB_SODGM RecName:
   52::157     1e-06  32%  379 aa  ARNB_SALTI RecName:
   53::158     1e-06  34%  382 aa  ARNB_PSEU2 RecName:
   72::250     1e-06  21%  364 aa  HIS8_SULNB RecName: Full=Histidinol-phosphate aminotransferase;    
   68::257     1e-06  29%  360 aa  HIS8_DESHY RecName: Full=Histidinol-phosphate aminotransferase;    
   74::223     1e-06  26%  350 aa  HIS8_CELJU RecName: Full=Histidinol-phosphate aminotransferase;    
   84::244     1e-06  19%  366 aa  HIS82_BACCZ RecName: Full=Histidinol-phosphate aminotransferase 2; 
   73::304     1e-06  25%  356 aa  HIS81_BORPE RecName: Full=Histidinol-phosphate aminotransferase 1; 
   71::178     1e-06  34%  424 aa  GLDSA_STRFR RecName: Full=L-glutamine:2-deoxy-scyllo-inosose
   17::285     1e-06  29%  425 aa  AADAT_RAT RecName: Full=Kynurenine/alpha-aminoadipate
  157::333     1e-06  32%  501 aa  1A1L1_HUMAN RecName: Full=1-aminocyclopropane-1-carboxylate
  103::288     1e-06  23%  470 aa  1A15_ARATH RecName: Full=1-aminocyclopropane-1-carboxylate synthase
   93::245     2e-06  29%  371 aa  HIS8_ROSCS RecName: Full=Histidinol-phosphate aminotransferase;    
   66::243     2e-06  27%  366 aa  HIS8_CORGL RecName: Full=Histidinol-phosphate aminotransferase;    
   66::243     2e-06  27%  366 aa  HIS8_CORGB RecName: Full=Histidinol-phosphate aminotransferase;    
   71::251     2e-06  21%  367 aa  HIS8_ARCB4 RecName: Full=Histidinol-phosphate aminotransferase;    
   73::233     2e-06  25%  361 aa  HIS8_ACIBT RecName: Full=Histidinol-phosphate aminotransferase;    
   35::261     2e-06  28%  411 aa  DAPAT_DESHY RecName: Full=LL-diaminopimelate aminotransferase;     
   35::261     2e-06  28%  411 aa  DAPAT_DESHD RecName: Full=LL-diaminopimelate aminotransferase;     
   30::399     2e-06  24%  404 aa  DAPAT_CLOPH RecName: Full=LL-diaminopimelate aminotransferase;     
   57::157     2e-06  35%  378 aa  ARNB_AERS4 RecName:
   87::288     2e-06  24%  475 aa  1A12_CUCMA RecName: Full=1-aminocyclopropane-1-carboxylate synthase
   63::234     2e-06  31%  351 aa  HIS8_CHRSD RecName: Full=Histidinol-phosphate aminotransferase;    
   73::233     2e-06  25%  361 aa  HIS8_ACIB5 RecName: Full=Histidinol-phosphate aminotransferase;    
   73::233     2e-06  25%  361 aa  HIS8_ACIB3 RecName: Full=Histidinol-phosphate aminotransferase;    
   84::220     2e-06  25%  354 aa  HIS81_OCEIH RecName: Full=Histidinol-phosphate aminotransferase 1; 
   38::404     2e-06  24%  411 aa  DAPAT_METST RecName: Full=LL-diaminopimelate aminotransferase;     
   34::259     2e-06  25%  408 aa  DAPAT_DESPS RecName: Full=LL-diaminopimelate aminotransferase;     
   95::280     2e-06  26%  496 aa  ALAT1_RAT RecName: Full=Alanine aminotransferase 1;       
   81::303     3e-06  23%  354 aa  HIS8_VESOH RecName: Full=Histidinol-phosphate aminotransferase;    
   88::240     3e-06  26%  368 aa  HIS8_DIAST RecName: Full=Histidinol-phosphate aminotransferase;    
   71::187     3e-06  34%  427 aa  GLDSA_STRKN RecName: Full=L-glutamine:2-deoxy-scyllo-inosose
   24::265     3e-06  27%  410 aa  DAPAT_PELPD RecName: Full=LL-diaminopimelate aminotransferase;     
   35::265     3e-06  26%  410 aa  DAPAT_METTH RecName: Full=LL-diaminopimelate aminotransferase;     
   35::249     3e-06  25%  401 aa  DAPAT_AZOPC RecName: Full=LL-diaminopimelate aminotransferase;     
  253::334     3e-06  34%  502 aa  1A1L1_BOVIN RecName: Full=1-aminocyclopropane-1-carboxylate
   82::284     4e-06  25%  350 aa  HIS8_STRTD RecName: Full=Histidinol-phosphate aminotransferase;    
   72::260     4e-06  31%  380 aa  HIS8_RHOOB RecName: Full=Histidinol-phosphate aminotransferase;    
   79::256     4e-06  25%  386 aa  HIS8_BIFLO RecName: Full=Histidinol-phosphate aminotransferase;    
   70::233     4e-06  27%  361 aa  HIS8_ACIBY RecName: Full=Histidinol-phosphate aminotransferase;    
   70::233     4e-06  27%  361 aa  HIS8_ACIBC RecName: Full=Histidinol-phosphate aminotransferase;    
   19::257     4e-06  31%  408 aa  DAPAT_PROMT RecName: Full=LL-diaminopimelate aminotransferase;     
   27::265     4e-06  26%  410 aa  DAPAT_PELCD RecName: Full=LL-diaminopimelate aminotransferase;     
   25::261     4e-06  27%  404 aa  DAPAT_EUBR3 RecName: Full=LL-diaminopimelate aminotransferase;     
   32::258     4e-06  28%  417 aa  AVTA_ECOLI RecName: Full=Valine--pyruvate aminotransferase;        
  114::285     4e-06  25%  425 aa  AADAT_HUMAN RecName: Full=Kynurenine/alpha-aminoadipate
   28::258     5e-06  26%  382 aa  HIS8_MYCUA RecName: Full=Histidinol-phosphate aminotransferase;    
   83::218     5e-06  29%  356 aa  HIS8_LACLM RecName: Full=Histidinol-phosphate aminotransferase;    
   52::157     5e-06  32%  381 aa  ARNB_PHOLL RecName:
   52::157     5e-06  30%  382 aa  ARNB_ERWCT RecName:
  114::334     5e-06  25%  425 aa  AADAT_BOVIN RecName: Full=Kynurenine/alpha-aminoadipate
  147::283     7e-06  30%  430 aa  PTSJ_SALTY RecName: Full=Putative transcriptional regulatory
   53::158     7e-06  31%  382 aa  ARNB_PSEPF RecName:
  129::308     7e-06  25%  524 aa  ALAT2_XENTR RecName: Full=Alanine aminotransferase 2;       
  105::289     7e-06  25%  492 aa  1A11_PRUMU RecName: Full=1-aminocyclopropane-1-carboxylate synthase
   99::250     7e-06  24%  487 aa  1A11_ORYSJ RecName: Full=1-aminocyclopropane-1-carboxylate synthase
   99::250     7e-06  24%  487 aa  1A11_ORYSI RecName: Full=1-aminocyclopropane-1-carboxylate synthase
   67::223     9e-06  30%  347 aa  HIS8_PELCD RecName: Full=Histidinol-phosphate aminotransferase;    
   37::410     9e-06  24%  410 aa  DAPAT_SYNP2 RecName: Full=LL-diaminopimelate aminotransferase;     
   53::158     9e-06  30%  379 aa  ARNB_PSEF5 RecName:
  114::274     9e-06  29%  425 aa  AADAT_MOUSE RecName: Full=Kynurenine/alpha-aminoadipate
  119::222     1e-05  28%  441 aa  NTDA_BACSU RecName: Full=NTD biosynthesis operon protein ntdA;
  119::316     1e-05  20%  442 aa  NORG_STAAC RecName: Full=HTH-type transcriptional regulator norG;
  119::316     1e-05  20%  442 aa  NORG_STAA8 RecName: Full=HTH-type transcriptional regulator norG;
  119::316     1e-05  20%  442 aa  NORG_STAA3 RecName: Full=HTH-type transcriptional regulator norG;
   95::238     1e-05  27%  365 aa  HIS8_POLNA RecName: Full=Histidinol-phosphate aminotransferase;    
   66::222     1e-05  28%  346 aa  HIS8_BACTN RecName: Full=Histidinol-phosphate aminotransferase;    
   91::194     1e-05  30%  368 aa  HIS81_NITMU RecName: Full=Histidinol-phosphate aminotransferase 1; 
   79::218     1e-05  29%  359 aa  HIS81_NITEU RecName: Full=Histidinol-phosphate aminotransferase 1; 
   37::402     1e-05  24%  411 aa  DAPAT_TRIEI RecName: Full=LL-diaminopimelate aminotransferase;     
   19::402     1e-05  27%  408 aa  DAPAT_PROM1 RecName: Full=LL-diaminopimelate aminotransferase;     
   53::158     1e-05  30%  382 aa  ARNB_PSEAE RecName:
   53::158     1e-05  30%  382 aa  ARNB_PSEAB RecName:
   53::158     1e-05  30%  382 aa  ARNB_PSEA8 RecName:
   53::158     1e-05  30%  382 aa  ARNB_PSEA7 RecName:
   73::219     1e-05  28%  352 aa  HIS8_STRGC RecName: Full=Histidinol-phosphate aminotransferase;    
   43::258     1e-05  25%  382 aa  HIS8_MYCMM RecName: Full=Histidinol-phosphate aminotransferase;    
   85::235     1e-05  25%  354 aa  HIS8_CLOBK RecName: Full=Histidinol-phosphate aminotransferase;    
   88::239     1e-05  21%  370 aa  HIS81_BACC1 RecName: Full=Histidinol-phosphate aminotransferase 1; 
   19::146     1e-05  33%  424 aa  GLDSA_STRSD RecName: Full=L-glutamine:2-deoxy-scyllo-inosose
  135::379     1e-05  26%  500 aa  ARO8_YEAST RecName: Full=Aromatic amino acid aminotransferase 1;   
  114::288     1e-05  23%  469 aa  1A13_SOLLC RecName: Full=1-aminocyclopropane-1-carboxylate synthase
   85::235     2e-05  25%  358 aa  HIS8_CLOB8 RecName: Full=Histidinol-phosphate aminotransferase;    
   70::237     2e-05  24%  363 aa  HIS8_CAMLR RecName: Full=Histidinol-phosphate aminotransferase;    
  119::290     2e-05  23%  491 aa  1A1C_TOBAC RecName: Full=1-aminocyclopropane-1-carboxylate
   72::237     3e-05  22%  364 aa  HIS8_SULDN RecName: Full=Histidinol-phosphate aminotransferase;    
   88::240     3e-05  26%  368 aa  HIS8_ACISJ RecName: Full=Histidinol-phosphate aminotransferase;    
   85::287     3e-05  25%  355 aa  HIS82_GLUOX RecName: Full=Histidinol-phosphate aminotransferase 2; 
    8::157     3e-05  31%  378 aa  ARNB_AERHH RecName:
  119::316     3e-05  20%  442 aa  NORG_STAAB RecName: Full=HTH-type transcriptional regulator norG;
   73::233     3e-05  27%  363 aa  HIS8_XANC5 RecName: Full=Histidinol-phosphate aminotransferase;    
   83::245     3e-05  21%  370 aa  HIS83_RHIME RecName: Full=Histidinol-phosphate aminotransferase 3; 
  119::316     4e-05  19%  442 aa  NORG_STAAN RecName: Full=HTH-type transcriptional regulator norG;
  119::316     4e-05  19%  442 aa  NORG_STAAM RecName: Full=HTH-type transcriptional regulator norG;
   86::243     4e-05  21%  365 aa  HIS8_CAMC1 RecName: Full=Histidinol-phosphate aminotransferase;    
   73::246     4e-05  32%  438 aa  GSA_MYCSS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   73::246     4e-05  32%  438 aa  GSA_MYCSK RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   34::256     4e-05  30%  409 aa  DAPAT_DESOH RecName: Full=LL-diaminopimelate aminotransferase;     
   75::243     4e-05  23%  364 aa  COBD_SALTY RecName: Full=Threonine-phosphate decarboxylase;        
  255::405     4e-05  26%  568 aa  1A1L2_HUMAN RecName: Full=1-aminocyclopropane-1-carboxylate
   69::206     6e-05  22%  349 aa  HIS8_HYDS0 RecName: Full=Histidinol-phosphate aminotransferase;    
  241::322     6e-05  28%  461 aa  DAPAT_ARATH RecName: Full=LL-diaminopimelate aminotransferase,
   75::243     6e-05  23%  364 aa  COBD_SALTI RecName: Full=Threonine-phosphate decarboxylase;        
   65::235     7e-05  27%  351 aa  HIS82_RHIME RecName: Full=Histidinol-phosphate aminotransferase 2; 
  145::324     7e-05  24%  540 aa  ALAT2_XENLA RecName: Full=Alanine aminotransferase 2;       
   66::235     1e-04  27%  350 aa  HIS8_PSEU2 RecName: Full=Histidinol-phosphate aminotransferase;    
   81::253     1e-04  19%  366 aa  HIS8_CAMFF RecName: Full=Histidinol-phosphate aminotransferase;    
   73::246     1e-04  31%  438 aa  GSA_MYCSJ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   35::222     1e-04  28%  408 aa  DAPAT_PROM0 RecName: Full=LL-diaminopimelate aminotransferase;     
  246::291     1e-04  39%  507 aa  ALAT_YEAST RecName: Full=Probable alanine aminotransferase;        
   78::231     2e-04  22%  363 aa  HIS8_BUCDN RecName: Full=Histidinol-phosphate aminotransferase;    
   79::233     2e-04  21%  370 aa  HIS8_BACCN RecName: Full=Histidinol-phosphate aminotransferase;    
   30::309     2e-04  22%  361 aa  HIS8_ACIAD RecName: Full=Histidinol-phosphate aminotransferase;    
   91::255     2e-04  25%  370 aa  HIS8_ACIAC RecName: Full=Histidinol-phosphate aminotransferase;    
   66::239     2e-04  34%  436 aa  GSA_PROAC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   70::177     2e-04  32%  420 aa  GLDSA_MICEC RecName: Full=L-glutamine:2-deoxy-scyllo-inosose
  107::281     2e-04  22%  488 aa  1A11_ARATH RecName: Full=1-aminocyclopropane-1-carboxylate
   66::288     2e-04  25%  348 aa  HIS8_PSEE4 RecName: Full=Histidinol-phosphate aminotransferase;    
   78::218     2e-04  26%  360 aa  HIS8_LACLA RecName: Full=Histidinol-phosphate aminotransferase;    
  161::246     2e-04  26%  369 aa  HIS82_LEGPL RecName: Full=Histidinol-phosphate aminotransferase 2; 
  161::246     2e-04  26%  369 aa  HIS82_LEGPH RecName: Full=Histidinol-phosphate aminotransferase 2; 
   37::278     2e-04  24%  410 aa  DAPAT_LAWIP RecName: Full=LL-diaminopimelate aminotransferase;     
   27::390     2e-04  24%  411 aa  DAPAT_CYAP8 RecName: Full=LL-diaminopimelate aminotransferase;     
   47::152     3e-04  31%  376 aa  RFFA_ECOLI RecName: Full=Lipopolysaccharide biosynthesis protein
   90::257     3e-04  21%  388 aa  HIS8_PROAC RecName: Full=Histidinol-phosphate aminotransferase;    
  161::246     3e-04  26%  369 aa  HIS82_LEGPA RecName: Full=Histidinol-phosphate aminotransferase 2; 
   88::237     3e-04  19%  370 aa  HIS81_BACCZ RecName: Full=Histidinol-phosphate aminotransferase 1; 
   64::175     3e-04  35%  418 aa  GLADA_MICEC RecName: Full=Putative
   70::235     4e-04  30%  364 aa  Y2256_MYCBO RecName: Full=Uncharacterized aminotransferase Mb2256c;
   70::235     4e-04  30%  364 aa  Y2231_MYCTU RecName: Full=Uncharacterized aminotransferase
   83::191     4e-04  31%  389 aa  MFNA_METST RecName: Full=L-tyrosine decarboxylase;       
   73::233     4e-04  26%  363 aa  HIS8_XANAC RecName: Full=Histidinol-phosphate aminotransferase;    
   66::287     4e-04  23%  348 aa  HIS8_PSEPK RecName: Full=Histidinol-phosphate aminotransferase;    
   66::235     4e-04  26%  350 aa  HIS8_PSE14 RecName: Full=Histidinol-phosphate aminotransferase;    
   85::248     4e-04  25%  361 aa  HIS8_DEIRA RecName: Full=Histidinol-phosphate aminotransferase;    
   88::237     4e-04  19%  370 aa  HIS81_BACHK RecName: Full=Histidinol-phosphate aminotransferase 1; 
   88::237     4e-04  19%  370 aa  HIS81_BACAN RecName: Full=Histidinol-phosphate aminotransferase 1; 
   56::221     4e-04  28%  414 aa  GLYA_DIAST RecName: Full=Serine hydroxymethyltransferase;       
   56::221     4e-04  28%  414 aa  GLYA_ACISJ RecName: Full=Serine hydroxymethyltransferase;       
   73::233     5e-04  26%  362 aa  HIS8_XANCB RecName: Full=Histidinol-phosphate aminotransferase;    
   71::235     5e-04  28%  361 aa  HIS8_SYNAS RecName: Full=Histidinol-phosphate aminotransferase;    
   66::287     5e-04  23%  348 aa  HIS8_PSEPG RecName: Full=Histidinol-phosphate aminotransferase;    
   81::227     5e-04  24%  366 aa  HIS8_CAMHC RecName: Full=Histidinol-phosphate aminotransferase;    
  170::237     6e-04  26%  390 aa  MALY_ECOLI RecName: Full=Protein malY;Includes:  RecName:
   33::222     6e-04  25%  408 aa  DAPAT_PROM5 RecName: Full=LL-diaminopimelate aminotransferase;     
   72::241     8e-04  24%  366 aa  HIS8_NITSB RecName: Full=Histidinol-phosphate aminotransferase;    
  155::219     8e-04  33%  502 aa  GCSPB_PYRHO RecName: Full=Probable glycine dehydrogenase
  154::333     8e-04  23%  549 aa  ALAT2_DANRE RecName: Full=Alanine aminotransferase 2-like;       
    1::373

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MTEFSDRVAQVSISGIRAVFEAAGEDAINLGLGQPDFPTPDHARQAAVDAIESGAADGYTSNRGTAALVD
AAT1_METJA      ----SSRCKNIKPSAIREIFNLATSDCINLGIGEPDFDTPKHIIEAAKRALDEGKTH-YSPNNGIPELRE
AAT_PYRHO       ----AERVLLIKRSKIRELFERASEDVISLGIGEPDFDTPKNIKEAAKRALDEGWTH-YTPNAGIPELRE
AAT_PYRAB       ----SDRLDLVNPSEIRKLFDIAAKDVISLGIGEPDFDTPQHIKEYAKEALDMGLTH-YGPNIGLPELRE
AAT_BACST       --KLAKRVASLTPSATLAITEAAGHDVIGLGAGEPDFNTPQHILDAAIKAMNEGHTK-YTPSGGLPALKE
AAT1_BACSU      --------------------KAAGHDVIGLGAGEPDFNTPQHIIDAAVRSMNEGHTK-YTPSGGLAELKN
AAT_THEAQ       --------ATVAVNARALELRRKGVDLVALTAGEPDFDTPEHVKEAGRRALAQGKTK-YAPPAGIPELRE
AAT_BACY2       --------------------KAQGIDVIGLGAGEPDFNTPQNIMDAAIDSMQQGYTK-YTPSGGLPALKQ
AAT_AQUAE       ---------------------AKGVDVIGFGAGEPDFDTPDFIKEACIRALREGKTK-YAPSAGIPELRE
AATA_RHIME      --------ATIAVSQKARELKAKGRDVIGLGAGEPDFDTPDNIKKAAIDAIDRGETK-YTPVSGIPELRE
AAT_STRVG       -----------------------GRPVIGFGAGEPDFPTPDYIVEAAVEACRNPKYHRYTPAGGLPELKA
AAT_THET8       --------ATVAVNAKALELRRQGVDLVALTAGEPDFDTPEHVKEAARRALAQGKTK-YAPPAGIPELRE
AAT_SYNY3       ----TQRVSQVEITAKAKAMRTEGIDVLSFTAGEPDFTTPPHIVEAAKLALDEGKTR-YGPAAGEPALRQ
AATB1_RHIME     ----ASRISSIGVSEIAAAMKREGKPVIILGAGEPDFDTPEHVKQAASDAIHRGETK-YTALDGTPELKK
AATB2_RHIME     ----ASRISSIGVSEIAAAMKREGKPVIILGAGEPDFDTPDHVKQAASDAIHRGETK-YTALDGTPELKK
AAT_SULTO       ----------------RQVQKTKGIRIINFGIGQPDLPTFARIREAAKKSLDEGFT-GYTSAYGIDELRQ
AAT_SULSO       ---------------------------IDFGIGQPDLPTFKRIRDAAKEALDQGFTF-YTSAFGIDELRE
AAT_SULAC       ----------------RSVQKEKGIKIVNFGIGQPDFPTFQKIRDEAKKALDGGFT-AYTSAYGIDELRA
DAPAT_CARHZ     ----------------------AGVDVISLGIGDPDTPTPKHIIEELYLAAQNPENHQYPSSVGMLSYRQ
PATA_BACSU      ------KAREIEISGIRKFSNAQHEDVISLTIGQPDFFTPHHVKAAAKKAIDENVTS-YTPNAGYLELRQ
AAT_RICBR       ----------------------AGIDIIALGAGEPDFDTPDNIKEAAIKAIKDGFTK-YTNVEGIPALKE
AAT_RHILP       --------ATIAVSQKARELKAKGRDVIGLGAGEPDFDTPDNIKKAAIDAINRGETK-YTPVSGIPELRK
DAPAT_HALOH     -----------------------GVDVISFGIGDPDQPTPDNIINKMIEAVKDPSTHSYPSYEGMYEYRK
AAT_THEMA       ----SRRISEIPISKTMELDAKAGEDVINLTAGEPDFPTPEPVVEEAVRFLQKGEVK-YTDPRGIYELRE
AAT_RICFE       ----------------------AGVDIIALGAGEPDFDTPDNIKEAAIKAIKDGFTK-YTNVEGMPLLKQ
AAT_RICCN       MSIISTRLSSIKPSPTLAVLKKAGVDIITLGAGEPDFDTPDNIKEGAIKAIKDGFTK-YTNVEGMPLLKQ
DAPAT_SYNFM     ------------IDRLKAELTAKGVDVINLGVGDPDLPTPDHIIARLKTAAEDPSTHQYPSYSGMNDFKV
AAT_RICPR       ----------------------AGVNIIALGAGEPDFDTPDNIKEVAITSIKDGFTK-YTNVDGIPLLKQ
AAT_RICTY       ----------------------AGVNIIALGAGEPDFDTPDNIKEVAITSIKDGFTK-YTNVDGIPLLKQ
DAPT2_ANASP     ----------------REALIAKGVDIINIGVGDPDKPTPAHILQAMREAIDDASNHNYPPYEGTQEFRE
DAPAT_MOOTA     -----------------------GVDIISLGIGDPDMPTPSHVIDKLVAEAHNPENHRYPTSEGLLAFRQ
DAPAT_GLOVI     ---------------------ARGVDIINMGIGDPDKPTPPVVLEAMHAAIDDPSTHNYPPYKGTKAYRE
AAT2_METJA      ----------MDILALAQKLESEGKKVIHLEIGEPDFNTPKPIVDEGIKSLKEGKTH-YTDSRGILELRE
DAPT2_ANAVT     ----------------REALIAQGVDIINIGVGDPDKPTPAHILQAMREAIDEASNHNYPPYEGTQEFRE
DAPAT_DEHSB     ----------VQISKKIAEKRAKGEDVISFAIGDPDLPTPKHILAELCKAAEDPSNHRYPETEGLPVLRK
MTNE_BACSU      ---------------------AEGHDVINLGQGNPDQPTPEHIVEEMKRAVADPENHKYSSFRGSYRLKS
KAT1_MOUSE      -------------------------DVVNLGQGFPDFSPPDFAVQAFQQATTGNMLNQYTSAFGYPPLTK
DAPAT_DEHSC     ----------VQISKKIAEKRAKGEEVISFAIGDPDLPTPKHILAELCKAAEDPSNHRYPETEGLPVLRK
KAT1_RAT        -------------------------DVVNLGQGFPDFSPPDFATQAFQQATSGNMLNQYTRAFGYPPLTN
DAPAT_DESAD     MPEFADRLATLEIDRLKAEVAAQGVDIISLGIGDPDLPTPDFIIEALHKAAKNPVNHQYPSYVGLLTFRQ
DAPAT_DEHE1     ----------VQISKKIAEKRAKGEEVISFAIGDPDLPTPKHILAELCKAAEDPANHRYPETEGLPVLRK
AATC_RHIME      ------------VNRLKASARAAGADIIDLGMGNPDLPTPQSIVDKLCEVVQDPRTHRYSSSKGIPGLXX
KAT3_DANRE      ---------------------AADPSIVNLGQGYPDIPPPSYVKEGLAQAAMVDRLNQYTRGFGHPTLVK
KAT_DICDI       -------------------------NAVNLGQGFPNFEPPKFVKDAMIKTIEVGGFNQYTRSPGHIRLVK
KAT3_RAT        ---------------------AADPSVVNLGQGFPDITLPSYVQEELSKAAFIDNLNQYTRGFGHPSLVK
DAPAT_NATTJ     --------------------QAKGKEIIKLGIGDPGMKPPEGIIKAATQEMYKGENHGYPAYDGIDKLKH
DAPAT_DESDG     MTQFTDRLATLQIDKVKAEVAARGVDIISLGIGDPDMPTPDFVIEALKKAAEKPANHQYPSYTGMLAFRQ
KAT3_HUMAN      ---------------------AADPSVVNLGQGFPDISPPTYVKEELSKIAAIDSLNQYTRGFGHPSLVK
DAPAT_DESVH     --KLADRLATLGIDKVKAEVAARGVDIISLGIGDPDMATPGFIIEAMKEAIARPANHQYPSYVGMLAFRQ
DAPAT_DESVV     --KLADRLATLGIDKVKAEVAARGVDIISLGIGDPDMATPGFIIEAMKEAIARPANHQYPSYVGMLAFRQ
KAT3_MOUSE      ---------------------AADPSVVNLGQGFPDISPPSYVKEELSKAAFIDNMNQYTRGFGHPALVK
KAT3_BOVIN      ---------------------AADPSVVNLGQGLPDISPPVYVKEELSKIAAIDNLNQYTRGFGHPSLVK
DAPAT_AQUAE     -----------------------GVDVIDLGVGDPDMPTPKPIVEAAKKALENPENHKYPSYVGKYEFRK
KAT1_HUMAN      ---------------------ASEHDVVNLGQGXXXXXXXXXAVEAFQHAVSGDMLNQYTKTFGYPPLTK
AAT_STRGR       -----------------------GRPVIGFGAGEPDFPTPDYIVDAAVEACRNPKYHRYTPQRAPE-LKA
DAPAT_DESVM     --KLADRLATLGIDKVKAEVAARGVDIISLGIGDPDMPTPDFIIEAMKKAVERPANHQYPSYVGMLEFRQ
AAT2_BACSU      --------------------EKTGAHIINLGQGNPDLPTPPHIVEALREASLNPSFHGYGPFRGYPFLKE
YBDL_ECOLI      ---------------------AQQHQAINLSQGFPDFDGPRYLQERLAHHVAQGA-NQYAPMTGVQALRE
AAT3_BACSU      -----------------------GEDQVDFSLGNPIVEPPEAFKRALIEEAEKGS-HGYIQNQGLLAARE
YFDZ_ECOLI      -----------------------GEDIIDFSMGNPDGATPPHIVEKLCTVAQRPDTHGYSTSRGIPRLRR
BNA3_YEAST      -----------------------GRELINLGQGFFSYSPPQFAIKEAQKALDIPMVNQYSPTRGRPSLIN
AAT_MYCTU       -----------------ARLEAEGHRILKLNIGNPGFEAPDVIMRDIIQALPY--AQGYSDSQGILSARR
AAT_MYCBO       -----------------ARLEAEGHRILKLNIGNPGFEAPDVIMRDIIQALPY--AQGYSDSQGILSARR
ATTY_MOUSE      ---------------------------ISLSIGDPNLPTDPEVTQAMKDALDSGKYNGYAPSIGYLSSRE
DAPAT_DESAP     --------------------KAQGVDVISLGIGDPDVPTPDHIIEAAEKELKIPANHQYPSSAGMPAYRR
ATTY_RAT        ---------------------------ISLSIGDPNLPTDPEVTQAMKDALDSGKYNGYAPSIGYLSSRE
Y1527_METMP     -------------------------ELIDMGVGEPDEMADESVVEVLCEEAKKHVNRGYSDN-GVQALKD
Y1391_METJA     -------------------------ELIDMGVGEPDEMADPEVIRVLCEEAKKWENRGYADN-GIQELKD
ATTY_DICDI      ----SSKSANNAFNPIRRIVDKGGKSTISLSIGDPNLNILDYANDLLIENIKSSKFNGYPPSTGYEIARE
ATTY_HUMAN      ---------------------------ISLSIGDPNLPTDPEVTQAMKDALDSGKYNGYAPSIGFLSSRE
Y286_HAEIN      --------------------EEEGNKILKLNIGNPGFEAPD---EILVDVLRNPSAQGYCDSKGLYSARK
YFBQ_SHIFL      --------------------EEEGNKVLKLNIGNPGFDAPD---EILVDVIRNPTAQGYCDSKGLYSARK
YFBQ_ECOLI      --------------------EEEGNKVLKLNIGNPGFDAPD---EILVDVIRNPTAQGYCDSKGLYSARK
YFBQ_ECOL6      --------------------EEEGNKVLKLNIGNPGFDAPD---EILVDVIRNPTAQGYCDSKGLYSARK
ATTY_BOVIN      ---------------------------IALSIGDPNLPTDPEVTQAMKDALDSGKFNGYVPSIGYLSSRE
ATTY_TRYCR      ------------------------------------------------EAIDSQECNGYFPTVGSPEARE
HIS8_AZOC5      ----------------------------------------------------------------------
HIS8_SILPO      ---------------------------------------------AAVEAIRATAAQAHRPSTDHAELRA
AAT_PYRKO       -----------------------------LDAGQPDIPVRREIIEEAVESLRRGET-GYTSTGGIRELRE
PATR_PROAC      ----------------------------------------------------------------------
YDT4_SCHPO      ---------------------------VSLSQGFFNYNPPKFVLDAAKKSIDEVACNQYSHTRGRPSLRK
HIS8_UNCMA      ------------------------------------------ASPLAIEAIRKAACDAHVYPS-----VD
HIS8_BEII9      ---------------------------------------------------------------GAATLLT
PATR_STRGG      --------------------------------------------------LESALAAAGSFNRYPDMACT
HIS8_METS4      --------------------------------------TPLGPSPAAVAAMRETASHLELYPDGSAALRR
HIS8_CALS8      ----------------------------------------------------------------------
HIS8_HALMA      --------------GIEEVARELGDDMVKLASNENMFPSPD-----AVEAIRGSAERMHSYPKASHALVD
HIS8_MAGSA      ----------------------------------------------------------------------
HIS8_XANP2      ----------------------------------------------------------------------
HIS8_ROSDO      -----------------------------------------------------------------SALRM
Y104_SULSO      -----------------------GKNVISLAGGLPDPQTPVEEIKKIADDILLNSADKYTATAGISEFRR
HIS8_SPHAL      ---------------------ADGRPLIKLSANENPLGTGEKAR-AAFAAVQS-APDALSRDPGSVELRA
PATR_MYCA9      ----------------------------------------------------------------------
YISV_BACSU      -------------------------DIIRLGTGEPDLVPADTIGRMFQQINPGVLSLGYEQPKGNRQLRE
PATR_STRCO      ----------------------------------------------------------------------
HIS81_RHIME     --------------------------------------TPLGASPRAIEAFQKAAFNLERYPDGQAALKE
HIS8_METNO      --------------------------------------TPLGPSLAAIAAMETGAHLELYPDGSATDLRR
HIS8_RUBXD      ----------------------------------------------------------------------
HIS8_ZYMMO      -----------------------GRPAVKLSSNENPLGTSLKAKEAYREAIDSLSL---YPDSGATALRE
PATR_RHOSR      -------------------------------------------------------------DNGHVALIA
HIS8_METFL      ----------------------------------------------------------------------
HIS8_DINSH      -----------------------------------------------------------------AGLRG
HIS82_RALEJ     ----------------------------------------------------------------------
HIS8_PELLD      ----------------------------------------------------------------------
HIS8_BRUME      ------------VEGVAKVYKLSSNET-------PLGPSP-HAREAYRHAGEK--LELYPDGQALA-LRQ
HIS8_SILST      -----------------------------------------------------------------ATLRA
HIS8_BRUSU      ------------VEGVAKVYKLSSNET-------PLGPSP-HAREAYRHAGEK--LELYPDGQALA-LRQ
HIS8_BRUO2      ------------VEGVAKVYKLSSNET-------PLGPSP-HAREAYRHAGEK--LELYPDGQALA-LRQ
HIS8_BRUAB      ------------VEGVAKVYKLSSNET-------PLGPSP-HAREAYRHAGEK--LELYPDGQALA-LRQ
HIS8_BRUA2      ------------VEGVAKVYKLSSNET-------PLGPSP-HAREAYRHAGEK--LELYPDGQALA-LRQ
PATR_THEFY      ----------------------------------------------------------------------
HIS8_BURM1      -------------------------------LAMTSYPVPDASGFVKLDAMENXXXXXXXXNRYPAPRPA
YDCR_ECOLI      ---------------------------------------------------------------GNAELRQ
PATR_STRAW      --------------------------------------------------LESVASSVGSFNRYPDMACS
HIS8_PROVI      --------------------EGGQQAAIKLNQNESPFDLPMWLKDAIVSEFVREPWNRYPDYRGTKAYAD
HIS8_MESSB      --------------------------------------TPLGPSPAALEAVREASQHLEIYPDGSASLRD
HIS8_ERYLH      ----------------------------------------------ALEALDAPGNPATYPDPDAKALRA
HIS81_BURS3     -------------------------------------------------------------NRYPAPRPA
HIS8_CHLL2      ----------------------------------------------------------------------
HIS8_NOVAD      ----------------------------------------------------------------------
HIS8_METMA      -----------SIEEIASTYGLKPESIIKLGSNENPLGPSPKAVKALIEA--APGANIYPS-------AD
PATR_RHOE4      ----------------------------------------------------------------------
HIS8_METJA      ----------------------------------------------------------------------
CBL_BACSU       -------------------------DALPMWVADMDFRAPEAITEALKERLDHGIFGYTTPDQKTK---D
HIS8_MOOTA      --------------------ELGVKDVIKLASNEPLGPSPD-----AVQALQEASDRIFLYPDGNCYYL-
HIS8_METM7      ----------------------------------------------------------------------
HIS8_HYPNA      ----------------------------------------------------------------------
PATR_MYCVP      -------------------------------------PSVRAAIEKAIDGINRYPDNGYVELRERLA---
PATR_MYCS2      -------------------------------------PSVREAILKATDLINRYPDNGYLDLRERLA---
HIS8_RHOP2      ----------------------AGRKVFKLSANETPFGPSPHA----IAAYKSAADHLEDYPEGTSRVLR
HIS8_ALKOO      ----------------------------------------------------------------------
HIS8_PELPB      ----------------------------------------------------------------------
HIS8_HALLT      --DLSDHSPYVPGRGVEEVARDRGDDLIKLSSNEPHGPSP-----AAVDAIREHADRVHQYPKSSHTLTA
PATR_MYCTU      ----------------------------------------------------------------------
PATR_MYCTA      ----------------------------------------------------------------------
PATR_MYCBT      ----------------------------------------------------------------------
PATR_MYCBP      ----------------------------------------------------------------------
PATR_MYCBO      ----------------------------------------------------------------------
HIS8_RHOPB      -----------------------GRKVFKLSANETPFGPSPHAIAAY-----KGAADHLEDYEGTSRVLR
HIS8_METMP      ----------------------------------------------------------------------
HIS8_MARMM      ----------------------------------------------------------------------
HIS8_CHLTE      ----------------------------------------------------------------------
HIS8_THETN      ----------------------------------------------------------------------
HIS8_SALPK      -----------------------------------------------------------TLNRYPECQPK
HIS8_SALPA      -----------------------------------------------------------TLNRYPECQPK
HIS8_PROA2      --------------------EGGQQAEIKLNQNESPFDLPLWLKDEIMDEFKHEAWNRYPDIRGMKAYAD
HIS8_HALSA      LRDLSDHVEYRAGRGIEEVARELGRDPVKLSSNEPHGPSPK-----ATIAIREAATGVHRYPKAVHALTG
HIS8_HALS3      LRDLSDHVEYRAGRGIEEVARELGRDPVKLSSNEPHGPSPK-----ATIAIREAATGVHRYPKAVHALTG
HIS8_ENTS8      -----------------------------------------------------------TLNRYPECQPK
PATR_RHOOB      ----------------------------------------------------------------------
HIS8_SYMTH      ----------------------------------------------------------------------
HIS8_SALTY      -----------------------------------------------------------TLNRYPECQPK
HIS8_SALSV      -----------------------------------------------------------TLNRYPECQPK
HIS8_SALPC      -----------------------------------------------------------TLNRYPECQPK
HIS8_SALHS      -----------------------------------------------------------TLNRYPECQPK
HIS8_SALG2      -----------------------------------------------------------TLNRYPECQPK
HIS8_SALEP      -----------------------------------------------------------TLNRYPECQPK
HIS8_SALDC      -----------------------------------------------------------TLNRYPECQPK
HIS8_SALA4      -----------------------------------------------------------TLNRYPECQPK
HIS8_METVS      ----------------------------------------------------------------------
HIS8_GRABC      ---------------------------------------------------------------GSHALRE
HIS82_BORPA     ----------------------------------------------------------------------
HIS82_BORBR     ----------------------------------------------------------------------
HIS8_SALCH      -----------------------------------------------------------TLNRYPECQPK
HIS8_METBF      --DIAEYVPGKSIEEIASAYGLDPASIIKLGSNENPLGPSPKAVQAMMDT--APFANIYPS-------AD
HIS8_ECOSE      -----------------------------------------------------------TLNRYPECQPK
HIS8_ECOLI      -----------------------------------------------------------TLNRYPECQPK
HIS8_ECOHS      -----------------------------------------------------------TLNRYPECQPK
HIS8_ECODH      -----------------------------------------------------------TLNRYPECQPK
HIS8_ECOBW      -----------------------------------------------------------TLNRYPECQPK
HIS8_ECO8A      -----------------------------------------------------------TLNRYPECQPK
HIS81_ANAVT     ----------------------------------------------------------------------
HIS8_METM5      ----------------------------------------------------------------------
HIS8_CHLPD      ----------------------------------------------------------------------
HIS82_MANSM     -------------------------------------------------------------NRYPEPQPE
HIS82_BORPE     ----------------------------------------------------------------------
HIS8_RHOCS      -------------------------------------------------AVEAFRAVGPEIHRGSTRLRE
HIS8_ACICJ      ----------------------------------------------------------------------
PATR_CORGL      -------------------------DATKLSSNEVSFPLP-----AAVDAVTEATANRYP-DMGAVELRE
HIS8_YERPS      -----------------------------------------------------------TFNRYPECQPK
HIS8_YERPB      -----------------------------------------------------------TFNRYPECQPK
HIS8_SHIDS      -----------------------------------------------------------TLNRYPECQPK
HIS8_SHIB3      -----------------------------------------------------------TLNRYPECQPK
HIS8_SALPB      -----------------------------------------------------------TLNRYPECQPK
HIS8_SALNS      -----------------------------------------------------------TLNRYPECQPK
HIS8_ECO27      -----------------------------------------------------------TLNRYPECQPK
PATR_MYCSS      ----------------------------------------------------------------------
PATR_MYCSK      ----------------------------------------------------------------------
PATR_MYCSJ      ----------------------------------------------------------------------
PATR_CORGB      ---------------------------------------------AAVDAVEATQGANRYPDMGAVELRE
HIS8_SHIBS      -----------------------------------------------------------TLNRYPECQPK
HIS8_METAC      --EIAEYVPGKSIEEIAAAYGIDPPSIIKLGSNEPLGPSPK-----AVRALVETAPGANIYPSADARELR
HIS8_ECO55      -----------------------------------------------------------TLNRYPECQPK
HIS8_ECO24      -----------------------------------------------------------TLNRYPECQPK
HIS8_CITK8      -----------------------------------------------------------TLNRYPECQPK
HIS8_AGRT5      --------------------------------------TPLGPSPKAIEAFSAAASHLEIYPDGQAALRQ
HIS8_SHISS      -----------------------------------------------------------TLNRYPECQPK
HIS8_ECOLU      -----------------------------------------------------------TLNRYPECQPK
HIS8_ECO5E      -----------------------------------------------------------TLNRYPECQPK
HIS8_ECO57      -----------------------------------------------------------TLNRYPECQPK
HIS8_ECO45      -----------------------------------------------------------TLNRYPECQPK
HIS8_THEPX      ----------------------------------------------------------------------
HIS8_THEP3      ----------------------------------------------------------------------
HIS8_SHIFL      -----------------------------------------------------------TLNRYPECQPK
HIS8_SHIF8      -----------------------------------------------------------TLNRYPECQPK
HIS8_SALTI      -----------------------------------------------------------TLNRYPECQPK
HIS8_RHORT      ------------------------------------------------DALIASAGEAHRYPDGNAT---
HIS8_ECOLC      -----------------------------------------------------------TLNRYPECQPK
HIS8_YERPY      -----------------------------------------------------------TFNRYPECQPK
HIS8_YERPP      -----------------------------------------------------------TFNRYPECQPK
HIS8_YERPN      -----------------------------------------------------------TFNRYPECQPK
HIS8_YERPG      -----------------------------------------------------------TFNRYPECQPK
HIS8_YERPE      -----------------------------------------------------------TFNRYPECQPK
HIS8_YERPA      -----------------------------------------------------------TFNRYPECQPK
HIS8_YERP3      -----------------------------------------------------------TFNRYPECQPK
HIS8_RHOP5      --------------------------------------TPFGPSPHAIAAYQSAADHLEDYPEGTSRVLR
HIS82_THICR     ----------------------------------------------------------------------
HIS8_SALAR      -----------------------------------------------------------TLNRYPECQPK
HIS8_ECOUT      -----------------------------------------------------------TLNRYPECQPK
HIS8_ECOL6      -----------------------------------------------------------TLNRYPECQPK
HIS8_ECOL5      -----------------------------------------------------------TLNRYPECQPK
HIS8_ECO81      -----------------------------------------------------------TLNRYPECQPK
HIS81_PASMU     -----------------------------------------------------------TFNRYPEPQPQ
PATR_NOCFA      ----------------------------------------------------------------------
PATR_MYCMM      --------------------------AIKLASNETVFGPLPSVRAAIEHATQS--INRYPDN-GCLAVKA
HIS8_ENT38      -----------------------------------------------------------TLNRYPECQPK
PATR_MYCUA      --------------------------AIKLASNETVFGPLPSVRAAIEHATQS--INRYPDN-GCLAVKA
PATR_MYCPA      ----------------------------------------------------------------------
PATR_MYCA1      ----------------------------------------------------------------------
HIS8_AKKM8      ----------------------------------------------------------------------
HIS8_PELUB      ----------------------------------------------------------------------
HIS8_HALWD      ----------------------------------PHGPSP-----AAVDAIADTAETVNTYPKSSHTDLT
HIS8_PARDP      ---------------------AGVENVVKLSSNENPFGPSDKAREAMIRAAHGLHRYPNTDHAG---LRG
HIS8_ECO7I      -----------------------------------------------------------TLNRYPECQPK
HIS8_CHLP8      ----------------------------------------------------------------------
HIS82_PASMU     ---------------------------IKLASNENPFGLPDSAKQAILAELDN--LTRYPDSNG------
HIS8_YERE8      -----------------------------------------------------------TFNRYPECQPK
HIS8_RHOPT      --------------------------------------TPFGPSPHAIAAYKSAADHLEDYPEGTSRILR
HIS8_RHOPA      --------------------------------------TPFGPSPHAIAAYKSAADHLEDYPEGTSRILR
HIS8_METS3      VSEMDSYVPGKSQDEIASEFNLNKDDIIKLGSNENPFGP-------SAKAIEAIGKECKNINRYPESVLN
HIS8_KLEP3      -----------------------------------------------------------TMNRYPEPQPK
HIS8_ECOSM      -----------------------------------------------------------TLNRYPECQPK
PATR_COREF      -------------------------DALKLSSNEVAFPP----LPAAVSAITEAATGANRYPDMGAVELR
HIS8_NITWN      ----------------------AGRKVFKLSANETPFPSPK-----AMDAYRDAVAHLEDYPEGTSRVLR
HIS8_META3      ----------------------------------------------------------------------
HIS8_ERWCT      -----------------------------------------------------------TLNRYPECQPV
HIS82_BRAJA     --------------------------------------TPFGPSPKAIEAFKKVADHLEDYPEGTSRVLR
HIS81_HAEI8     ---------------------------------------------------------GKDLNRYPEPQPQ
DAPAT_CHLTB     ---------------------------INLSIGDTTQPLNASVAEAFASSIARLSSPTTCRGYGPDFGLP
DAPAT_CHLT2     ---------------------------INLSIGDTTQPLNASVAEAFASSIARLSSPTTCRGYGPDFGLP
HIS8_PECCP      -----------------------------------------------------------TLNRYPECQPV
HIS8_MACCJ      --------AGLSEEALKRKFNVEGEFSRLASNENPIGPSPQ-----VYEAIRSQDALNYYPDP------E
HIS8_ESCF3      -----------------------------------------------------------TLNRYPECQPK
HIS8_CHRVO      ----------------------------------------------------------------------
HIS81_ARCFU     ----------------------------------------------------------------------
HIS81_ANASP     ----------------------------------------------------------------------
HIS8_STAAW      ----------------------------------------------------------------------
HIS8_STAAS      ----------------------------------------------------------------------
HIS8_HAEIG      ---------------------------------------------------------GKDLNRYPEPQPQ
HIS8_HAEIE      ---------------------------------------------------------GKDLNRYPEPQPQ
HIS8_ECOK1      -----------------------------------------------------------TLNRYPECQPK
HIS82_NITEU     ------------------------DEVVKLASNENPLGTSPLAKEAMIQALNESAR--YPDGSGFEL---
HIS81_RALSO     ---------------------------------------PYHLPAMLRDALGKRLAE-VALNRYPVPTAD
HIS81_HAEIN     ---------------------------------------------------------GKDLNRYPEPQPQ
HIS8_KLEP7      -----------------------------------------------------------TLNRYPEPQPK
HIS8_CHLCH      ----------------------------------------------------------------------
PATR_LEIXX      -------------------------------LSSNENPYPPLASVVAAVGATLGGLNRYP-DAGGADLRD
HIS8_LACPL      ------------------------------------------------------------SNRYPDADAQ
HIS8_DESPS      ---------------------------------------PWGASPKAIKAIGESLGDMQRYPDGSAYYLT
HIS8_ANOFW      ------------------------ETVIKLASNENPYGCSPLVRQAVMNELDDLALDGYSRTL-------
DAPAT_CHLTR     ---------------------------INLSIGDTTQPLNASVAEAFASSIARLSSPTTCRGYGPDFGLP
DAPAT_CHLTA     ---------------------------INLSIGDTTQPLNASVAEAFASSIARLSSPTTCRGYGPDFGLP
ALAT_SCHPO      ------------------------------------FPT-DVVQRSKMLLKESGSLGAYSASQGIP----
HIS8_LEUMM      ----------------------------------------------------------------------
HIS81_RALEJ     ----------------------------------------------------------------------
DAPAT_BACV8     -------------------------DLIRLGIGDVTRPLPQTSIEAMYKAVDELANKGYGPEQGYDFLID
PATR_CORDI      ----------------------------------------------------------------------
HIS8_STAAR      ----------------------------------------------------------------------
HIS8_LEUCK      ----------------------------------------------------------------------
HIS8_COREF      ---------EVTLSDLPLREELRGESAVRLNTNENPYPPSEALIADLVETVRATATENRYPERDSVELRD
HIS82_RHILO     ----------------------------------------------AIEAAREVAARLDIYPDGTARLRE
HIS81_PSYA2     ----------------------------------------------------------------------
CBL_MYCLE       -------------------WRAHPEDVLPLWVAEMDVLLAPTVAEAVHRAVDNGDT-GYPYGTTFAEAIS
HIS8_THEGJ      ----------------------------------------------------------------------
HIS8_RHOPS      --------------------------------------TPFGPSPHAIAAYKSAADHLEDYPEGTSRVLR
HIS8_NITHX      ----------------------AGRKVFKLSANETPFPSPK-----AMDAYRNAVAHLQDYPEGTSRVLR
HIS81_MANSM     ---------------------------IKLASNENPFGFPESAKKAIQNQLDN--LTRYPDSNGFS-LKA
DAPAT_SYNPW     -------------------FSAANPDAIRLGIGDVTEPLPQACRDAMKTAIDAGTAEGYGPEQGYGWLRE
ALAM_YEAST      -----------------------------------------------------GSVGAYSSSQGVEGIRK
HIS8_STAAT      ----------------------------------------------------------------------
HIS8_STAAN      ----------------------------------------------------------------------
HIS8_STAAM      ----------------------------------------------------------------------
HIS8_STAAE      ----------------------------------------------------------------------
HIS8_STAAC      ----------------------------------------------------------------------
HIS8_STAAB      ----------------------------------------------------------------------
HIS8_STAA9      ----------------------------------------------------------------------
HIS8_STAA8      ----------------------------------------------------------------------
HIS8_STAA3      ----------------------------------------------------------------------
HIS8_STAA2      ----------------------------------------------------------------------
HIS8_STAA1      ----------------------------------------------------------------------
HIS8_PYRKO      ----------------------------------------------------------------------
HIS8_GEOBB      ----------------------------------------------------------------------
HIS83_RHILO     ---------------------------VKLNTNENPFPLPEIIMQSAIAALERQYL--YPED-------D
DAPAT_SYNS9     -------------------FSAANPEAIRLGIGDVTEPLPLACREAMKTAIDAGTAEGYGPEQGYAWLRE
HIS8_PHOLL      -----------------------------------------------------------TLNRYPDCQPA
HIS8_METST      LEEYKTYVPGRSKKEIAEEYGVAEESIIKLGSNENPWGPSPKAKQAIIDSIDE-------INRYPESNHE
HIS8_METBU      -------------------------------------------------------------------LVD
HIS8_GEOSM      -----------------------------------------------LEAIAKEAGEGLRRYPDAASVLA
HIS82_RALSO     ------------ISEVAREFGLEAARIVKLASNENPLGMPASARVAMTAAIDGLAANGFSLK---AAL--
HIS82_NITMU     ----------------------------------------------------------------------
HIS8_HAHCH      ----------------------------------------------------------------------
HIS81_IDILO     ----------------------------------------------------------------------
HIS8_BREBN      ----------------------------------------------------------------------
HIS83_BURS3     -----------------------------------------------------------------AALRS
HIS81_THIDA     ----------------------------------------------------------------------
HIS8_TOBAC      ----------------------------------------------------------------------
HIS8_LYSSC      --------------------------------------------------------DGYAQNLRTA----
HIS81_NITOC     ----------------------------------------------AIDAIYGGESGRYPDGNGFAL---
HIS8_VIBFM      ----------------------------------------------------------------------
HIS8_STAS1      -------------------------------------PKVKEAIQAHLDELQ------YYPETGSPLIKE
HIS8_RHOS1      ------------------------QNALKLSSNENPFGPSPKAKEAFLRSVHTLHRYPSTDHAG---LRH
HIS8_NICPL      ----------------------------------------------------------------------
HIS8_CLONN      ---------------------------------------------------------------------D
HIS8_BACA2      ------------------------EKVVKLASNENPFGCSQAAKDALHQEIEQLALDGYS-----AALRT
HIS82_CARHZ     ----------------------------------------------------------YYPDGGAFRLKE
DAPAT_BACFR     -------------------------DIIRLGIGDVTRPLPKACIEAMHKAVEEMTSAGYGPEQGYDFLIE
YJIR_ECOLI      ----------------------------------------------------------------------
HIS8_VIBPA      -------------------------------------------------------------NRYSECQPK
HIS8_STAHJ      ----------------------------------------------------------YYPETGSPSLRK
HIS8_RHOBA      ---------------------------IKLNTNENPYPPP----APVVSAIQSAATGPL--NRYPDPMAT
HIS8_HALVO      ----------------------------------------------------------------------
1A112_ARATH     ----------------------------------------------------------YKPFEGLLELRV
MOCR_RHIME      ---------------------------------------------------------GYHWVTGHPRLKA
HIS8_STAES      ----------------------------------------------------------------------
HIS8_STAEQ      ----------------------------------------------------------------------
HIS8_BACHD      ----------------------------------------------------------------------
HIS8_ACEPA      ---------------------------------------------------------------------E
HIS82_METCA     ----------------------------------------------------------------------
DAPAT_SYNR3     -------------------FSEANPDAIRLGIGDVTEPLPQACRDAMKNAIEMGTREGYGPEQGYAWLRE
DAPAT_BACFN     -------------------------DIIRLGIGDVTRPLPKACIEAMHKAVEEMTSAGYGPEQGYDFLIE
HIS8_VIBCM      -------------------------------------------------------------NRYSDCQPK
HIS8_VIBC3      -------------------------------------------------------------NRYSDCQPK
HIS8_SULSO      ------------------------KEGIRLHLNESPFEPP----QFIIDAVKM-----YLS-KGNRYQHP
HIS8_RHOS5      ------------------------QNALKLSSNENPFGPSPKAKEAFLRSVHTLHRYPSTDHAG---LRQ
HIS8_RHISN      ---------------------------VKLDTNENPFALPKAVMQSAVAALERQYL--YPED-------D
ARNB_ESCF3      -----------------------------------------------------------TTGPKNLALED
ALA2_PANMI      -----------------------------------------------LSTIPGRATGAYSHSQGIKGLRD
HIS8_VIBCH      -------------------------------------------------------------NRYSDCQPK
HIS8_RHOSK      ------------------------QNALKLSSNENPFGPSPKAKEAFLRSVHTLHRYPSTDHAG---LRH
HIS8_RHOS4      ------------------------QNALKLSSNENPFGPSPKAKEAFLRSVHTLHRYPSTDHAG---LRH
HIS8_ANADF      ----------------------------------------------------------------------
ALAM_DICDI      ----------------------------------------------------------YSNSQGIGLVLR
HIS8_VIBVY      ----------------------------------------------------------------------
HIS8_VIBHB      ----------------------------------------------------------------------
HIS8_METPP      -----------------------------------------HRLPAALQAELGRRLGALAINRYPGTRTD
HIS8_DESDG      ---------------------------------------------------------------GNPRLVS
DAPT1_ANAVT     -------------------FAEANPDAIRLGIGDVTEPLPEACRTAMIQAVEESSFKGYGPEQGYAWLRE
DAPAT_ACAM1     -----------------SAFAEANPDAIKLGIGDVTEPLPEACRSAMVTAVEDGNRDGYGPEQGYGWLRE
ALA2_HORVU      ------------------------------------FSADSISRAKQILAMIPGRATGYSHSQGIKGLRD
HIS8_PYRFU      ----------------------------------------------------------------------
HIS8_GEOTN      ----------------------------------------------------------------------
HIS8_DESVV      ---------------------------------------------------------------GNPRLTR
HIS8_DESVH      ---------------------------------------------------------------GNPRLTR
HIS8_BDEBA      ----------------------------------------------------------------------
DAPAT_SYNP6     ---------------------------IRLGIGDVTEPLPVACRQAMIQAVEDMGQKGYGPEQGYAWLRE
DAPAT_SYNE7     ---------------------------IRLGIGDVTEPLPVACRQAMIQAVEDMGQKGYGPEQGYAWLRE
DAPAT_CHLMU     ---------------------------INLSIGDTTQPLDTSVAEAFSQAIARFSSPGYGPDFGLPSLRQ
DAPAT_CHLAB     -TNFSNLEANYLFSGIRQKIQAFRKQIIDLSIGDTSYPLHTSVIHTFTQSVEKKTYRGYGPELGLPALRE
HIS8_METTH      -----------SIKEIADAYGLKEDEIIKLGSNEPLGPSP-----AAVEAMERELESVHRYPE--SALTD
HIS8_BACP2      ---------------------------VKLASNENPFGCSTHAREAIQAELEHLAIDGYSASLRTELA--
HIS82_NITOC     ----------------------------------------------------------------------
HIS81_CAUCR     ----------------------------------------------------------------------
ALAT1_HUMAN     -------------------------------LSSPNFP--DDAKKRALQACGGHSLGAYSVSSGIQLIRE
HIS8_SERP5      -----------------------------------------------------------TFNRYPECQPA
HIS8_LISW6      ----------------------------------------------------------------------
HIS8_CAMC5      -------------------FGIEAKDVIKLASNENPFGTSPHV----VEAIKSAASNAFLYPD------D
HIS81_BURPS     -------------------------------------PYPPSPR--ALDAIRRELGDGEALRRYPDPVAR
HIS81_BURP1     -------------------------------------PYPPSPR--ALDAIRRELGDGEALRRYPDPVAR
DAPT1_ANASP     -------------------FAEANPDAIRLGIGDVTEPLPAACRSAMIQAVEESSFKGYGPEQGYAWLRE
DAPAT_MICAN     -------------------FAAANPDAIRLGIGDVTEPLPLACREAMIKAVEESSFKGYGPEQGYAWLRE
DAPAT_BACTN     ------------------------QDIIRLGIGDVTQPLPKACIEAMHKAVEELASKGYGPEQGYDFLIE
HIS8_VIBF1      ----------------------------------------------------------------------
HIS8_LISMF      ----------------------------------------------------------------------
HIS8_LISMC      ----------------------------------------------------------------------
HIS8_LACF3      -----------------------------LSANENPYGTSPLVKEALINAINDGALNRYPD--GDASELR
HIS8_STACT      ----------------------------------------------------------------------
HIS8_MICAN      ----------------------------------------------------------------------
HIS8_LISMH      ----------------------------------------------------------------------
HIS8_DEHE1      ----------------------------------------------------------------------
HIS8_CYAP8      -------------------------DYIKLNTNENPYPPPDK--------IFEGLQQELTKVRLYPDPVS
HIS8_ARATH      ----------------------------------------------------------------------
HIS8_METI4      ----------------------------------------------------------------------
HIS8_MARMS      ----------------------------------------------------------------------
HIS8_BUCBP      ----------------------------------------------------------------------
HIS8_BACLD      --------------------------------------------------------DGYSA---------
ALAT2_MOUSE     -------------------------------LNSPSFPEDAKKRARRIQACGGNSLGSYSASQGVNCIRE
HIS8_VIBVU      ----------------------------------------------------------------------
HIS8_BACSU      ---------------IEAVKSEYGLDVVKLASNENPYGCSEAAKEALHHEIQQLALDGYSAALRTR----
HIS8_BACNA      ---------------IEAVKSEYGLDVVKLASNENPYGCSEAAKEALHHEIQQLALDGYSAALRTR----
HIS82_BURPS     -------------------------------LAMTGYPVPDATGFVKLDAMENPAAEHVALNRYPAPRPA
HIS82_BURP1     -------------------------------LAMTGYPVPDATGFVKLDAMENPAAEHVALNRYPAPRPA
HIS81_DECAR     ----------------------------------------------------------------------
HIS81_BURMA     -------------------------------LAMTGYPVPDATGFVKLDAMENPAAEHVALNRYPAPRPA
DAPAT_SYNSC     -------------------FSSANPDAIRLGIGDVTEPLPLACREAMKTAIDAGTAEGYGPEQGYGWLRE
Y1479_METJA     ---------------------------------------PDWIKDIIAEIVKNDCSYAYCPTKGLLETRE
HIS8_CLOK5      ---------------------------------------------------------------------D
HIS8_CLOK1      ---------------------------------------------------------------------D
HIS82_HAEIN     ----------------------------------------------------------------------
HIS82_HAEI8     ----------------------------------------------------------------------
HIS81_GLUOX     ------------------------------------------------------------------ASAE
HIS8_RHOSR      -------------------------------------------------------------DRDAVALRT
HIS8_GEOUR      ----------------------------------------------------------------------
HIS8_GEOSF      ----------------------------------------------------------------------
HIS8_FRAP2      -----------------------------------------------LNANESPYNDEYLYNRYPEPQPR
HIS8_BACFN      ----------------------------------------------------------------------
HIS82_PSYA2     ----------------------------------------------------------------------
HIS82_CAUCR     ----------------------------------------------------------------------
DAPAT_GEOSM     -------------------FAAANPEAIRLGIGQPLTPTILKAFHEAVDDLASNSFMGYGPEQGYDFLID
DAPAT_GEOBB     -------------------FAAANPEAIRLGIGDVTQPLTPTILKAFHDAVDDLASEGYGPEQGYDFLID
ARNB_ERWT9      ----------------------------------------------------------------------
HIS8_THEMA      -------------------YETEKRDKTYLALNENPFPFPEDLVDEVFRRLNSDALRIYYDSPD-----E
HIS8_STRMU      ----------------------------------------------------------------------
HIS8_NEIMF      ----------------------------------------------------------------------
HIS8_NEIMA      ----------------------------------------------------------------------
HIS8_NEIM0      ----------------------------------------------------------------------
HIS8_METMJ      -------------------------------------PPSPAALEAATVALRE--VNRYPDER-TSVLVE
HIS8_LISIN      ----------------------------------------------------------------------
HIS8_DEHSC      ----------------------------------------------------------------------
HIS8_DEHSB      ----------------------------------------------------------------------
HIS8_CLOCE      ---------------------------------------------------------------------D
HIS82_PSEF5     ----------------------------------------------------------------------
HIS82_BURMA     -------------------------------------PYPPSPR--ALDAIRRELGDGEALRRYPDPVAR
YDFD_BACSU      ----------------------------------------------------------------------
HIS8_SULTO      ----------------------------------------------------------------------
HIS8_LISMO      ----------------------------------------------------------------------
HIS8_BACFR      ----------------------------------------------------------------------
HIS8_AZOSE      ----------------------------------------------------------------------
DAPAT_GEOLS     -------------------FTAANPSAIRLGIGRPLAPTVLKAFHAAVDDLATDQFAGYGPEQGYDWLIN
HIS8_THESQ      -------------------YETEKRDKTYLALNENPFPFPEDLVDEVFRRLNSDALRIYYDSPD-----E
HIS8_NEIMB      ----------------------------------------------------------------------
HIS8_NATPD      --DLSHHVAYEAGRGIEEVARELGDDLVKLSSNENPFPSPKAAREHAVNSYPKAAATDLRGEIGDLLSVD
HIS8_METM6      ----------------------------------------------------------------------
HIS8_BAUCH      ----------------------------------------------------------------------
HIS8_ARTAT      ----------------------------------------------------------------------
HIS8_ALISL      ----------------------------------------------------------------------
HIS81_BRAJA     ----------------------------------------------------------------------
ALAT2_HUMAN     -------------------------------LDSPSFPEDAKKRARRIQACGGNSLGSYSASQGVNCIED
1A14_SOLLC      ----------------------------------------------------------------------
HIS8_THIRO      ---------------------------IKLDAMENPYGWPDTLKAEWLEGMHDLALNRYPDPQGTA----
HIS8_NEIG2      ----------------------------------------------------------------------
HIS8_NEIG1      ----------------------------------------------------------------------
HIS8_GEOSW      ----------------------------------------------------------------------
HIS8_GEOKA      ----------------------------------------------------------------------
DAPAT_PARD8     ---------------------------IRMGIGQPLAPAVIEAMHKAVEEMASDTFHGYGPEQGYPFLID
1A12_ARATH      ----------------------------------------------------------------------
HIS8_ROSS1      ----------------------------------------------------------------------
HIS8_GRAFK      ------------------------------------------AEMVFLDANENPNDNGL--NRYPDPQQT
HIS82_OCEIH     ----------------------------------------------------------------------
HIS82_BURS3     -------------------------------------PYPPSPRVVAAIARELGET-GDTLRRYPDPVAR
DAPAT_SYNS3     -------------------FSSANPEAIRLGIGDVTEPLPQACRDAMKSAIEMGTAEGYGPEQGYAWLRE
DAPAT_SYNJA     -------------------FAAAHPEAIKMGIGDVTEPLPEACRTAMIRAVEEATFRGYGPEQGYEWLRQ
ARNB_KLEP7      ----------------------------------------------------------------------
1A1C_SOYBN      ------------------------------------------------------AIANFQDYHGLPEFRN
1A1C_PHAAU      ------------------------------------------------------AIANFQDYHGLAEFRN
HIS8_STRSV      ----------------------------------------------------------------------
ARNB_KLEP3      ----------------------------------------------------------------------
ARNB_ECO5E      ----------------------------------------------------------------------
ARNB_ECO57      ----------------------------------------------------------------------
1A111_ARATH     ---------------------------------------------------------------GLPAFKD
HIS8_SHEON      -----------------------------------------NANESPFNNVAVGELDLTKLNRYPECQPP
HIS8_SHEAM      ----------------------------------------------------------------------
HIS8_PARD8      ----------------------------------------------------------------------
HIS8_BUCAT      ----------------------------------------------------------------------
HIS8_BUCAI      ----------------------------------------------------------------------
HIS8_BUCA5      ----------------------------------------------------------------------
HIS82_PSEPF     ----------------------------------------------------------------------
DAPAT_SYNJB     ---------------------------IKMGIGDVTEPLPEACRTAMIRAVEEATFRGYGPEQGYEWLRQ
DAPAT_GEOUR     ---------------VRAFAEAPSAKVIRLGIGRPLAPAVLKAFHAAVDDL--GTTDGYGPEQGYDWLIN
CBL_MYCTU       -------------------------DVLPLWVAEMDVKLPPTVADALRRAIDDGDT-GYPYGTEYAEAVR
CBL_MYCBO       -------------------------DVLPLWVAEMDVKLPPTVADALRRAIDDGDT-GYPYGTEYAEAVR
1A110_ARATH     ------------------------DGVIQLGLAQNNKLSLDNPKEAISDGLSISGIASYEPSDGLLELKM
PATR_CORJK      ----------------------------------------------------------------------
HIS8_JANSC      ----------------------------------------------------------------------
HIS8_GEOSL      ----------------------------------------------------------------------
HIS8_CYAA5      ----------------------------------------------------------------------
HIS8_BUCSC      ----------------------------------------------------------------------
ARNB_SHISS      ----------------------------------------------------------------------
ARNB_SHIFL      ----------------------------------------------------------------------
ARNB_SHIF8      ----------------------------------------------------------------------
ARNB_SHIBS      ----------------------------------------------------------------------
ARNB_PROMH      ----------------------------------------------------------------------
ARNB_ECOSM      ----------------------------------------------------------------------
ARNB_ECOSE      ----------------------------------------------------------------------
ARNB_ECOLU      ----------------------------------------------------------------------
ARNB_ECOLC      ----------------------------------------------------------------------
ARNB_ECO8A      ----------------------------------------------------------------------
ARNB_ECO81      ----------------------------------------------------------------------
ARNB_ECO7I      ----------------------------------------------------------------------
ARNB_ECO55      ----------------------------------------------------------------------
ARNB_ECO24      ----------------------------------------------------------------------
AATR1_SCHPO     -----------------------------------------------------------------AALLS
1A17_ARATH      ----------------------------------------------------------------------
1A12_CUCPE      ----------------------------------------------------------------------
HIS8_THEP1      -------------------YETEKRDRTYLALNENPFPFPEDLVDEVFRRLNSDTLKIYYDSPD-----E
HIS82_BACC1     ----------------------------------------------------------------------
DAPAT_LEPIC     ---------------------------IRLGIGDVTLPIVPSVVDAMVEASKEGGFHGYGPEQGYSFLLK
DAPAT_HELMI     -------------------------DIIRLGIGRPLVPAVVEAMKKAVD--EMGRAEGYGPEQGYDFLIG
ARNB_SALTY      ----------------------------------------------------------------------
ARNB_SALSV      ----------------------------------------------------------------------
ARNB_SALPK      ----------------------------------------------------------------------
ARNB_SALPC      ----------------------------------------------------------------------
ARNB_SALPA      ----------------------------------------------------------------------
ARNB_SALNS      ----------------------------------------------------------------------
ARNB_SALHS      ----------------------------------------------------------------------
ARNB_SALCH      ----------------------------------------------------------------------
ARNB_ECOLI      ----------------------------------------------------------------------
ARNB_ECOHS      ----------------------------------------------------------------------
ARNB_ECODH      ----------------------------------------------------------------------
ARNB_ECOBW      ----------------------------------------------------------------------
1A12_SOLLC      ----------------------------------------------------------------------
MFNA_METKA      ----------------------------------------------------------------------
HIS82_PSEAE     ----------------------------------------------------------------------
DAPAT_THEEB     ---------------------------IRLGIGDVTEPLPAACREAMIKAVEEATFKGYGPEQGYPWLRE
DAPAT_LEPIN     ---------------------------IRLGIGDVTLPIVPSVVDAMVEASKEGGFHGYGPEQGYSFLLK
DAPAT_GEOSF     ---------------VRAFAEAPSAKVIRLGIGDVTRPLAPAVLKAFHDAVDDLATTGYGPEQGYDWLIN
DAPAT_CLOTH     ---------------------------IRLGIGDVTKPLAPAVIDALHKAVDEMAKEGYGPEQGYSFLVS
ARNB_ENT38      ----------------------------------------------------------------------
ARNB_ECOUT      ----------------------------------------------------------------------
ARNB_ECOL6      ----------------------------------------------------------------------
ARNB_ECOL5      ----------------------------------------------------------------------
ARNB_ECOK1      ----------------------------------------------------------------------
ARNB_ECO45      ----------------------------------------------------------------------
ARNB_ECO27      ----------------------------------------------------------------------
1A1C_DIACA      ----------------------------------------------------------------------
1A14_ARATH      ---------------------------------------------------------------GLSSFKN
DAPAT_CHLCV     ----------------------------------------------------------------------
HIS8_GEOMG      ----------------------------------------------------------------------
HIS8_FRASC      ----------------------------------------------------------------------
HIS8_COLP3      ----------------------------------------------------------------------
HIS81_RHILO     ----------------------------------------------------------------------
DEGT_BACST      ----------------------------------------------------------------------
DAPAT_DESDA     -------------------FKNANPDVISLGIGDVTRPLPPAVIQALHKAVEMGDATGYGPEQGYAFLRD
DAPAT_CYAP7     ---------------------------IKLGIGDVTEPLPQACRQAMIKAVEEATFKGYGPEQGYNWLRE
HIS8_PSEST      ----------------------------------------------------------------------
HIS8_FLAJ1      ----------------------------------------------------------------------
DAPAT_PARUW     ---------------------------INLGIGDTTQPIPLYISEAMQNFAKQLASEGYGTEQGSILLRE
ALAT1_BOVIN     -------------------------------LNSPDFP--DDAKRRALQACGGHSLGAYSISAGVQMIRE
1A1C_MALDO      ------------------------------------------------------------------AMVD
1A18_ARATH      ------------------------------------------------------------------AMAD
1A11_CUCPE      ----------------------------------------------------------------------
HIS8_MYCLE      -------------------------------------------------------------DRDAVALRQ
HIS8_MYCLB      -------------------------------------------------------------DRDAVALRQ
HIS8_HELHP      ----------------------------------------------------------------------
HIS8_CYTH3      ----------------------------------------------------------------------
DAPAT_PROM3     -------------------FSEANPDAIRLGIGDVTEPLPLACRNAMKVAIDEMGTNGYGPEQGYDWLRE
DAPAT_CHLFF     ---------------------------------------------------------GYGPELGLPALKE
ARNB_EDWI9      ----------------------------------------------------------------------
HIS8_BUCAP      ----------------------------------------------------------------------
HIS8_BRAHW      ----------------------------------------------------------------------
HIS8_BACSK      ---------------------------------------PYGASPAVAKAIADGASKTYPDGYGTA-LRK
HIS82_BACCR     ----------------------------------------------------------------------
HIS82_BACAN     ----------------------------------------------------------------------
DAPAT_LEPBL     ---------------------------IRLGIGDVTLPIVPSVVDAMIAASKAGGFHGYGPEQGYSFLLK
DAPAT_LEPBJ     ---------------------------IRLGIGDVTLPIVPSVVDAMIAASKAGGFHGYGPEQGYSFLLK
ARNB_SERP5      ----------------------------------------------------------------------
ARNB_SALPB      ----------------------------------------------------------------------
ARNB_SALG2      ----------------------------------------------------------------------
ARNB_SALEP      ----------------------------------------------------------------------
ARNB_SALDC      ----------------------------------------------------------------------
ARNB_SALA4      ----------------------------------------------------------------------
HIS8_THENN      -------------------YETEKRDRIYLALNENPFPFPKELTEEVFRKLEGDKMRIYYDSPD-----E
HIS82_DECAR     ----------------------------------------------------------------------
HIS82_BACHK     ----------------------------------------------------------------------
GLDSA_STRRI     ----------------------------------------------------------------------
DAPAT_PROMA     ---------------------------IRLGIGDVTEPLPQACCKAMKTAIEEMGSTGYGPEQGYLWLRE
DAPAT_METS3     ----------VEVARREAEFQKNNPDAIKMGIGKPLAPSVIKAFQGAVD--EMGNADGYGPEQGYDFLAE
DAPAT_GEOSL     -------------------FAAANPSAIRLGIGDVTRPLAPAVIKAFHEAVDDLATTGYGPEQGYDWLIN
DAPAT_EUBE2     -----------------AAYQQANPDKIRLGIGQPLAPAVIDALHKSVD--EMGHAEGYAPDLGYEFLRS
DAPAT_CYAP4     -------------------FAAAQPDAIRLGIGDVTEPLPAACRTAMIKAVEDSSFRGYGPEQGYEWLRQ
DAPAT_CYAA5     ---------------------------IKLGIGDVTEPLPEACRTAMIKAVEDSSFKGYGPEQGYGWLRE
COBD_THETN      ----------------------------------------------------------------------
ARNB_PECCP      ----------------------------------------------------------------------
1A11_CUCMA      ----------------------------------------------------------------------
HIS8_SYNY3      ----------------------------------------------------------------------
HIS8_LACLS      ----------------------------------------------------------------------
HIS8_CLOAB      ----------------------------------------------------------------------
DAPAT_PROM4     --EISRRVNDFSTANPKA-------DLIRLGIGDVTEPLPKNAMQLAIEEMSTEAGHGYGPEQGYSWLRE
ARNB_YERPY      ----------------------------------------------------------------------
ARNB_YERPS      ----------------------------------------------------------------------
ARNB_YERPP      ----------------------------------------------------------------------
ARNB_YERPN      ----------------------------------------------------------------------
ARNB_YERPG      ----------------------------------------------------------------------
ARNB_YERPE      ----------------------------------------------------------------------
ARNB_YERPB      ----------------------------------------------------------------------
ARNB_YERPA      ----------------------------------------------------------------------
ARNB_YERP3      ----------------------------------------------------------------------
ALAT1_MOUSE     -------------------------------LSSPDFPEDAKRRERILQACGGHSLGAYSISSGIQPIRE
1A1L1_MOUSE     ----------------------------------------------------------------------
1A19_ARATH      ----------------------------------------------------------------------
1A16_ARATH      ----------------------------------------------------------------------
HIS8_PHOPR      -----------------------------------------------LNANESPFANEYSVNRYSECQPA
HIS81_BORPA     ----------------------------------------------------------------------
HIS81_BORBR     ----------------------------------------------------------------------
DAPAT_SYNPX     -------------------FSAANPDAIRLGIGDVTEPLPLACREAMKTAIDAGTAEGYGPEQGYGWLRE
DAPAT_NOSP7     -------------------FAEANPDAIRLGIGDVTEPLPEACRTAMIKAVEDNTFKGYGPEQGYAWLRE
HIS8_ACIBS      ----------------------------------------------------------------------
DAPAT_PROMM     -------------------FSEANPDAIRLGIGDVTEPLPLACRNAMKVAIDEMGTNGYGPEQGYDWLRK
DAPAT_GEOMG     -------------------FSAANPEAIRLGIGDVTRPLAPAIIKAFHDAVDDLATAGYGPEQGYDWLIN
DAPAT_DESAH     -----------------------GVDIIRLGIGDVTHALPDACVAAFHRGVDEMANDGYGPEQGYAFLRE
DAPAT_CHLPN     ----------------------------------------------------------------------
ARNB_YERE8      ----------------------------------------------------------------------
ARNB_SODGM      ----------------------------------------------------------------------
ARNB_SALTI      ----------------------------------------------------------------------
ARNB_PSEU2      ----------------------------------------------------------------------
HIS8_SULNB      ----------------------------------------------------------------------
HIS8_DESHY      ----------------------------------------------------------------------
HIS8_CELJU      ----------------------------------------------------------------------
HIS82_BACCZ     ----------------------------------------------------------------------
HIS81_BORPE     ----------------------------------------------------------------------
GLDSA_STRFR     ----------------------------------------------------------------------
AADAT_RAT       -------------SPIRATVEIAPKDIISLAPGSPNFPF-----KSAVFTVENGSALQYSSSYGIPELLS
1A1L1_HUMAN     ----------------------------------------------------------------------
1A15_ARATH      ----------------------------------------------------------------------
HIS8_ROSCS      ----------------------------------------------------------------------
HIS8_CORGL      --------------------------------------------------------------RDAVELRD
HIS8_CORGB      --------------------------------------------------------------RDAVELRD
HIS8_ARCB4      -------------------------------------------------------------------LKD
HIS8_ACIBT      ----------------------------------------------------------------------
DAPAT_DESHY     -------------------------DIIRLGIGDVTRPLAPVVVEAMKQAVEEGRAEGYGPEQGYDFLIE
DAPAT_DESHD     -------------------------DIIRLGIGDVTRPLAPVVVEAMKQAVEEGRAEGYGPEQGYDFLIE
DAPAT_CLOPH     --------------------ENPDKNVISLGIGDVTLPLAPSIISALHKATDEMAAKGYSPDLGYEFLRS
ARNB_AERS4      ----------------------------------------------------------------------
1A12_CUCMA      ---------------------------------------------------------------GLPAFKK
HIS8_CHRSD      ------------------------------------------------------------------ALRE
HIS8_ACIB5      ----------------------------------------------------------------------
HIS8_ACIB3      ----------------------------------------------------------------------
HIS81_OCEIH     ----------------------------------------------------------------------
DAPAT_METST     ---------------------------IKMGIGDVTRPLAKSVVEAFKRAVELGDADGYGPEQGYDFLIE
DAPAT_DESPS     ------------------------KEVIKLGIGDVTTPSVIAAFHQAVDEMANDSTHGYGPEQGYAFLRE
ALAT1_RAT       -------------------------------LSSPDFPEDAKRRERILQACGGHSLGAYSISSGIQPIRE
HIS8_VESOH      ----------------------------------------------------------------------
HIS8_DIAST      ----------------------------------------------------------------------
GLDSA_STRKN     ----------------------------------------------------------------------
DAPAT_PELPD     ---------------VRAFAEANPQNVIRLGIGDVTRPLPPAILKAFHDAVDDLAKAGYGPEQGYDWLIN
DAPAT_METTH     -------------------------DIIRMGIGDVTRPLPEAVVEAFHRAVDEMAEEGYGPEQGYPFLRE
DAPAT_AZOPC     -------------------------EVISLGIGD----VTQAIAPAVVEAIHKATNEGYAPYEGYDFLIQ
1A1L1_BOVIN     ----------------------------------------------------------------------
HIS8_STRTD      ----------------------------------------------------------------------
HIS8_RHOOB      -------------------------------------------------------------DRDAVALRT
HIS8_BIFLO      ----------------------------------------------------------------------
HIS8_ACIBY      ---------------------------------------------------------------------D
HIS8_ACIBC      ---------------------------------------------------------------------D
DAPAT_PROMT     --EISRRITEFSSKNPNA-------DLIRLGIGDVTEPLPLACREAMKAAIEEGTKDGYGPEQGYKWLRE
DAPAT_PELCD     -------------------FSQANPEAIRLGIGDVTQPLAPAVLKAFHDGVDDLANKGYGPEQGYEFLID
DAPAT_EUBR3     -----------------AAYQEANPDKIRLGIGQPLAPAIIDALHKAVDEMGNAATHGYAPDLGYEFLRK
AVTA_ECOLI      --------------------------AIMLGGGNPQIPEQDYFQTLLTDMLESGKATNYDGPQGKTELLT
AADAT_HUMAN     ----------------------------------------------------------------------
HIS8_MYCUA      ----------------------ASQLAVPVRLSTNENPHPP--TQALVDDVVRSVGEAAVDDRDAVALRT
HIS8_LACLM      ----------------------------------------------------------------------
ARNB_PHOLL      ----------------------------------------------------------------------
ARNB_ERWCT      ----------------------------------------------------------------------
AADAT_BOVIN     ----------------------------------------------------------------------
PTSJ_SALTY      ----------------------------------------------------------------------
ARNB_PSEPF      ----------------------------------------------------------------------
ALAT2_XENTR     ---------------------------------------PEDVKQKAARILQAHSIGAYSASQGIEVIRQ
1A11_PRUMU      ----------------------------------------------------------------------
1A11_ORYSJ      ---------------------------------------------------------------GLPAFKN
1A11_ORYSI      ---------------------------------------------------------------GLPAFKN
HIS8_PELCD      ----------------------------------------------------------------------
DAPAT_SYNP2     ---------------------------IKLGIGDVTEPLPAACREAMAKAIDDANFKGYGPEQGYAWLRE
ARNB_PSEF5      ----------------------------------------------------------------------
AADAT_MOUSE     ----------------------------------------------------------------------
NTDA_BACSU      ----------------------------------------------------------------------
NORG_STAAC      ---------------------------------------------------------GYNNGYGYIKLRD
NORG_STAA8      ---------------------------------------------------------GYNNGYGYIKLRD
NORG_STAA3      ---------------------------------------------------------GYNNGYGYIKLRD
HIS8_POLNA      ----------------------------------------------------------------------
HIS8_BACTN      ----------------------------------------------------------------------
HIS81_NITMU     ----------------------------------------------------------------------
HIS81_NITEU     ----------------------------------------------------------------------
DAPAT_TRIEI     ---------------------------IKLGIGDVTEPLPKACIQAMTKAVDRSTFKGYGPEQGYAWLRE
DAPAT_PROM1     --EISRRITEFSSKNPNA-------NLIRLGIGDVTEPLPLACREAMKAAIEEGTEDGYGPEQGYKWLRE
ARNB_PSEAE      ----------------------------------------------------------------------
ARNB_PSEAB      ----------------------------------------------------------------------
ARNB_PSEA8      ----------------------------------------------------------------------
ARNB_PSEA7      ----------------------------------------------------------------------
HIS8_STRGC      ----------------------------------------------------------------------
HIS8_MYCMM      ---------------------------------------PHPPTQALVDDVVRSVGEAAVDDRDAVALRT
HIS8_CLOBK      ----------------------------------------------------------------------
HIS81_BACC1     ----------------------------------------------------------------------
GLDSA_STRSD     ----------------------------------PVWPQP---ARGALDALERVLRSGRWAISGPYRGIE
ARO8_YEAST      ----------------------------------------------------------------------
1A13_SOLLC      ----------------------------------------------------------------------
HIS8_CLOB8      ----------------------------------------------------------------------
HIS8_CAMLR      ----------------------------------------------------------------------
1A1C_TOBAC      ----------------------------------------------------------------------
HIS8_SULDN      ----------------------------------------------------------------------
HIS8_ACISJ      ----------------------------------------------------------------------
HIS82_GLUOX     ----------------------------------------------------------------------
ARNB_AERHH      ------------------------------------------SRPAIGDAEISAVCDVLKSGWITTGPKN
NORG_STAAB      ---------------------------------------------------------GYNNGYGYIKLRD
HIS8_XANC5      ----------------------------------------------------------------------
HIS83_RHIME     ----------------------------------------------------------------------
NORG_STAAN      ---------------------------------------------------------GYNNGYGYIKLRD
NORG_STAAM      ---------------------------------------------------------GYNNGYGYIKLRD
HIS8_CAMC1      ----------------------------------------------------------------------
GSA_MYCSS       -----------------------------------------HAHPAVVEAVQRVAADGLSFGAPTPSLAS
GSA_MYCSK       -----------------------------------------HAHPAVVEAVQRVAADGLSFGAPTPSLAS
DAPAT_DESOH     ------------------------QSIIKLGIGQPLCPACLDAFHKAVDEMGTASSRGYGPEQGYAFLRE
COBD_SALTY      ----------------------------------------------------------------------
1A1L2_HUMAN     ----------------------------------------------------------------------
HIS8_HYDS0      ----------------------------------------------------------------------
DAPAT_ARATH     ----------------------------------------------------------------------
COBD_SALTI      ----------------------------------------------------------------------
HIS82_RHIME     -------------------------------------------------------------------LRQ
ALAT2_XENLA     ---------------------------------------PEDVKQKAARILQAHSIGAYSASQGIEVIRQ
HIS8_PSEU2      ----------------------------------------------------------------------
HIS8_CAMFF      ----------------------------------------------------------------------
GSA_MYCSJ       -----------------------------------------HAHPAVVEAVQRVAADGLSFGAPTPSLAS
DAPAT_PROM0     -------------------------DIIKLGIGDVTEPLPRACIEAMGKALEMGTTDGYGPEQGYSWLRE
ALAT_YEAST      ----------------------------------------------------------------------
HIS8_BUCDN      ----------------------------------------------------------------------
HIS8_BACCN      ----------------------------------------------------------------------
HIS8_ACIAD      ------------------------QNLLKLNTNENPYP-PSPKVKAAVETVLVDQADALRLYPDP----D
HIS8_ACIAC      ----------------------------------------------------------------------
GSA_PROAC       -----------------------------------------HARPEVVSAVQVAASKGLSPTRTETELAD
GLDSA_MICEC     ----------------------------------------------------------------------
1A11_ARATH      ----------------------------------------------------------------------
HIS8_PSEE4      ----------------------------------------------------------------------
HIS8_LACLA      ----------------------------------------------------------------------
HIS82_LEGPL     ----------------------------------------------------------------------
HIS82_LEGPH     ----------------------------------------------------------------------
DAPAT_LAWIP     ---------------------------IRLSIGDVTRPLVPAVIKALHDATDESSFHGYGPEHGYEFLIG
DAPAT_CYAP8     -------------------FAEANPDAIKLGIGDVTEPLPEACRTAMIKAIEDGTFKGYGPEQGYEWLRE
RFFA_ECOLI      ----------------------------------------------------------------------
HIS8_PROAC      ----------------------------------------------------------------------
HIS82_LEGPA     ----------------------------------------------------------------------
HIS81_BACCZ     ----------------------------------------------------------------------
GLADA_MICEC     ----------------------------------------------------------------------
Y2256_MYCBO     ----------------------------------------------------------YPSTDDVHRAQD
Y2231_MYCTU     ----------------------------------------------------------YPSTDDVHRAQD
MFNA_METST      ----------------------------------------------------------------------
HIS8_XANAC      ----------------------------------------------------------------------
HIS8_PSEPK      ----------------------------------------------------------------------
HIS8_PSE14      ----------------------------------------------------------------------
HIS8_DEIRA      ----------------------------------------------------------------------
HIS81_BACHK     ----------------------------------------------------------------------
HIS81_BACAN     ----------------------------------------------------------------------
GLYA_DIAST      -------------------------------------------------------AEGYPGKRGGCENVD
GLYA_ACISJ      -------------------------------------------------------AEGYPGKRGGCENVD
HIS8_XANCB      ----------------------------------------------------------------------
HIS8_SYNAS      ----------------------------------------------------------------------
HIS8_PSEPG      ----------------------------------------------------------------------
HIS8_CAMHC      ----------------------------------------------------------------------
MALY_ECOLI      ----------------------------------------------------------------------
DAPAT_PROM5     -----------------------GSEVIKLGIGDVTEPLPNACINAMSKALEMGTHEGYGPEQGYEWLRE
HIS8_NITSB      ----------------------------------------------------------------------
GCSPB_PYRHO     ----------------------------------------------------------------------
ALAT2_DANRE     ---------------------------------------PEDAKNRARRILQSNSIGAYTTSQGIDCVRQ


                         .         .         *         .         .         .         .:140
query           AIVEKHARDQGVDVAPAGVIATAGGSEALHLAMEAHVDPGDEVLFPDPGFVSYDALTRMAGGNPVGLPLR
AAT1_METJA      EISNKLKDDYNLDVDKDNIIVTCGASEALMLSIMTLIDRGDEVLIPNPSFVSYFSLTEFAEGKIKNIDLD
AAT_PYRHO       AVVEYYKKFYGIDIEVENVIITAGAYEGTYLAFESLLERGDEVIIPDPAFVSYAEDAKVAEAKPVRIPLR
AAT_PYRAB       AIAEKLKKQNNIEADPKEIMVLVGANQAFLMGLSAFLKDGEEVLIPTPAFVSYAPAVILAGGKPVEVPTE
AAT_BACST       EIIKKFARDQGLDYEPAEVIVCVGAKHALYTLFQVLLDEGDEVIIPTPYWVSYPEQVKLAGGVPVGLE-Q
AAT1_BACSU      SIAEKFKRDQNIEYKPSQIIVCTGAKHALYTLFQVILDEEDEVIIPTPYWVSYPEQVKLAGGKPVGLE-E
AAT_THEAQ       AVAEKFRRENGLEVTPEETIVTVGGKQALFNLFQAILDPGDEVIVLAPYWVSYPEMVRFAGGVPVEVPTE
AAT_BACY2       AIIEKFKRDNQLEYKPNEIIVGVGAKHVLYTLFQVILNEGDEVIIPIPYWVSYPEQVKLAGGVPVYIEAT
AAT_AQUAE       AIAEKLLKENKVEYKPSEIVVSAGAKMVLFLIFMAILDEGDEVLLPSPYWVTYPEQIRFFGGVPVEVPLK
AATA_RHIME      AIAKKFKRENNLDYTAAQTIVGTGGKQILFNAFMATLNPGDEVVIPAPYWVSYPEMVALCGGTPVFVPTR
AAT_STRVG       AIAAKTLRDSGYEVEASQVLVTNGGKQAIYEAFAAILDPGDEVIVPAPYWTTYPESIRLAGGVPVDV-VA
AAT_THET8       ALAEKFRRENGLSVTPEETIVTVGGKQALFNLFQAILDPGDEVIVLSPYWVSYPEMVRFAGGVVVEVETE
AAT_SYNY3       AIAKKLREKNNLPYEAANILVTNGGKHSLFNLMLAMIEQGDEVIIPAPYWLSYPEMVRLAEGTPVNTTAA
AATB1_RHIME     AIREKFQRENGLAYELDEITVATGAKQILFNAMMASLDPGDEVIIPTPYWTSYSDIVHICEGKPVACDAS
AATB2_RHIME     AIREKFQRENGLAYELDEITVATGAKQILFNAMMASLDPGDEVVIPTPYWTSYSDIVQICEGKPIACDAS
AAT_SULTO       KIAE-HLSSKYESVRKEEVIVTPGAKTALYLAFLLYINPGDEVIIFDPSFYSYAEVVKMLGGVPVYVKMK
AAT_SULSO       KIAQYLNTRYGTDVKKEEVIVTPGAKPALFLVFILYINPSDEVILPDPSFYSYAEVVKLLGGKPIYANLK
AAT_SULAC       KIASFLSSKYNTNISSKEVIITPGAKVSLYLAFLLYVNPGDEVIIFDPSYYSYPEVVKMLGGKPVYVKMR
DAPAT_CARHZ     AVAAWYARRFGVELDPTEVVSLLGSKEGIAHISWCYVDPGDLVLVPDPGYPVYEGGTILAGGTTYKMPLK
PATA_BACSU      AVYMKKKADFNYD-AESEIIITTGASQAIDAAFRTILSPGDEVXXXXXXXXXXXXXXNLCGAKPVIVDTT
AAT_RICBR       AIQAKFKRENNIDYDLEEIIVSTGGKQVIYNLFMASLNKGDEVIIPAPYWVSYPDMVLLAEGTPVNCGIE
AAT_RHILP       AIAAKFKRENGLDYSWEQTIVGTGGKQILFNAFMATLNPGDEVSIPAPYWVSYPEMVALCGGTRVSATQE
DAPAT_HALOH     TVADWYKNNYGRELDPKEVVSLIGSKEGIAHLPFCYINPGDIALVPDPGYPVYKTSVLLAGGKPVQVPLV
AAT_THEMA       GIAKRIGERYKKDISPDQVVVTNGAKQALFNAFMALLDPGDEVIVFSPVWVSYIPQIILAGGNVVETFMS
AAT_RICFE       AIKDKFKRENNIDYELDEIIVSTGGKQVIYNLFMASLDKGDKVIIPAPYWVSYPDMVALSTGTPVNCGIE
AAT_RICCN       AIKDKFKRENNIDYELDEIIVSTGGKQVIYNLFMASLDQGDEVIIPAPYWVSYPDMVALSTGTPVNCGIE
DAPAT_SYNFM     SVAGWYKRRFGVELDPSEVLTLIGSKEGLAHFPLAVINPGDLALVPTPAYPVYHVATMFAGGESYFMPLV
AAT_RICPR       AIKNKFKRENNIDYELDEIIVSTGGKQVIYNLFMASLDKGDEVIIPVPYWVSYPDMVALSTGTPVNCGIE
AAT_RICTY       AIKNKFKRENNIDYELDEIIVSTGGKQVIYNLFMASLDKGDEVIIPVPYWVSYPDMVALSTGTPVNCGIE
DAPT2_ANASP     AAVEWMERRFGVDLNPTEVVSSIGSKEAIHNTFLAFVEAGDYTLIPDPGYPVYRTSTIFAGGEAFSMPLK
DAPAT_MOOTA     AVADWYQRLYGVDLDPRREVVTLIGSKEAHISL-CYVDPGDINLVPDPGYPVYNIGTLLAGGESYFMPLT
DAPAT_GLOVI     XXXXWFERRFGVGGPDTEVISSIGSKEAIHNTFLAFVDPGDYTLIPDPAYPVYRTSTIFAGGEFFAMPLL
AAT2_METJA      KISELYKDKYKADIIPDNIIITXXXXXXXXXXXXXIIDDGDEVLIQNPCYPCYKNFIRFLGAKPVFC---
DAPT2_ANAVT     AAVKWMERRFGVDLNPTEVVSSIGSKEAIHNTFLAFVEAGDYTLIPDPGYPVYRTSTIFAGGEPFTMPLK
DAPAT_DEHSB     AMAEWYQKRFGVKLNPTEVLPLIGSKEGIGHAAWCFLDPGDIALVPNPAYPVYAISSQLAGAEVFNLPLN
MTNE_BACSU      AAAAFYKREYGIDLDPETEVAVLGGKAGLVELPQCLLNPGDTILVPDPGYPDYWSGVTLAKAKMEMMPLV
KAT1_MOUSE      ILASFFGKLLGQEMDPLNVLVTVGAYGALFTAFQALVDEGDEVIIIEPAFNCYEPMTMMAGGRPVFVSLR
DAPAT_DEHSC     AMAEWYQKRFGVKLNPTEVLPLIGSKEGIGHAAWCFLDPGDIALVPNPAYPVYAISSQLAGAEVFNLPLN
KAT1_RAT        VLASFFGKLLGQEMDPTNVLVTVGAYGALFTRFQALVDEGDEVIIMEPAFDCYEPMTMMAGGCPVFVTLK
DAPAT_DESAD     AVADWYKERFDVELATKEVVSLIGSKEGIAHFPLAFVNPGDLVLVASPNYPVYPVASGFAGGEVEIVPLL
DAPAT_DEHE1     AMAEWYEKRFGVKLNPTEVLPLIGSKEGIGHAAWCFLDPGDVALVPDPAYPVYAISSQLAGAEVFYMPLN
AATC_RHIME      XXXXXXXXXFGVKLNPTQVVATLGSKEGFANMAQAITAPGDVVLCPNPTYPIHAFGFLMAGGVIRSISVE
KAT3_DANRE      ALSKVYGKVYDRQLDPKEILVTVGGYGSLFSTMQALVEEGDEVIIIEPFFDCYVPMVKMAGAKPVLIPLR
KAT_DICDI       ALSSVYSPYFGRELAMTEIMVGVGASESLFAAISSIVNEGDEVILIEPFFDIYIGPILMAGGIPKFVTLK
KAT3_RAT        ALSCLYGKIYQKQIDPEEILVTVGGYGSLFNAIQGLVDPGDEVIIMVPFYDCYEPMVKMAGAVPVFIPLR
DAPAT_NATTJ     AIKEYYQSRFGVELNPDREILTLIGSEGIANISQAILNPGDINFIPDPSYPVYKNGTILAGGTPHSMPLK
DAPAT_DESDG     EVANWYKRRYAVELDPTEVLTLIGSKEGIAHFPTAFVNPGDLVLVCPPCYPVYAIASRFMGGVVQELPLL
KAT3_HUMAN      ALSYLYEKQKQID-SNKEILVTVGAYGSLFNTIQALIDEGDEVILIVPFYDCYEPMVRMAGATPVFIPLR
DAPAT_DESVH     EVANWYDRRFGVSLDPAEVIGLIGSKEGIAHFPFAFINPGDLVLVCTPNYPVYHIATGFAGGEVQFVPLL
DAPAT_DESVV     EVANWYDRRFGVSLDPAEVIGLIGSKEGIAHFPFAFINPGDLVLVCTPNYPVYHIATGFAGGEVQFVPLL
KAT3_MOUSE      ALSCLYGKIYQRQIDPEEILVAVGAYGSLFNSIQGLVDPGDEVIIMVPFYDCYEPMVRMAGAVPVFIPLR
KAT3_BOVIN      ALSCLYEKFYHNKINPEEILVTVGAYGSLFNAIQGLIDEGDEVIVIVPFFDCYESMVRMAGATPVFVPLR
DAPAT_AQUAE     AVADWYKRRFDVDLDPTEVITLIGSKEGIAHFPLAFVNPGDIVLCPDPAYPVYRIGAIFAGGTPYTVPLK
KAT1_HUMAN      ILASFFGELLGQEIDPLNVLVTVGGYGALFTAFQALVDEGDEVIIIEPFFDCYEPMTMMAGGRPVFVSLK
AAT_STRGR       AIAEKTLRDSGYEVDAGQILVTNGGKQAIYEAFAAILDPGDEVIVPAPYWTTYPESIRLAGGVPVEV-VA
DAPAT_DESVM     EVANWYGRRFGVSLDPTEVIGLIGSKEGIAHFPLAFVNPGDLVLVCTPNYPVYHIATGFVGGEVQFIPLV
AAT2_BACSU      AIAAFYKREYGVTINPETEVALFGGGKALYVLTQCLLNPGDIALVPNPGYPEYLSGITMARAELYEMPLY
YBDL_ECOLI      AIAQKTERLYGYQPADSDITVTAGATEALYAAITALVRNGDEVICFDPSYDSYAPAIALSGGIVKRMALQ
AAT3_BACSU      KVAQFLGSRFEADFSAERIVMTVGAGGALNVALKSIVNPGEEVIILAPYFAEYKLYIENYGGKAVSCPLT
YFDZ_ECOLI      AISRWYQDRYDVEIDPSEAIVTIGSKEGLAHLMLATLDHGDTVLVPNPSYPIHIYGAVIAGAQVRSVPLV
BNA3_YEAST      SLIKLYSPIYNTELKAENVTVTTGANEGILSCLMGLLNAGDEVIVFEPFFDQYIPNIELCGGKVVYVPIN
AAT_MYCTU       AVVTRYELVPGFPRFDVDDVYLGNGSELITMTLQALLDNGDQVLIPSPDYPLWTASTSLAGGTPVHYLCD
AAT_MYCBO       AVVTRYELVPGFPRFDVDDVYLGNGSELITMTLQALLDNGDQVLIPSPDYPLWTASTSLAGGTPVHYLCD
ATTY_MOUSE      EVASYYHCPEA-PLEAKDVILTSGCSQAIELCLAVLANPGQNILIPRPGFSLYRTLAESMGIEVKLYNLL
DAPAT_DESAP     AVADWYARRFGVELDPREVVSLIGSKEGIAHLPWCFXXXXXXXXXXXXXXXXXAGGTILAGGIPHPVPLT
ATTY_RAT        EVASYHCHEAPLEAKD--VILTSGCSQAIELCLAVLANPGQNILIPRPGFSLYRTLAESMGIEVKLYNLL
Y1527_METMP     EIPIYLEKIFGVDLDPVNVVHSIGSKPALAYITSVFINPGDVTLMTVPGYPVTATHTKWYGGSVETLPLL
Y1391_METJA     AVPPYMEKVYGVDIDPVNVIHSIGSKPALAYITSAFINPGDVCLMTVPGYPVTATHTKWYGGEVYNLPLL
ATTY_DICDI      AVA-KYVETPTSKLTSKDIIVASGASGAIELAIGVLLNEGDNILVPKPGFPLYECTTKFINVKHYNLLEK
ATTY_HUMAN      EIASYYHCPEA-PLEAKDVILTSGCSQAIDLCLAVLANPGQNILVPRPGFSLYKTLAESMGIEVKLYNLL
Y286_HAEIN      AIVQYYQSKGILGATVNDVYIGNGVSELITMAMQALLNDGDEVLVPMPDYPLWTAAVTLSGGKAVHYLCD
YFBQ_SHIFL      AIMQHYQARGMRDVTVEDIYIGNGVSELIVQAMQALLNSGDEMLVPAPDYPLWTAAVSLSSGKAVHYLCD
YFBQ_ECOLI      AIMQHYQARGMRDVTVEDIYIGNGVSELIVQAMQALLNSGDEMLVPAPDYPLWTAAVSLSSGKAVHYLCD
YFBQ_ECOL6      AIMQHYQARGMRDVTVEDIYIGNGVSELIVQAMQALLNSGDEMLVPAPDYPLWTAAVSLSSGKAVHYLCD
ATTY_BOVIN      EVASYYHCPEA-PLEAKDVILTSGCSQAIELCLAVLANPGQNILVPRPGFSLYRTLAESMGIEVYNLLPE
ATTY_TRYCR      AVATVHKEELKSTIVKDNVVLCSGGSHGILMAITAICDAGDYALVPQPGFPHYETVCKAYG---IGMHFE
HIS8_AZOC5      ALREAIGKAMGID--PDRIICGAGSDEILNLIAHAYVGPGDEAIHCAHGFLVYKIATLGAGGVPVVVPDR
HIS8_SILPO      AIGAVHGLD------PDRIICGVGSDEVLQFVAQAYTGPGDEVIHTEHGFSMYPILARMAGATPVQVPER
AAT_PYRKO       RIAEF----EGVS---ADEVIVAPGAKIL---IAAEIASAKKVAVVSPRWNAYSLIARQFWREVEVIKTT
PATR_PROAC      ----------GVDVSQVAV--GAGSTEVASQLMHALAGAGDEIIFPWRSFEAYPILTKVAGATPIPVPLT
YDT4_SCHPO      ALSEAYSPYFKRTLNPTEIVVTAGANEGFFSVFAAFLNPGDEVIVMEPFFDQYISNITMNXXXXXXXXXX
HIS8_UNCMA      AIELREALAMRHGVPVRNIVCGNGMDAVIETLLRAFLETGDEVVIPLPAFSYYENVTRFCGATPKYCARR
HIS8_BEII9      AIASRHGLD------PARIVCGAGSDELLSLLAAVYLGPGEEGIFTEHGFLVYKIAILTAGGTPIVVP-E
PATR_STRGG      GLMNELADRFGV---PLGHLATGTGSVGVQQLLQATSGPGDEVIYAWRSFEAYPIITQVSGATSVKVPLT
HIS8_METS4      AIAGKYGLD------PARIVCGAGSDELLSLLTYAFMGPGDEGIYSEYGFLVYRIAILAAGGTPVVAPER
HIS8_CALS8      ------------NVKPTQIIFGAGSDEITQLIASIFINPGDNSIMARPSFPRYETVTKVMGGIPIEIPLK
HIS8_HALMA      ELADMW------DVTPEQVWLSNGGDGALDCLARAMLDPGQDVLVPSPGFAYYAMSARYHHGNEYTLSKA
HIS8_MAGSA      ------------------IVCGAGSDELLGILCRAYAGPGDEVLYSAHGFLMYAIAAKACGATPVTAP-E
HIS8_XANP2      ATVLRQAIATAYGLDPARIICGAGSDEILNLVAHTYVGPGDEVIFSEHGFLVYKIATLASGGTPV-VARE
HIS8_ROSDO      AIGQVHGLDAG------RIICGVGSDELLTLLAMAFAGPGDEVLYTEHGFSMYRIFALSAGATPVVAP-E
Y104_SULSO      ELVNL-SRLRGISIDERNVFVTVGSQEALFMIFNILLDPGDNVVVEAPTYLAALNAMRTRKPNFISITVT
HIS8_SPHAL      AIAAKYGLD------PDRVICGNGSDELLHLAAGTYAGPGDEILYVRYGFAVYEIAARRVGAVPVEADDR
PATR_MYCA9      -----------VDMPPEHIAVGCGSVSLCQQLVQITATVGDEVLFGWRSFETYPLVVRVAGATPVQVPLV
YISV_BACSU      AVAD-HLKGKKIHVSPSAILIVSGALQALQLISIGLLKRDSVILTEKPSYLQSLHVFQSAGMRLRGLPMD
PATR_STRCO      ---------------PLAHLATGTGSVGVQQLIQATSGPGDEVIYAWRSFEAYPIITQISGARSVQVPLT
HIS81_RHIME     AIAAVHGLN------PANILCGNGSDELLGLLCHTYLGPGDEGIVTEHGFLVYKIQITASGGTPVTVKER
HIS8_METNO      AIAGKYGLD------PERIVCGAGSDELLSLLTYAYLGPGDEGVYSQYGFLVYRIAILAAGGTPVVAPER
HIS8_RUBXD      ----------GSDVA--NVLVGNGSSEVLQNLLMLVERPG-EVLFPWPTFTLYPSIAGTLGLRARRVPLT
HIS8_ZYMMO      AIGACYNLD------PARIIHGTGSDEILHLAAGAYAGQDDEVLYPRYSFSVYPLAARRVGATPVEAP-D
PATR_RHOSR      ALADH------LGVATENIAAGCGSVSLCQELVQATCNDGDEVIFAWRSFEAYPVVTQVAGATPVKVPLT
HIS8_METFL      ---------------PDQLVFGNGSNDILELAARAFLTPGTEAVYAQHAFAVYALVTQATGASGISVPAR
HIS8_DINSH      AIAEVYGLD------PERIICGAGSDEIIAFLCQAYVGPGDEVIHTEHGFAMYRISTLAAGGTPVEVPER
HIS82_RALEJ     ---------------PAGVLLGNGSDEIISMLALAAARPGAKVMAPVPGFVMYAMSAQFAGLEFVGVPLR
HIS8_PELLD      --IEAYAEFLGV---PAGVIMGNGSNELLYTIFMACLGPGRRILIPEPSFSLYEKIALLMQADIVSVPMR
HIS8_BRUME      AIAET----QGLNIS--NILCGNGSDELLGLLCQTYLAPGDETIITEHGFAVYKIQTLAAGATPVTVKEK
HIS8_SILST      AIAETHGLDA------ERIICGAGSDEIIAFLCQCYAGPGDEVLYTEHGFAMYRISALAAGATPVEVKER
HIS8_BRUSU      AIAET----QGLNIS--NILCGNGSDELLGLLCQTYLAPGDETIITEHGFAVYKIQTLAAGATPVTVKEK
HIS8_BRUO2      AIAET----QGLNIS--NILCGNGSDELLGLLCQTYLAPGDETIITEHGFAVYKIQTLAAGATPVTVKEK
HIS8_BRUAB      AIAET----QGLNIS--NILCGNGSDELLGLLCQTYLAPGDETIITEHGFAVYKIQTLAAGATPVTVKEK
HIS8_BRUA2      AIAET----QGLNIS--NILCGNGSDELLGLLCQTYLAPGDETIITEHGFAVYKIQTLAAGATPVTVKEK
PATR_THEFY      ----------------------AGSVGLLQQLLEATAEPGAEVVYAWRSFEAYPLLTGLAGATPIHVPLR
HIS8_BURM1      ALLDKLRHAMGVP-GTCDVLLGNGSDEIISMISVACAKPGAKVLAPVPGFVMYELSARFAQLDFVGVPLK
YDCR_ECOLI      AIARRYAL-QGITISPDEIVITAGALEALNLSLQAVTEPGDWVIVENPCFYALQALERLRKALSVATDVK
PATR_STRAW      GLMSELSERFGV---PLSHLATGTGSVGVQQLLQATSGPGDEVIYAWRSFEAYPIITQVSGATSVQVPLT
HIS8_PROVI      FL----------GVPAEGVMMGNGSNELLYTIFLACLGPGRKILVPDPSFSLYEKLALLLQASLVRVPLK
HIS8_MESSB      AIAKAHGLN------PANILCSNGSDELLALLAQTYLMPGDEGIYTEHGFLVYRIQILAAGATPVVAREK
HIS8_ERYLH      KLAEVHGLDAG------RIVCGTGSDELLNLAAQAFAGPGDEVLFSTYSFSVYDIAARRCGATPVEXXXX
HIS81_BURS3     ALLDKLRHAMGV---PAGVLLGNGSDEIISMMSMACAKPGAKVLAPVPGFVMYELSAKLAQLEFVGVPLK
HIS8_CHLL2      -------------VSRDSVIMSNGSNEMLYTIFLACLSPGKKILIPEPSFSLYEKIALLLQADIVSVPMQ
HIS8_NOVAD      AIGEVH----GID--PSRIVMGTGSDELLNLAAQAYAGPGDEVLYVRYGFSVYDIAARRCGAVPVVAPDA
HIS8_METMA      AHELREALSKYTGFPVSNIVASGPGMDGLLDGLRIIIEKGDEVIVPIPTFSYYELPARACGAEPVFIRRN
PATR_RHOE4      -------------VEPANVAAGCGSVTLCQELVQITCDQGDEVIYAWRSFEAYPVVTQVGHAVSVKVPLT
HIS8_METJA      ------------------IVGGDGADEIIDTIFRTFVDDGDEVIIPIPTFTQYSATIHNAKIKYAKYDKE
CBL_BACSU       AVCGWMQNRHGWKVNPESITFSPGVVTALSMAVQAFTEPGDQVVVQPPVYTPFYHMVEKNGRHILHNPLL
HIS8_MOOTA      ----KEALAAKLGVKQENLIIGNGTDEILKMLAETYINPGDEIVVADPTFSEYEFAAQVMGGRAIKVPTR
HIS8_METM7      ------------------IVGGDGADEVIDNIMRILIDEGDEVIIPIPTFTQYAISAKIHGANIAKFDEE
HIS8_HYPNA      ------------------VVTSAGSDEIIHLLTQCYAGPGDEVLFTEHAFSMYRVSAGAHGATSVTVP-E
PATR_MYCVP      ----KH-----VNFAPEYISVGCGSVSLCQQLIQITSTVGDEVLFGWRSFEIYPLQVRTAGATPVQVPLT
PATR_MYCS2      ----KH-----VNFAPENISVGCGSVSLCQQLIQITSSVGDEVLFAWRSFEIYPLQVRTAGATPVAVALR
HIS8_RHOP2      EAI---GRAYGLD--PDRIICGAGSDEILNLLAHTYLGPGDEAISSQHGFLVYPIATLANGATNVVAP-E
HIS8_ALKOO      ------------------IITGNGGEQIIQLIAQTFINPGDEAIMADTTFGLYETSVLNMKGVPVILPLK
HIS8_PELPB      -------------ISPDSVMMSNGSNEMLYTIFLACLGPGRKVLIPDPSFSLYEKIALLLQSQIVTVPML
HIS8_HALLT      KLAEKW------DVSTEQVWVSPGADGSIDYLSRAALEPGDEVLVPEPGFAYYAMSARYHHGSEYALSPD
PATR_MYCTU      ------ARHLGPDFAPEHVAVGCGSVSLCQQLVQVTASVGDEVVFGWRSFELYPPQVRVAGAIPIQVPLT
PATR_MYCTA      ------ARHLGPDFAPEHVAVGCGSVSLCQQLVQVTASVGDEVVFGWRSFELYPPQVRVAGAIPIQVPLT
PATR_MYCBT      ------ARHLGPDFAPEHVAVGCGSVSLCQQLVQVTASVGDEVVFGWRSFELYPPQVRVAGAIPIQVPLT
PATR_MYCBP      ------ARHLGPDFAPEHVAVGCGSVSLCQQLVQVTASVGDEVVFGWRSFELYPPQVRVAGAIPIQVPLT
PATR_MYCBO      ------ARHLGPDFAPEHVAVGCGSVSLCQQLVQVTASVGDEVVFGWRSFELYPPQVRVAGAIPIQVPLT
HIS8_RHOPB      EAI---GRAYGLD--PDRIICGAGSDEILNLLAHTYLGPGDEAIATTYGFLVYPIAT-MANGAKLVIAEE
HIS8_METMP      ------------------IVGGDGADEVIDNIMRILIDEGDEVIIPIPTFTQYAISAKIHGANIKWAKFD
HIS8_MARMM      ------------------IVCGTGSDELLQLLGRAYLNPGDKVVQSQYGFLVYRLVAMQCGANLVSAPER
HIS8_CHLTE      -------------VKPELVIMSNGSNEMLYTIFMACLGAGRKVLIPEPSFSLYDKLARLQQAGVVEVPMH
HIS8_THETN      -------------VTPKNIFVGNGSDEIIHLIMLAFVDKGDTVLYPHPSFAMYSIYSKIAGANEIAVNLN
HIS8_SALPK      AVIENYAQYAGVK--PEQVLVSRGADEGIELVIRAFCEPGDAILYCPPTYGMYSVSAETIGVERRTVPAL
HIS8_SALPA      AVIENYAQYAGVK--PEQVLVSRGADEGIELVIRAFCEPGDAILYCPPTYGMYSVSAETIGVERRTVPAL
HIS8_PROA2      FL----------GIAPESVMMSNGSNEMLYTIFLACLSKGRKVVIPEPSFSLYEKLAVLLQADIVDVPMH
HIS8_HALSA      ALADRW------DVGDDQVWVANGGDGALDYLARATLDPGDSVLVPSPGFTYYGMSARFHHGNVAEYDVA
HIS8_HALS3      ALADRW------DVGDDQVWVANGGDGALDYLARATLDPGDSVLVPSPGFTYYGMSARFHHGNVAEYDVA
HIS8_ENTS8      RVIERYAQYAGVK--PEQVLVSRGADEGIELLIRAFCEPGDAVLYCPPTYGMYSVSAETSGVECRTVQAT
PATR_RHOOB      --------------------------------VHATCNDGDEVMFAWRSFEAYPVVTRVAGAVPVTVPLT
HIS8_SYMTH      -----------------------GSDEVFRLLAEVYLEPGDRVVVPEPSFAAYRFVAELMGAEVVAVPLA
HIS8_SALTY      AVIENYAQYAGVK--PEQVLVSRGADEGIELVIRAFCEPGDAILYCPPTYGMYSVSAETIGVERRTVPAL
HIS8_SALSV      AVIENYAQYAGVK--PEQVLVSRGADEGIELVIRAFCEPGDAILYCPPTYGMYSVSAETIGVERRTVPAL
HIS8_SALPC      AVIENYAQYAGVK--PEQVLVSRGADEGIELVIRAFCEPGDAILYCPPTYGMYSVSAETIGVERRTVPAL
HIS8_SALHS      AVIENYAQYAGVK--PEQVLVSRGADEGIELVIRAFCEPGDAILYCPPTYGMYSVSAETIGVERRTVPAL
HIS8_SALG2      AVIENYAQYAGVK--PEQVLVSRGADEGIELVIRAFCEPGDAILYCPPTYGMYSVSAETIGVERRTVPAL
HIS8_SALEP      AVIENYAQYAGVK--PEQVLVSRGADEGIELVIRAFCEPGDAILYCPPTYGMYSVSAETIGVERRTVPAL
HIS8_SALDC      AVIENYAQYAGVK--PEQVLVSRGADEGIELVIRAFCEPGDAILYCPPTYGMYSVSAETLGVERRTVPAL
HIS8_SALA4      AVIENYAQYAGVK--PEQVLVSRGADEGIELVIRAFCEPGDAILYCPPTYGMYSVSAETIGVERRTVPAL
HIS8_METVS      ------------------IIGGDGADEVIDNIMRILIDEGDEVIIPIPTFTQYAISAKIHGAKIAKFDKE
HIS8_GRABC      AI----GRYFGLD--PARIVCGVGSDEMIHLCM-AYSNPDSELIMSVHGFSVYEMYGHYAGAKVVKVP-E
HIS82_BORPA     --------------AQAGLLFGNGSDELIHLIIQACCEPGDTVLSPWPSFVYFDMAARLSHARFVGVPLT
HIS82_BORBR     --------------AQAGLLFGNGSDELIHLIIQACCEPGDTVLSPWPSFVYFDMAARLSHARFVGVPLT
HIS8_SALCH      AVIENYAQYAGVK--PEQVLVSRGADEGIELMIRAFCEPGDAILYCPPTYGMYSVSAETIGVERRTVPAL
HIS8_METBF      AIELREALSRYTGFPVSNLIASGPGMDGLLDGLRLVIEKGDEVIVPTPTFAYYELPARACGGKPVFVRRS
HIS8_ECOSE      AVIENYAQYAGVK--PEQVLVSRGADEGIELLIRAFCEPGDAILYCPPTYGMYSVSAETIGVECRTVPTL
HIS8_ECOLI      AVIENYAQYAGVK--PEQVLVSRGADEGIELLIRAFCEPGDAILYCPPTYGMYSVSAETIGVECRTVPTL
HIS8_ECOHS      AVIENYAQYAGVK--PEQVLVSRGADEGIELLIRAFCEPGDAILYCPPTYGMYSVSAETIGVECRTVPTL
HIS8_ECODH      AVIENYAQYAGVK--PEQVLVSRGADEGIELLIRAFCEPGDAILYCPPTYGMYSVSAETIGVECRTVPTL
HIS8_ECOBW      AVIENYAQYAGVK--PEQVLVSRGADEGIELLIRAFCEPGDAILYCPPTYGMYSVSAETIGVECRTVPTL
HIS8_ECO8A      AVIENYAQYAGVK--PEQVLVSRGADEGIELLIRAFCEPGDAILYCPPTYGMYSVSAETIGVECRTVPTL
HIS81_ANAVT     ----REAASKVLGVPSDWLIVGNGSDEILSIVIRACTEPGRKVVYPMPTYVLYRTLTQMQAADILEIPYQ
HIS8_METM5      ------------------IVGGDGADEVIDNIMRILIDEGDEVIIPIPTFTQYAISAKIHGANIKWAKFD
HIS8_CHLPD      -----------VGVPADAVMMSNGSNEMLYTIFLACLGPGKKILIPEPSFSLYEKIARLLHTEVVFVPML
HIS82_MANSM     AVIKGYAAY--ADVKPENVIVTRGGDESIELLIKGFCEPEDKVLYCPPTYGMYAVSAETLGIATKTVPLT
HIS82_BORPE     --------------AQAGLLFGNGSDELIHLIIQACCEPGDTVLSPWPSFVYFDMAARLSHARFVGVPLT
HIS8_RHOCS      AIGHRFGLD------PARVLCFNGSDEVLHLLAQAYAGPGGEVLYSRHGFLVYXXXXXXXXXXXXXXXER
HIS8_ACICJ      ---------------PARIVCGNGSDDLIALLIQSYGGPGTELVMSRHGFLIYEIAARLAGMNVRKAPER
PATR_CORGL      ALAEH------LEVEFDQVTVGCGSSALCQQLVQATCAQGDEVIFPWRSFEAYPIFAQVAGATPVAIPLT
HIS8_YERPS      HVIERYAAYAGLP--PEQVLVSRGADEGIELLIRAFCEPGDAILFCPPTYGMYAVSAETFGVERRTVPAQ
HIS8_YERPB      HVIERYAAYAGLP--PEQVLVSRGADEGIELLIRAFCEPGDAILFCPPTYGMYAVSAETFGVERRTVPAQ
HIS8_SHIDS      AVIENYAQYAGVK--PEQVLVSCGADEGIELLIRAFCEPGDAILYCPPTYGMYSVSAETIGVECRTVPTL
HIS8_SHIB3      AVIENYAQYAGVK--PEQVLVSRGADEGIELLIRAFCEPGDSILYCPPTYGMYSVSAETIGVECRTVPTL
HIS8_SALPB      AVIENYAQYAGVK--PEQVLVSRGADEGIELVIRAFCEPGDAILYCPPTYGMYSVSAETIGVERRTVPAL
HIS8_SALNS      AVIENYAQYAGVK--PEQVLVSRGADEGIELVIRAFCEPGDAILYCPPTYGMYSVSAETIGVERRTVPAL
HIS8_ECO27      VVIENYAQYAGVK--PEQVLVSRGADEGIELLIRAFCEPGDAILYCPPTYGMYSVSAETIGVECRTVPTL
PATR_MYCSS      ---------------------------------------GDEVIFAWRSFEIYPLQVRTAGATPVQVPLR
PATR_MYCSK      ---------------------------------------GDEVIFAWRSFEIYPLQVRTAGATPVQVPLR
PATR_MYCSJ      ---------------------------------------GDEVIFAWRSFEIYPLQVRTAGATPVQVPLR
PATR_CORGB      ALAEH------LEVEFDQVTVGCGSSALCQQLVQATCAQGDEVIFPWRSFEAYPIFAQVAGATPVAIPLT
HIS8_SHIBS      AVIENYAQYAGVK--PEQVLVSRGADEGIELLIRAFCEPGDAILYCPPTYGMYGVSAETIGVECRTVPTL
HIS8_METAC      EVLSKYT---GFPVS--NIVASGPGMDGLLDGLRIIIEKGDEVIVPTPTFAYYELPARACGGKPVFVRRN
HIS8_ECO55      AVIENYAQYAGVK--PEQVLVSRGADEGIELLIRAFCEPGDAILYCPPTYGMYSVSAETIGVECRTVPTL
HIS8_ECO24      AVIENYAQYAGVK--PEQVLVSRGADEGIELLIRAFCEPGDAILYCPPTYGMYSVSAETIGVECRTVPTL
HIS8_CITK8      AVIENYAQYAGVN--PGQVLVSRGADEGIELLIRAFCEPGKEILYCPPTYGMYSVSSETIGVECRTVPTL
HIS8_AGRT5      AIADVH----GLNIA--NILCGNGSDELLGLLCHVYLGAGDEAIITEHGFLVYKIQIMGAGATPVTVK-E
HIS8_SHISS      AVIENYAQYAGVK--PEQVLVSRGADEGIELLIRAFCEPGDAILYCPPTYGMYSVSAETIGVECRTVPTQ
HIS8_ECOLU      AVIENYAQYAGVK--PEQVLVSRGADEGIELLIRAFCEPGDAILYYPPTYGMYSVSAETIGVECRTVPTL
HIS8_ECO5E      AVIENYAQYAGVK--PEQVLVSRGADEGIELLIRAFCEPGDAILYCPPTYGMYSVSAETIGVECRTVPTL
HIS8_ECO57      AVIENYAQYAGVK--PEQVLVSRGADEGIELLIRAFCEPGDAILYCPPTYGMYSVSAETIGVECRTVPTL
HIS8_ECO45      AVIENYAQYAGVK--PEQVLVSRGADEGIELLIRAFCEPGDAILYCPPTYGMYSVSAETIGVECRTVPTL
HIS8_THEPX      -------------VVPTNIFVGNGSDEIIHLIMLAFINKGDVVAYPHPSFAMYSVYSKIAGAVEIPVRLR
HIS8_THEP3      -------------VVPTNIFVGNGSDEIIHLIMLAFINKGDVVAYPHPSFAMYSVYSKIAGAVEIPVRLR
HIS8_SHIFL      AVIENYAQYAGVK--PEQVLVSRGADEGIELLIRAFCEPGDAILYCPPTYGMYSVSAETIGVECRTVPTL
HIS8_SHIF8      AVIENYAQYAGVK--PEQVLVSRGADEGIELLIRAFCEPGDAILYCPPTYGMYSVSAETIGVECRTVPTL
HIS8_SALTI      AVIENYAQYAGVK--PEQVLVSRGADEGIELVIRAFCEPGDAILYCPPTYGMYSVSAETIGVERRTVPAL
HIS8_RHORT      ALREALGRTHGLD--PARIVCGAGSDELIGLLCRAYAGPGDSIVQSAYGFLMYGIYARGVGAEPILAP-E
HIS8_ECOLC      AMIENYAQYAGVK--PEQVLVSRGADEGIELLIRAFCEPGDAILYCPPTYGMYSVSAETIGVECRTVPTL
HIS8_YERPY      HVIERYAAYAGLP--PEQVLVSRGADEGIELLIRAFCEPGDAILFCPPTYGMYAVSAETFGVERRTVPAQ
HIS8_YERPP      HVIERYAAYAGLP--PEQVLVSRGADEGIELLIRAFCEPGDAILFCPPTYGMYAVSAETFGVERRTVPAQ
HIS8_YERPN      HVIERYAAYAGLP--PEQVLVSRGADEGIELLIRAFCEPGDAILFCPPTYGMYAVSAETFGVERRTVPAQ
HIS8_YERPG      HVIERYAAYAGLP--PEQVLVSRGADEGIELLIRAFCEPGDAILFCPPTYGMYAVSAETFGVERRTVPAQ
HIS8_YERPE      HVIERYAAYAGLP--PEQVLVSRGADEGIELLIRAFCEPGDAILFCPPTYGMYAVSAETFGVERRTVPAQ
HIS8_YERPA      HVIERYAAYAGLP--PEQVLVSRGADEGIELLIRAFCEPGDAILFCPPTYGMYAVSAETFGVERRTVPAQ
HIS8_YERP3      HVIERYAAYAGLP--PEQVLVSRGADEGIELLIRAFCEPGDAILFCPPTYGMYAVSAETFGVERRTVPAQ
HIS8_RHOP5      EAIGKTF---GLD--PDRIICGAGSDEILNLLAHTYLAPGDEAIATTYGFLVYPIAT-MANGAKLVIAEE
HIS82_THICR     ---------------PTEIALGNGSNELLELVARIFAGKGDEIIYSQYAFAVYSISTQAVGATGIEVPAK
HIS8_SALAR      AVIENYAQYAGVK--PEQVLVSRGADEGIELMIRAFCEPGDAILYCPPTYGMYSVSAETIGVARRTVPTL
HIS8_ECOUT      VVIENYAQYAGVK--PEQVLVSRGADEGIELLIRAFCEPGDAILYCPPTYGMYSVSAETIGVECRTVPTL
HIS8_ECOL6      VVIENYAQYAGVK--PEQVLVSRGADEGIELLIRAFCEPGDAILYCPPTYGMYSVSAETIGVECRTVPTL
HIS8_ECOL5      VVIENYAQYAGVK--PEQVLVSRGADEGIELLIRAFCEPGDAILYCPPTYGMYSVSAETIGVECRTVPTL
HIS8_ECO81      AVIENYAQYAGVK--PEQVLVSRGADEGIELLIRAFCEPGDAILYCPPTYGMYSVSAETIGVECRTVPTL
HIS81_PASMU     AVIEGYANYVGV--TPENVLVSRGGDESIELIIRAFCEAEDSILYCPPTYGMYAVSAETCGIALKTVPLT
PATR_NOCFA      -------------------VAIGCGSVALELVQITCSSPRDEVLFAWRSFEAYPIITQVGNATAVQVPLS
PATR_MYCMM      ALARHVSSLSAADFGPEHIAVGCGSVSLCQQLVQITASVGDEVIFGWRSFELYPPQVQVAGATAIQVPLT
HIS8_ENT38      AVIENYAQYAGVK--PEQVLVSRGADEGIELLIRAFCEPGDAVLYCQPTYGMYSVSAETFGVECRNVLSL
PATR_MYCUA      ALARHVSSLSAADFGPEHIAVGCGSVSLCQQLVQITASVGDEVIFGWRSFELYPPQVQVAGATAIQVPLT
PATR_MYCPA      ----------GSDVAPEQIAVGSGSVTLCQQLVQITSAAGDEVMMGWRSFECYLPIVQVAGAIAVKVPLR
PATR_MYCA1      ----------GSDVAPEQIAVGSGSVTLCQQLVQITSAAGDEVMMGWRSFECYLPIVQVAGAIAVKVPLR
HIS8_AKKM8      -------------------VVGTGSSEVIELICHALLNPRAEVVAAKHAFSMYPIMSKLFGAAYVEVPNK
HIS8_PELUB      ------------------IICGAGSDEIIQMICQLYLKPSDEVIVPQYSFLMYRIYAQIVGAKVV-FSKE
HIS8_HALWD      ARIADYW-----GLSPEQIWLSPGADGAIDYLSRAFLTPGDTMLISDPGFSYYPMSARYHHGSIRTYPVS
HIS8_PARDP      AIGEVHGLD------PDRIICGVGSDEIIHFLCQAYAGPGTEVLFTEHGFLMYRISAHAAGAIPVQVAER
HIS8_ECO7I      AVIDNYAQYAGIK--PEQVLVSRGADEGIELLIRAFCEPGDAILYCPPTYGMYSVSAETIGVECRTVPTL
HIS8_CHLP8      -------------VPAESVIMSNGSNEMLYTIFMACVGAGRKVLIPEPSFSLYDKLAVLLQGEIVSVPLN
HIS82_PASMU     -FYFKQTVAKKFGLSPEQITLGNGSNDLLELVAHTFANEQDEILFSQYAFIVYPLVTQAINAKKVEIPAK
HIS8_YERE8      LVIERYAAYAGL--ATDQVLVSRGADEGIELLIRAFCEPADAILFCPPTYGMYAVSAETFGVELRTVPTK
HIS8_RHOPT      EAIGKA---YGLD--PDRIICGAGSDEILNLLAHTYLAPGDEAISSQHGFLVYPIATLANGAKNVVAP-E
HIS8_RHOPA      EAIGKA---YGLD--PDRIICGAGSDEILNLLAHTYLAPGDEAISSQHGFLVYPIATLANGAKNVVAP-E
HIS8_METS3      ELQQELANYSGVKQSQVXXXXXXXXXXXXVLA-KTFIDEGDEFIVPLPSYMYYEYLLQQYGARPVYAKWN
HIS8_KLEP3      AVIESYARY--ADVKPEQVLVSRGADEGIELLIRAFCEPGDALLYCPPTYGMYSVSAETIGVECRTVPTL
HIS8_ECOSM      AVIENYAQYAGVKAEQ--VLVSRGADEGIELLIRAFCEPGDAILYCPPTYGMYSVSAETIGVECRTVPTL
PATR_COREF      GVLADH-----LELTPEQITVGCGSSALCQQLVQATCAAGDEVIFPWRSFEAYPIFARVAGATAVPIPLL
HIS8_NITWN      AAI---GRAYGLD--PDRIICGAGSDEILNLLAHTFLSHGDEAISTTHAFLVYPIATMANGATNIVAP-E
HIS8_META3      ------------------VVGGDGADEIIDTMMRILIDKDDEVIIPIPTFTQYRISAKIYGANIAKFDKE
HIS8_ERWCT      MVINRYAEYAGV--TPEQVLVSRGADEGIELLIRAFCEPGDAILFCPPTYGMYAVSAETFGVERRTAASK
HIS82_BRAJA     EAI---GRTFGLD--PNRIICGAGSDEILNLLAHTYLGQGDEAISTTHGFLVYPIATMAVGARNV-IAQE
HIS81_HAEI8     RVVQAYANYAGVSTE--NVLVTRGGDEGIELIIHTFCEPKDAILFCPPTYGMYAVSAETAGVLSKSVPLT
DAPAT_CHLTB     ALRQKLSEDFYRGCVDAKEIFISDGAKADLFRLLSFFGPNQTVAIQDPSYPAYLDIARLTGAKEIALPCL
DAPAT_CHLT2     ALRQKLSEDFYRGCVDAKEIFISDGAKADLFRLLSFFGPNQTVAIQDPSYPAYLDIARLTGAKEIALPCL
HIS8_PECCP      QVINRYAEYAGVQ--PEQVLVSRGADEGIELLIRAFCEPGDAILFCPPTYGMYAVSAETFGVERRTAASK
HIS8_MACCJ      AIQLKASLSEFYQVDSEQILVGAGLDEIIMMISRARLNPKGHILTSEGTFIQYTTHALIEDNEVVSIPLK
HIS8_ESCF3      AVIDNYAQYAGVK--PEQVLVSRGADEGIELLIRAFCEPGDAILYCPPTYGMYSVSAETIGVECRTVPTL
HIS8_CHRVO      -----------------------GSDELITLVTQALARPGAKLLALEPSFVMYKMNALFSGLQYVGVPLR
HIS81_ARCFU     ------------------VVVGAGIDGILETLFRILIDEGDEVVIPIPTFPYYHILTKLSCGKEV-LVRR
HIS81_ANASP     ------------------VIVGNGSDEILSIVIRACAEPTRKVVYPVPTYVLYRTLTEMQAADILEIPYR
HIS8_STAAW      ----KAAISKHLNVDQSRILFGAGLDEVILMISRAVLTPGDTIVTSEATFGQYYHNAIVESANVIQVPLK
HIS8_STAAS      ----KAAISKHLNVDQSRILFGAGLDEVILMISRAVLTPGDTIVTSEATFGQYYHNAIVESANVIQVPLK
HIS8_HAEIG      RVVQAYANYAGVSTE--NVLVTRGGDEGIELIIHTFCEPKDAILFCPPTYGMYAVSAETAGVLSKTVPLT
HIS8_HAEIE      RVVQAYANYAGVSTE--NVLVTRGGDEGIELIIHTFCEPKDAILFCPPTYGMYAVSAETAGVLSKTVPLT
HIS8_ECOK1      VVIENYAQYAGVK--PEQVLVSRGADEGIELLIRAFCEQGDAILYCPPTYGMYSVSAETIGVECRTVPTL
HIS82_NITEU     ----KAALSERLGMPADQIVLGNGSNDVLELATRIFLHPDSTAIYSQYAFAIYPLLAQAVGARGIAVPAR
HIS81_RALSO     ALKAQLKRVMRVP-AGADVLLGNGSDEIISLIAIAAAKPGATVLAPVPGFVMYAMSAQLMGLKFVGVPLR
HIS81_HAEIN     RVVQAYANYAGVSTE--NVLVTRGGDEGIELIIHTFCEPKDAILFCPPTYGMYAVSAETAGVLSKTVPLT
HIS8_KLEP7      AVIESYARY--AEVKPEQVLVSRGADEGIELLIRAFCEPGDAVLYCPPTYGMYSVSAETIGVECRTVPTL
HIS8_CHLCH      -----------VGVPAECVIMSNGSNEMLYTIFLACLGPGRKVLIPNPSFSLYEKLALLLQSDIVEVPMK
PATR_LEIXX      KLAERH----GVDVDQ--VHLGSGSVALLAQLIRAVAGAGDEVVYSWRSFEAYPGLATVAGATSVQVPNR
HIS8_LACPL      ELRQAVAQQQGID--PNSIVFSVGLDEMIVMLSRTFLATNDQVLVSAPTFSEYGLHAEIEGGQLISVPTL
HIS8_DESPS      EAIAKYA-----GVGMSEIILGNGSNEVIEFLVKAFVQDDSEVITSHPSFLMYQKFVQVRGGVNRVIPLK
HIS8_ANOFW      ----REALAAHIGISEKQLIFGNGSDEVVQIICRAFLQKGTNTVMATPTFPQYRHNAIIEGAEVREIPLQ
DAPAT_CHLTR     ALRQKLSEDFYRGFVDAKEIFISDGAKVDLFRLLSFFGPNQTVAIQDPSYPAYLDIARLTGAKEIALPCL
DAPAT_CHLTA     ALRQKLSEDFYRGFVDAKEIFISDGAKVDLFRLLSFFGPNQTVAIQDPSYPAYLDIARLTGAKEIALPCL
ALAT_SCHPO      -LVRRHVADDGFDCEPSDIYLTSGASHAARLIMTLIIAPTDGVMVPAPQYPLYGAQIDLMSGSMVSYSLS
HIS8_LEUMM      -------------VDPQHLVFGAGADELIELLTRVVLEPGSNIIIPNPTFGEYAMHAQIEQSTTKKIPVN
HIS81_RALEJ     -----------------------GSNDILELAAHALVTPGQSIVYAEYSFAVYALATQEIGARAIVVKAR
DAPAT_BACV8     AVIRNDYAPRGVYLEPGEVFISDGASDTGNIGDILRHDNSIGVTDPIPVYIDSNVMCGRAGSNVVYLPCL
PATR_CORDI      ---------------PAEQIAVGCGSSALQQLVQITCTPGDEVVFPWRSFEAYPIFVQVVGATPVAVPLT
HIS8_STAAR      ----KAAISKHLNVDQSRILFGAGLDEVILMISRAVLTPGDTIVTSEATFGQYYHNAIVESANVIQVPLK
HIS8_LEUCK      -------------VNPDSLVFGAGADELIELLTRVILTPNDNVIVPNPTFGEYAMHAQIEQATTKSIPVN
HIS8_COREF      ALADYITHQTGVQVTRENLWAANGSNEVLQQLLQAFGGPGRKALGFQPSYSMHPILSKGTQTEPRGADFR
HIS82_RHILO     AIAEVHG------LTAQNIICSNGSDEILGLLAQTYLAPGDEAIFTEHAFMVYKIYIQSAGAAPIAVKET
HIS81_PSYA2     -----------------------GSDDLLDILARSFVGADDAIVYSQYAFVVYSMLAKMQGAMDVEVPAQ
CBL_MYCLE       EFASQRWQWHDLDVSRTAIVPDVGVVEMLRLI----TDRGDGVIVSPPVYPPFYAFVTHDGRRVLEAPLG
HIS8_THEGJ      -------------------VAVGNGSDEL-LSYLVRLFEGNHIVITPPTFGMYSFYAKLNGVPVVEVPLR
HIS8_RHOPS      EAI---GRAYGLD--PDRIICGAGSDEILNLLAHTYLGPDDEAISTTHGFLVYPIATLANGARNV-VAEE
HIS8_NITHX      EAI---GRAYGLD--PDRIICGAGSDEILNLLAHVYLSHGDEAVSTTHSFLVYPIATTANGAENVVAP-E
HIS81_MANSM     AIAEKF------NLQPEQITLGNGSNDLIELIAHTFATEGDEIIFSQYAFIVYPLITKAINAKAREIPAK
DAPAT_SYNPW     AIATHDFKARGCDIS-AEEIFVSDGSKCDSSNILDILGEGNRVAVTDPVYPVYVDSNVMAGGRYAGLPIS
ALAM_YEAST      SVAEFITRDEGEISYPEDIFLTAGASAAVNYLLSIFCGPETGVLIPIPQYPLYTATLALNNSQPYYLDEN
HIS8_STAAT      ----KAAISKHLNVDQSRILFGAGLDEVILMISRAVLTPGDTIVTSEATFGQYYHNAIVESANVIQVPLK
HIS8_STAAN      ----KAAISKHLNVDQSRILFGAGLDEVILMISRAVLTPGDTIVTSEATFGQYYHNAIVESANVIQVPLK
HIS8_STAAM      ----KAAISKHLNVDQSRILFGAGLDEVILMISRAVLTPGDTIVTSEATFGQYYHNAIVESANVIQVPLK
HIS8_STAAE      ----KAAISKHLNVDQSRILFGAGLDEVILMISRAVLTPGDTIVTSEATFGQYYHNAIVESANVIQVPLK
HIS8_STAAC      ----KAAISKHLNVDQSRILFGAGLDEVILMISRAVLTPGDTIVTSEATFGQYYHNAIVESANVIQVPLK
HIS8_STAAB      ----KAAISKHLNVDQSRILFGAGLDEVILMISRAVLTPGDTIVTSEATFGQYYHNAIVESANVIQVPLK
HIS8_STAA9      ----KAAISKHLNVDQSRILFGAGLDEVILMISRAVLTPGDTIVTSEATFGQYYHNAIVESANVIQVPLK
HIS8_STAA8      ----KAAISKHLNVDQSRILFGAGLDEVILMISRAVLTPGDTIVTSEATFGQYYHNAIVESANVIQVPLK
HIS8_STAA3      ----KAAISKHLNVDQSRILFGAGLDEVILMISRAVLTPGDTIVTSEATFGQYYHNAIVESANVIQVPLK
HIS8_STAA2      ----KAAISKHLNVDQSRILFGAGLDEVILMISRAVLTPGDTIVTSEATFGQYYHNAIVESANVIQVPLK
HIS8_STAA1      ----KAAISKHLNVDQSRILFGAGLDEVILMISRAVLTPGDTIVTSEATFGQYYHNAIVESANVIQVPLK
HIS8_PYRKO      ---------------PAENVAVGKGGDEL-IGYLVRLFEGDYIVTTPPTFGMYSFYARLNGIPVIEVPLR
HIS8_GEOBB      ---EEAAKVYGFD--PSWIIMANGSDEVLNNLIRACAGEGEEIAFINPSYSYYGTLAEVQGARVRTFGLS
HIS83_RHILO     NISLREAAANAYSVSMDQVIAGNGSSELLGLVYRAFLTPGDSVAMMSPGFSFNRKLATLQGAQFVEIEFS
DAPAT_SYNS9     AIAQQDFQSRGCEIN-ADEIFVSDGSKCDSSNILDILGEGNRVAVTDPVYPVYVDSNVMAGGDAGAEGRY
HIS8_PHOLL      SVIRRYAAYAGLQ--PEQVLACRGADESIELLIRVFCEPGDVVLFCPPTYGMYSVSAETFGVEQKKITAL
HIS8_METST      YIKEQIAKYANVTKDQV-IIGGDGADELFEVLAKTVIDEGDEFIVHQPTYTYYEYTFKQSNAKAVYATWN
HIS8_METBU      AISEY------TDIPAANIVASGPGMDGLLDGLARLVIAGDEVVITTPTFSYYEIAARANGATTVYVQRE
HIS8_GEOSM      R--EEAAKVYGFD--PSWIIMANGSDEVLNNLIRACAGEGEEIAFINPSYSYYGTLAEVQGARVRTFGLT
HIS82_RALSO     -----HAK---FGVPEAWITLGNGSNDILELAARALVAPGQGVIYAQHAFAVYALAAQEVGARAVEVPAR
HIS82_NITMU     ----KAALSERYGVTSDQIVLGNGSNDVLELAARVFLKPGASTVYSQHAFAVYPLVTKAVGGIGISVPAR
HIS8_HAHCH      --------------ASADMLFGNGSDEIIQILAMAVAGPGRTILSVEPSFVMYKMIATFIGAEYVGVPLN
HIS81_IDILO     -----------------------GSNDVLEILARTFVSDKDEVIFSQHAFVVYPLVTQAIGAKPVAVPAV
HIS8_BREBN      -------------VKPSQLFFGNGSDEILLMISRAFLSEGTNAVMATQTFSQYRSNGIIEGADLIEVPLK
HIS83_BURS3     HLAAYLTHDTGVTVDASSVWAANGSNEVIQQILQAFGGPGRSALAFTPAYPMYDEYCRTTFTRLHTLPRT
HIS81_THIDA     ALKAKLSARLGVDAAQ--IVLGNGSNDVLDMVARAYLAPGTSAVYAQYAFAVYPIATHTVGAHGIAVAAR
HIS8_TOBAC      ------AEDSGLE--SEYILAGCGADELIDLIMRCVLDPGDMIVDCPPTFTMYEFDAAVNGAHVIKVPRN
HIS8_LYSSC      --VANH-----LGVQETQLLFGNGSDDIIAIITRALLYPGVNTIMADLSFSQYWHNAEIEGAEIRKIPCV
HIS81_NITOC     ----KTALSQCLGIPANQITLGNGSSDLLEFAARVLISPEHEVIYSQYCFALYPLLIQILGAKGHAVPAK
HIS8_VIBFM      ------------EVKPEQVLTSRGADEGIELLVRAFCEPNDAILYCPPTYGMYSISAETIGVETKTVPLT
HIS8_STAS1      AI-SKH-----LNIDPARILFGAGLDEVILMISRAVLTPGDKIVTSEMTFGQYYHNAIVESANVVQVPLQ
HIS8_RHOS1      AIAEVHGLD------PARVICGVGSDEIITFLCQAYAGPHTDVVFTEHGFLMYRISALAVGANPVEVPER
HIS8_NICPL      ------AEDSGLE--SEYILAGCGADELIDLIMRCVLDPGDMIVDCPPTFTMYEFDAAVNGAHVIKVPRN
HIS8_CLONN      ATKLKKAYGDYIGIDEKNIMVGNGSDELIQILTNAFLDKNEKIVTLNPDFSMYEVYTKVRGGKVSVFDLD
HIS8_BACA2      RLSEH------LQVSESSIIFGNGSDELVQIICRSLLNDQANTITAAPTFPQYRHNAVIEGAEVREVPLR
HIS82_CARHZ     KIAAKYG------VTPDNIILGNGSDELVMFLAMALIDPGDEAIMPVPSFPRYEPVVTMMNGIAREIPLK
DAPAT_BACFR     AIIKNDYAPRGIHLSPTEVFVNDGASDTGNIGDILRHDNSVGVTDPIPVYIDSNVMCGRAGVLDTESGKW
YJIR_ECOLI      --------DSGSVVTADDIIITSGCHNSMSLALMAVCKPGDIVAVESPCYYGSMQMLRGMGVKVIEIPTD
HIS8_VIBPA      ALISAYAAYAGVK--PEQTLTSRGADEGIELLVRAFCEPGDAILYCPPTYGMYAISAETIGVERKTVPLT
HIS8_STAHJ      AISEH------LNVDPSRILFGAGLDEVILMISRAVLTPGDKIVTSEGTFGQYYHNAIVESAEVVQVPLL
HIS8_RHOBA      SFRRAAANALGLP-GPEWVLAGNGSDEILTLLVRGFVGEGESLRLPYPSYILYRTLADIQGANWEQVPFN
HIS8_HALVO      -------------LAPEQVWVSPGADGSIDYLTRAVLEPDDRILEPAPGFSYYSMSARYHHGDAVQYEVS
1A112_ARATH     AFADFMSRIMGGNVSPSNMVITAGGTPAIEVLAFCLADHGNAFLIPTPYYPGFDRDIKFRTGIPVHCRSS
MOCR_RHIME      AIAEYLRASRGVECAPEQVIVVNGTQAALDILARMLVDEGDICWMEEPGYIGAQNSLLSAGAKLVPLPVR
HIS8_STAES      ----REAISQQLNVDASRILFGAGLDEVILMISRAVLSPGDKIITSESTFGQYYHNAIVESADVIQVPLK
HIS8_STAEQ      ----REAISQQLNVDASRILFGAGLDEVILMISRAVLSPGDKIITSESTFGQYYHNAIVESADVIQVPLK
HIS8_BACHD      -----------VGVAPEELIFGNGSDEVIQILCRAFLNEQTNTVMAEPTFSQYKLNAVIEGAELREVPLK
HIS8_ACEPA      ALALRKALGARIGLGPEYVFVGNGSDEVLAHAFQAFFAHGEPLLFPDVTYSFYKVYCGLYSLPFRNVPLT
HIS82_METCA     ----KAALAEKLGVEPAQIVLGNGSNDVLDLVARAFLTAGRNAVYSEYAFAVYPIXXXXXXXXXXXXXXH
DAPAT_SYNR3     AIAKHDFQSRGCDIS-AEEIFVSDGSKCDSSNILDILGEGNRIAVTDPVYPVYVDSNVMAGGDANEGGQY
DAPAT_BACFN     AIIKNDYAPRGIHLSPTEVFVNDGASDTGNIGDILRHDNSVGVTDPIPVYIDSNVMCGRAGVLDTESGKW
HIS8_VIBCM      AMIQAYANYAGVQ--PEQVLTSRGADEGIELLIRAFCEPNDAILFCPPTYGMYAISAETFGVERKKVPLT
HIS8_VIBC3      AMIQAYANYAGVQ--PEQVLTSRGADEGIELLIRAFCEPNDAILFCPPTYGMYAISAETFGVERKKVPLT
HIS8_SULSO      DLLEKY-RELAAEVEPENIYPSVGADGSIRAIFYNLVEPGDTILTNXXXXXXXXXXXXXRGTKVIKVNLK
HIS8_RHOS5      AIAEVHGLD------PARVICGVGSDEIITFLCQAYAGPHTDVIFTEHGFLMYRISALAVGANPVEVPER
HIS8_RHISN      NISLREAAAASYDLSADQVIAGNGSSELLSLIYKAFLGPGDSVAMLSPGFAYNRKLAQLQGARLLEIKWG
ARNB_ESCF3      AFIQLTGNQYAIAVSSA----TAG----MHITLMAEIGPGDEVITPSMTWVSTLNMISLLGATPVMVDVR
ALA2_PANMI      AIAAGIASRDGFPANADDIFVTDGASPGVHMMMQLLINEKDGILCPIPQYPLYSASIALHGGTPYYLDEK
HIS8_VIBCH      AMIQAYANYAGVQ--PEQVLTSRGADEGIELLIRAFCEPNDVILFCPPTYGMYAISAETFGVERKKVPLT
HIS8_RHOSK      AIAEVHGLD------PARVICGVGSDEIITFLCQAYAGPHTDVVFTEHGFLMYRISALAVGANPVEVPER
HIS8_RHOS4      AIAEVHGLD------PARVICGVGSDEIITFLCQAYAGPHTDVVFTEHGFLMYRISALAVGANPVEVPER
HIS8_ANADF      -------------VPPEEVMVGNGSNELIELLVRTFVLDGEEVLTSAQSFVAYKLAAHEHGRTLVEAPMK
ALAM_DICDI      SVADFIERRDGHKSDPSEIFLTDGASVGVQRILKLLIDRSDGILIPIPQYPLYSATIELYNGSQLGYLLN
HIS8_VIBVY      -------------VKPEQTLTSRGADEGIELLIRAFCEPNDAILYCPPTYGMYSVSAETIGVERKTVPLT
HIS8_VIBHB      -------------VKPEQTLTSRGADEGIELLIRAFCEPGDAILYCPPTYGMYGISAETIGVERKTVPLT
HIS8_METPP      ELRAALARHAGLPPGCALMLGN-GSDELISLLSMACDVPGATVLAPLPGFVMYEMSARLQGLRFVGVPLT
HIS8_DESDG      AI----ARSFGV--AAESVVTGNGSDEVIDLIIRVKARPGKHIVAFNPCFSMYELQTRFCGVEFRQVPLR
DAPT1_ANAVT     KIATQDFQARGADVDASEIFISDGSKCDTGNILDIFGD-NNIIAVTDPVYPVYVDTNVMAGHTGVANDKG
DAPAT_ACAM1     KIAAHDFQARGCDV-DAGEIFISDGSKCDCGNILDIFGDNNTIAVTDPVYPVYVDTNVMAGHTG---PCN
ALA2_HORVU      AIASGIASRDGFPANADDIFLTDGASPGVHLMMQLLINEKDGILVPIPQYPLYSASIALHGGALVPYYLN
HIS8_PYRFU      -------------------IAVGNGSDEL-INYLVKMFKGKYIVVTSPTFGMYSFFAKLHGIPVKDIPLK
HIS8_GEOTN      ALREKVANHLGVKETQ--LLFGNGSDEVVQIFCRAFLEPGTNTVMATPTFPQYRHNAIIERAEVREVPLR
HIS8_DESVV      AIAAHHG------VAPERVVAGNGSDEIIDLLIRVRATPGKHIVAFRPCFSIYELQAKFCGLEFRQADLR
HIS8_DESVH      AIAAHHG------VAPERVVAGNGSDEIIDLLIRVRATPGKHIVAFRPCFSIYELQAKFCGLEFRQADLR
HIS8_BDEBA      -----------------------GSDELIDLLCRIYCEHHDGVLTSAAAFNAYEANRAVIHKVPMAEGYR
DAPAT_SYNP6     KIAAHDFQSRGCEVDASEIFISDGSKCDCGNILDIFGN-NNRIAVTDPVYPVYVDTNVMAGGDANDRGEY
DAPAT_SYNE7     KIAAHDFQSRGCEVDASEIFISDGSKCDCGNILDIFGN-NNRIAVTDPVYPVYVDTNVMAGGDANDRGEY
DAPAT_CHLMU     KLSEKLYHG----CVNAEEIFISDGAKVDLFRLLSFFGPNQIVAVQDPSYPAYIDIARLTGAKEVSLPCL
DAPAT_CHLAB     KLSEVFYHGQ---VSPEEIFISEGAKMDIFRIFSLF-GPGKTIAVQDPSYPVYIDTALLTGSRKIKLPCT
HIS8_METTH      L------REAIADYAGVGIVGGDGADEIIDVLGRTFLEPGESFVVPMPSYMYYEYTLQAHDARAVHARWD
HIS8_BACP2      ---------EFLQVNEKQLIFGNGSDELVQIIARAFLDQHTNTVIPSPSFPQYNAIIEQAEIREVSL--L
HIS82_NITOC     -----------------------GSDELIQMVLLAVAGPGRSVVAPEPTFVMYRQIAALLGLQYQGVALR
HIS81_CAUCR     -----------------------GSDEIFALLCQVYLEPGDNIVQGEHGFAAYAIGARACQGE-VRMAKE
ALAT1_HUMAN     DVARYERRDGGIPADPNNVFLSTGASDALLVAGEGHTRTG--VLIPIPQYPLYSATLAELGAVQVDYYLD
HIS8_SERP5      LVIERYAEYAGVKKEQ--VLVSRGADEGIELLIRAFCEPGDAILFCPPTYGMYAVSAETFGVERRTVAAK
HIS8_LISW6      ------------------LIFTAGVDELIELLTRVLLDNTTNTVMATPTFVQYRQNALIEGAEVKEIPLL
HIS8_CAMC5      SYFEKEALGAKFGVGTKNIIIGSGSDQIIEFCLHAKANPQSAVLMAGVTFAMYEIYAKQVGAKIYRTRSQ
HIS81_BURPS     RLRETVAAYHGI--APEQVFAGNGSDEVLAHAFQALLQHDRPLRFPDITYSFYPTYARLYRVAYETVPLA
HIS81_BURP1     RLRETVAAYHGI--APEQVFAGNGSDEVLAHAFQALLQHDRPLRFPDITYSFYPTYARLYRVAYETVPLA
DAPT1_ANASP     KIATQDFQARGADVDAAEIFISDGSKCDTGNILDIFGD-NNIIAVTDPVYPVYVDTNVMAGHTGAANEKG
DAPAT_MICAN     KIAVHDFQARGCEISADEIFISDGSKCDTGNILDIFGD-NNSIAVTDPVYPVYVDTNVMAGGEANDRGEY
DAPAT_BACTN     AIIKNDFAPRGIHFSPSEIFVNDGASDTGNIGDILRHDNSVGVTDPIPVYIDSNVMCGRAGVLEEGTGKW
HIS8_VIBF1      -------------VKPEQVLTSRGADEGIELLVRAFCEPNDAILYCPPTYGMYSISAETIGVETKTVPLT
HIS8_LISMF      ------------------LIFTAGVDELIELLTRVLLDTTKNTVMATPTFVQYRQNALIEGAEVREIPLL
HIS8_LISMC      ------------------LIFTAGVDELIELLTRVLLDTTKNTVMATPTFVQYRQNALIEGAEVREIPLL
HIS8_LACF3      ALV-----GQQLNVAGDQLVFGVGLDEIIELVARAFLTPDDQVVVAKPAFSEYALHATVEGAAVKEVPVN
HIS8_STACT      ------------------ILFGAGLDEVILMISRAVLTPGDKIVTSQATFGQYYHNAIVESAEVVQVPLK
HIS8_MICAN      -------------IAADQIIAGNGSDDILNIALRTFVNPCESVAFLDLTYSLYETIARVHGANIIEFPTN
HIS8_LISMH      ------------------LIFTAGVDELIELLTRVLLDTTKNTVMATPTFVQYRQNALIEGAEVREIPLL
HIS8_DEHE1      ------------------IICGAGSDQLIDLLLRLFINPGDEVINCPPTFAMYKFYTDLNRGTVVNVPRD
HIS8_CYAP8      TQLRKAAANV-FGISYQNILAGNGSDDILNIAVRTFVNPGEVVAFLDLTYSLYETIARVHGASIVQIPTN
HIS8_ARATH      ------AQDSGLE--SEYILVGCGADELIDLIMRCVLDPGEKIIDCPPTFSMYVFDAAVNGAGVIKVPRN
HIS8_METI4      ----KEALSHHLDIDAENIVLGNGSNEIIELLFHVFANEEDEVLFSKYAFAVYKLMAEL-----FGVPFK
HIS8_MARMS      -----------------------GSDEVLALAFMGYFAGGKPLAFADITYSFYKVYAGLYSIEPKLIPLN
HIS8_BUCBP      ------------------ILVTRGSDEAIELLIKTFCEPRDKIMYFPPTYDMYDISAKILNVESIGIPLL
HIS8_BACLD      ALRTKLASHLGVN--ETNIILGNGTDEVIQIISRSLLDPASNTVMANPTFSQYKHNAVIEGAEVREVGLL
ALAT2_MOUSE     DVAAFITRRDGVPADPDNIYLTTGASDGISTILKLLVSGGGKVMIPIPQYPLYSAVISELDAVQVNYYLD
HIS8_VIBVU      -------------VKPEQTLTSRGADEGIELLIRAFCETNDAILYCPPTYGMYSVSAETIGVERKTVPLT
HIS8_BACSU      --LSKH-----LNVSETSLIFGNGSDEIIQIICRAFLNDKTNTVTAAPTFPQYKHNAVIEGAEVREIALR
HIS8_BACNA      --LSKH-----LNVSETSLIFGNGSDEIIQIICRAFLNNKTNTITAAPTFPQYKHNAVIEGAEVREIALR
HIS82_BURPS     ALIDRLRAVTGVPAA-CDVLLGNGSDEIISMLAMACAKPGAKVLAPVPGFVMYELSAKFAQLEFVGVPLR
HIS82_BURP1     ALIDRLRAVTGVPAA-CDVLLGNGSDELISMLAMACAKPGAKVLAPVPGFVMYELSAKFAQLEFVGVPLR
HIS81_DECAR     ------------------IVLGNGSNDVLDLIARVFLAPGRSAVFAQHAFAVYPLATLSTGAELISTPAK
HIS81_BURMA     ALIDRLRAVTGVPAA-CDVLLGNGSDEIISMLAMACAKPGAKVLAPVPGFVMYELSAKFAQLEFVGVPLR
DAPAT_SYNSC     AIAKNDFQARGCDIS-AEEIFVSDGSKCDSSNILDILGEGNKVAVTDPVYPVYVDSNVMAGGEAGEIGRY
Y1479_METJA     FLAEQVNKRGGVQITAEDIIFFNGLGDAI-AKIYGLLKRQVRVINPSPSYSTHSSAEASHAGSPPVTYFL
HIS8_CLOK5      AGAEKVCRSKYVGINRENIMAGNGSDELIQIIIAALVDKNENIMTVEPDFSMYGNYSEIGGGKALIFQLD
HIS8_CLOK1      AGAEKVCRSKYVGINRENIMAGNGSDELIQIIIAALVDKNENIMTVEPDFSMYGNYSEIGGGKALIFQLD
HIS82_HAEIN     -------------VQPNQITLGNGSNDLLELFAHTFATEGDEIMYSQYAFIVYPLVTKAINAIVKEIPAK
HIS82_HAEI8     -------------VQPNQITLGNGSNDLLELFAHTFATEGDEIIYSQYAFIVYPLVTKAINAIAKEIPAK
HIS81_GLUOX     GLREELSRQTGIDTDR--IVIGNGSEQIIRMICEAFLSPGDRLVTVLPSFGLHLIWPQMMGARAEAIPMT
HIS8_RHOSR      DLAAYLVRQTGVPVTVDNVWAANGSNEILQQLLQAFGGPGRSAM----GFVSYSMHPIIADGTETELPIR
HIS8_GEOUR      ---------------PEWIVMANGSDEVLNNLIRAFADEGDEIAYVYPSYSYYATLAEIQGARVKTYGLT
HIS8_GEOSF      ---------------PEWVIMANGSDEVLNNLIRAFADEGDEIAFVYPSYSYYATLAEVQGARVKTFGLT
HIS8_FRAP2      KLVEKLAKIYDVDAS--NILVTRGSDEGIDLLFRLYCEQKDSAFAVEPTFGMYKIAAQLQGVDYKTLKLK
HIS8_BACFN      -------------VAPAHIFLGNGSDEAIDLVFRAFCEPGDNVVAIDPTYGMYQVCADVNDVEYRKVLLH
HIS82_PSYA2     -----------------------GSDEVLALVFASFFLKNRPVLAPDISYSFYPVYANTFGIELVQIPLE
HIS82_CAUCR     -------------VSPARVVVSPGSEALIDYVFRAVLHPGDSILLSSPTFPTYEIFGRCAEARIIDVPRL
DAPAT_GEOSM     AIVEKSYKPLGVDLKTTEMFISDGSKDCANILDIFALD--NTVAIGDPVYPVYNDTNVMIGGDADDKGYY
DAPAT_GEOBB     AIIEKSYKPLGVDLKTTEMFISDGSKDCANILDIFALD--NTVAIGDPVYPVYNDTNVMIGGDADDKGYY
ARNB_ERWT9      -------------------IAVCSATAGMHVALMAGIGPGDEVITPSLTWVSTLNMIALLGATPVMIDVR
HIS8_THEMA      ELIEKILSYLDTDFLSKNNVSVGNGADEIIYVMMLMFDRS--VFFP-PTYSCYRIFAKAVGAKFLEVPLT
HIS8_STRMU      -------------VKPEQLMIANGSDDVLSIAFLAFFNNDEPVLFPDLTYGFYKVWADLYRVNYHEIPLA
HIS8_NEIMF      ------------DIPDCADIALGNGSELIQFITMLTAKPGAAMLAAEPSFVMYRHNAALYGMDYVGVPLN
HIS8_NEIMA      ------------DIPDCADIALGNGSELIQFITMLTAKPGAAMLAAEPSFVMYRHNAALYGMDYVGVPLN
HIS8_NEIM0      ------------DIPDCADIALGNGSELIQFITMLTAKPGAAMLAAEPSFVMYRHNAALYGMDYVGVPLN
HIS8_METMJ      ALRRYHGDYR--------FVTGSGMDGVIETVIRTVVEPGETMVVSTPTFSFYGIAAAAHGARVVNVPRR
HIS8_LISIN      ------------------LIFTAGVDELIELLTRVLLDTTTNTVMATPTFVQYRQNALIEGAEVREIPLL
HIS8_DEHSC      -------------VAVEQIVCGAGSDQLIDLLLRLFINPGDEVINCPPTFAMYKFYTELNRGKIVNVPRD
HIS8_DEHSB      -------------VAVEQIVCGAGSDQLIDLLLRLFINPGDEVINCPPTFAMYKFYTELNRGKIVNVPRD
HIS8_CLOCE      SVQLRQALGEYWSVDKENIIVGTGSDQLIQIIANVFLEKGDKVLYPTPSFGMYKDSCVIAGGRAVDLDQN
HIS82_PSEF5     -----------------------GSNDILELVARAYLAPGLNAVFSEHAFAVYPIVTQAVGAQARVVPAK
HIS82_BURMA     RLRETVAAYHGI--APEQVFAGNGSDEVLAHAFQALLQHDRPLRFPDITYSFYPTYARLYRVAYETVPLA
YDFD_BACSU      --------------------------QALQLISMGLLQRGSTVYLDQPSYLYSLHVFQSAGMKLTGLPM-
HIS8_SULTO      -------------VEPKNIYPTPGGDGALRAVFYNLIQTGDKVVINNPSYSMYKVYASVRGLKLTRVNLI
HIS8_LISMO      ------------------LIFTAGVDELIELLTRVLLDTTKNTVMATPTFVQYRQNALIEGAEVREIPLL
HIS8_BACFR      -------------VAPAHIFLGNGSDEAIDLVFRAFCEPGDNVVAIDPTYGMYQVCADVNDVEYRKVLLH
HIS8_AZOSE      -------------VEPREVFVGNGSDEVLAHAFMALLKHERPLRFPDISYSFYPVYCGLYGIAFETVPLD
DAPAT_GEOLS     AIIEKSYKPLGVDLKTEEMFISDGSKDCANILDIFALD--NVVAIGDPVYPVYNDTNVMIGRNIVYLPCN
HIS8_THESQ      ELIEKILSYLDTDFLSKNNVSVGNGADEIIYVMMLMFDRS--VFFP-PTYSCYRIFAKAVGAKFLEVPLT
HIS8_NEIMB      ------------DIPDCADIALGNGSELIQFITMLTAKPGAAMLAAEPSFVMYRHNAALYGMDYVGVPLN
HIS8_NATPD      A---------------AQVWLGNGGDGALDYLARAMXXXXXXXXXXXXXFAYYGMSARYHHGQVNSYPIE
HIS8_METM6      ----------------------------------------------------------------------
HIS8_BAUCH      -------------VQPNQVLACRGADEGIELLIRTFCEPSDKILFCPPTYGMYRVSAETFGVAYCAIQAL
HIS8_ARTAT      ----------GHGLSPDNIWAANGSNEVLQQILQAFGGPGRKALGFPPTYSMYPLLASGTDTEYVRGVRA
HIS8_ALISL      ------------------VLTSRGADEGIELLIRAFCEPNDAILYCPPTYGMYSISAETIGVETKTIPLT
HIS81_BRAJA     ------------DVAAEQVFVGNGSDEVLAHTFPALLKHDRPLLFPDVTYSFYPVYCRLYGVAHEEVPL-
ALAT2_HUMAN     VAAYITRRDGGVPADPDNIYLTTGASDGISTILKILVSGGGKVMIPIPQYPLYSAVISELDAIQVNYYLD
1A14_SOLLC      -----------------------GANETLILCL---ADPGDAFLVPTPYYPGFNRDLRWRSGVPISCKSC
HIS8_THIRO      --VQAALRQAMGIPSDMGLLLGNGSDELIQMLAIAVAQPGRKVLSLDPGFVMYRMIACFAGMDYVGVPLR
HIS8_NEIG2      ------------DIPDCAAVALGNGSELIQFITMLTAKPGAAMLAAEPGFIMYRHNAALYGMDYVGVPLN
HIS8_NEIG1      ------------DIPDCAAVALGNGSELIQFITMLTAKPGAAMLAAEPGFIMYRHNAALYGMDYVGVPLN
HIS8_GEOSW      ---EKVATHLGVNETQ--LIFGNGSDEVVQIICRAFLSPNTNTVMAAPTFPQYRHNAVIEGAEIREIPLR
HIS8_GEOKA      -----------------------GSDEVVQILCRAFLEPGANTVMAAPTFPQYRHNAIIERAEVREVPLR
DAPAT_PARD8     AIIKNDYASRGVFIEPSEVFISDGASDCGNIGDMLRHD--NSIGVTDPVYPVYIDSNVMSGRTGVLENGK
1A12_ARATH      ------ARGGRVTFDPERVVMSGGATGANETIMFCLADPGDVFLIPSPYYAAFDRDLRWRTGIPVPCSSS
HIS8_ROSS1      ---------------PERIICGAGSDELIDLLMRATLRPGDTMIDCPPTFAMYSFDAALYGARVVPVPRT
HIS8_GRAFK      SVKEKLSETRGV--SPNNILLGNGSDEVLDLIFRAFCEPGDNVITLPPTYGMYKVLSDINNIENREVLLN
HIS82_OCEIH     ------------------------------LLCRSYIIPGSNVVMATPTFPQYKHYSLIENAEIKEIPTD
HIS82_BURS3     ALRETVATHHRIK--PEQVFVGNGSDEVLAHTFQALLKHDRPLRFPDITYSFYPTYARLYGVQTSNVPLA
DAPAT_SYNS3     AIARDDFQARGCEIS-AEEIFVSDGSKCDSSNILDILGSGNRIAVTDPVYPVYVDSNVMAGGGLTYLPIS
DAPAT_SYNJA     AIARHDFQARGCDIDASEIFISDGSKCDCGNILDI-LGHDNTIAITDPVYPVYVDTNVMAGGPANERGEY
ARNB_KLEP7      -------------------IAVSSATGGMHVTLMAGIGPGDEVITPSQTWVSTLNMICLLGATPVMIDVN
1A1C_SOYBN      AVAKFMGRTRGVTFDPDRIVMSGGATGAHEVTTFCLADPGDAFLVPIPYYPGFDRDLRWRTGIPVMCDSS
1A1C_PHAAU      AVAKFMARTRGITFDPDRIVMSGGATGAHEVTAFCLADPGEAFLVPIPYYPGFDRDLRWRTGVPVMCDSS
HIS8_STRSV      -------------VSPDQLIIGNGSDDILSMAFLAFFNSGESVLFPDLTYGFYKVWADLYHVPFREIPLT
ARNB_KLEP3      -------------------IAVSSATGGMHVTLMAGIGPGDEVITPSQTWVSTLNMICLLGATPVMIDVN
ARNB_ECO5E      -------------------IAVSSATAGMHITLMAEIGKGDEVITPSLTWVSTLNMISLQGATPVMVDVR
ARNB_ECO57      -------------------IAVSSATAGMHITLMAEIGKGDEVITPSLTWVSTLNMISLQGATPVMVDVR
1A111_ARATH     AMAKGKIRENKVKFDTNKMVLTAGSTSANETLMFCLANPGDAFLIPAPYYPGFDRDLKWRTGVEI-VPIH
HIS8_SHEON      ALINAYSQYSGV--VESKIVASRGADEAIELLIRAFCIPGIDSIAPTYGMYAISAQTFNVGVKALSLSAE
HIS8_SHEAM      ------------------LVCGRGADEAIELLIRTFCVPGQDIFSPTYGMYAISAATFNVAVNT--LPLA
HIS8_PARD8      ---------KGVD--RSSIFLGNGSDEAIDLVIRAFCEPGDSVVTISPSYGMYEVAANVNNVECRKVSLD
HIS8_BUCAT      ------------------ILATRGADEGIELLIKAFCEPGDAIIYCPPTYDMYRINATIAGVEIKEIPIK
HIS8_BUCAI      ------------------ILATRGADEGIELLIKAFCEPGDAIIYCPPTYDMYRINATIAGVEIKEIPIK
HIS8_BUCA5      ------------------ILATRGADEGIELLIKAFCEPGDAIIYCPPTYDMYRINATIAGVEIKEIPIK
HIS82_PSEPF     -----------------------GSNDILELVARAYLAPGLNAVFSEHAFAVYPIATQAVGAQAKVVPAK
DAPAT_SYNJB     AIARHDFQARNCDIDASEIFVSDGSKCDCGNILDI-LGHDNTIAITDPVYPVYVDTNVMAGGPANERGEY
DAPAT_GEOUR     AIIEKSYKPLGVSLKTDEMFISDGSKDCANILDIFALD--NVVAIGDPVYPVYNDTNVMIGGEADDKGYY
CBL_MYCTU       EFACQRWQWHDLEVSRTAIVPDVGIVEVLRLI----TDRGDPVIVNSPVYAPFYAFVSHDGRRVIPAPLR
CBL_MYCBO       EFACQRWQWHDLEVSRTAIVPDVGIVEVLRLI----TDRGDPVIVNSPVYAPFYAFVSHDGRRVIPAPLR
1A110_ARATH     AVAGTEATKNSVTFDPSQLVLTSGASSAIEILSFCLADSGNAFLVPTPCSPGYDRDVKRTGVDIIHVPCR
PATR_CORJK      ALRGKLAQWLGVDLDN---VAVGNGSSALQQLVQATCKDGDEVVYAWRSFEAYPILCKIAGAVGVGVPLR
HIS8_JANSC      ------------------IICGVGSDEVIHFLCQCYAGPGDEVLYTQHGFGMYPIAAKAAGATPVQV-AE
HIS8_GEOSL      ---------------PAWIIMANGSDEVLNNLIRAFAGEGEEIGYVHPSYSYYATLAEIQGARVRTFGLT
HIS8_CYAA5      ------------------ILAGNGSDDILNIALRTFVNPGETVAFLDLTYSLYETIAKVHGATIQTISTN
HIS8_BUCSC      ------------------ILITRGSDEAIELLIKTFCEPQDRIVFCPPTYDMYNVSANIMGVECLQIPLL
ARNB_SHISS      -------------------IAVSSATAGMHITLMAEIGKGDEVITPSLTWVSTLNMISLLGATPVMVDVR
ARNB_SHIFL      -------------------IAVSSATAGMHITLMAEIGKGDEVITPSLTWVSTLNMISLLGATPVMVDVR
ARNB_SHIF8      -------------------IAVSSATAGMHITLMAEIGKGDEVITPSLTWVSTLNMISLLGATPVMVDVR
ARNB_SHIBS      -------------------IAVSSATAGMHITLMAEIGKGDEVITPSLTWVSTLNMISLLGATPVMVDVR
ARNB_PROMH      -------------------IAVCSATAGMHVVLMAMIGPGDEVITPSQTWVSTINIITLLGAEPVMVDIR
ARNB_ECOSM      -------------------IAVSSATAGMHITLMAEIGKGDEVITPSLTWVSTLNMISLLGATPVMVDVR
ARNB_ECOSE      -------------------IAVSSATAGMHITLMAEIGKGDEVITPSLTWVSTLNMISLLGATPVMVDVR
ARNB_ECOLU      -------------------IAVSSATAGMHITLMAEIGKGDEVITPSLTWVSTLNMISLLGATPVMVDVR
ARNB_ECOLC      -------------------IAVSSATAGMHITLMAEIGKGDEVITPSLTWVSTLNMISLLGATPVMVDVR
ARNB_ECO8A      -------------------IAVSSATAGMHITLMAEIGKGDEVITPSLTWVSTLNMISLLGATPVMVDVR
ARNB_ECO81      -------------------IAVSSATAGMHITLMAEIGKGDEVITPSLTWVSTLNMISLLGATPVMVDVR
ARNB_ECO7I      -------------------IAVSSATAGMHITLMAEIGKGDEVITPSLTWVSTLNMISLLGATPVMVDVR
ARNB_ECO55      -------------------IAVSSATAGMHITLMAEIGKGDEVITPSLTWVSTLNMISLLGATPVMVDVR
ARNB_ECO24      -------------------IAVSSATAGMHITLMAEIGKGDEVITPSLTWVSTLNMISLLGATPVMVDVR
AATR1_SCHPO     QFLKEHTRIHNPPYEGWNIIMTTGNTSCLDIALRMLTNRGDSILVEKYSFPSALQSMRPLGLSCIPIDM-
1A17_ARATH      ---------------PDRIVLTAGATAANELLTFILADPNDALLVPTPYYPGFDRDLRWRTGVPIHCDSS
1A12_CUCPE      ---------------PSRIVMGGGATGASETVIFCLADPGDAFLVPSPYYAAFDRDLKWAQIIPVHCNSS
HIS8_THEP1      ELIEKILSYLNTDFLSKSNVSVGNGADEIIYVMMLMFDRS--VFFP-PTYSCYRIFAKAVGAKFLEVPLT
HIS82_BACC1     ------------------VLCGSGLDEVIQIISRAALKAGDNIVTAGATFPQYRHHAIIEGCEVKEVPLN
DAPAT_LEPIC     SIADHDYGSLGIKIDESEIFVS-DGSKCDCGNIQEIFSTDSKIAVADPVYPVYVDTNVMAGRTEIGPDGR
DAPAT_HELMI     QIIENDYKPRGIDLGMDEVFVS-DGSKCDTANFQEILGIGNIVAVTDPVYPVYVDSNVMAGRSGVYLPCT
ARNB_SALTY      -------------------VAVSSATAGMHIALMAGIGEGDEVITPSMTWVSTLNMIVLLGANPVMVDVR
ARNB_SALSV      -------------------VAVSSATAGMHIALMAGIGEGDEVITPSMTWVSTLNMIVLLGANPVMVDVR
ARNB_SALPK      -------------------VAVSSATAGMHIALMAGIGEGDEVITPSMTWVSTLNMIVLLGANPVMVDVR
ARNB_SALPC      -------------------VAVSSATAGMHIALMAGIGEGDEVITPSMTWVSTLNMIVLLGANPVMVDVR
ARNB_SALPA      -------------------VAVSSATAGMHIALMAGIGEGDEVITPSMTWVSTLNMIVLLGANPVMVDVR
ARNB_SALNS      -------------------VAVSSATAGMHIALMAGIGEGDEVITPSMTWVSTLNMIVLLGANPVMVDVR
ARNB_SALHS      -------------------VAVSSATAGMHIALMAGIGEGDEVITPSMTWVSTLNMIVLLGANPVMVDVR
ARNB_SALCH      -------------------VAVSSATAGMHIALMAGIGEGDEVITPSMTWVSTLNMIVLLGANPVMVDVR
ARNB_ECOLI      -------------------IAVSSATAGMHITLMAKIGKGDEVITPSLTWVSTLNMISLLGATPVMVDVR
ARNB_ECOHS      -------------------IAVSSATAGMHITLMAKIGKGDEVITPSLTWVSTLNMISLLGATPVMVDVR
ARNB_ECODH      -------------------IAVSSATAGMHITLMAKIGKGDEVITPSLTWVSTLNMISLLGATPVMVDVR
ARNB_ECOBW      -------------------IAVSSATAGMHITLMAKIGKGDEVITPSLTWVSTLNMISLLGATPVMVDVR
1A12_SOLLC      ---------------PERVVMAGGATGANETIIFCLADPGDAFLVPSPYYPAFNRDLRWRTGVPIHCESS
MFNA_METKA      ----------------------SGGTEANILAAYAEVTGGREIIVPATRHFSFEKAARMLRMKLVEAPLR
HIS82_PSEAE     -------------VDAAQVTLGNGSNDILDLVARAYLAPGLNAVFSEHAFAVYPIATQAVGAEGRAVKAR
DAPAT_THEEB     KIAAHDFQARGCDIDASEIFISDGSKCDTGNILDIFGD-SNRIAVTDPVYPVYVDTNVMAGGEANERGEY
DAPAT_LEPIN     SIADHDYGSLGIKIDESEIFVS-DGSKCDCGNIQEIFSTDSKIAVADPVYPVYVDTNVMAGRTEIGPDGR
DAPAT_GEOSF     AIIDKSYKPLGVSLKTEEIFISDGSKDCANILDIFAMD--NVVAIGDPVYPVYNDTNVMIGRTGVYMPCN
DAPAT_CLOTH     KIIEYDYMPRGIRLDEDEVFVSDGAKSDTGNFQEIF-GLDNKVAVTDPVYPVYVDSNVMAGGKYLANGYF
ARNB_ENT38      -------------------IAVSSATAGMHVALMAGIQAGDEVITPSLTWVSTLNMIVLLGAEPVMIDVH
ARNB_ECOUT      -------------------IAVSSATAGMHITLMAEIGKGDEVITPSLTWVSTLNMISLLGATPVMVDVR
ARNB_ECOL6      -------------------IAVSSATAGMHITLMAEIGKGDEVITPSLTWVSTLNMISLLGATPVMVDVR
ARNB_ECOL5      -------------------IAVSSATAGMHITLMAEIGKGDEVITPSLTWVSTLNMISLLGATPVMVDVR
ARNB_ECOK1      -------------------IAVSSATAGMHITLMAEIGKGDEVITPSLTWVSTLNMISLLGATPVMVDVR
ARNB_ECO45      -------------------IAVSSATAGMHITLMAEIGKGDEVITPSLTWVSTLNMISLLGATPVMVDVR
ARNB_ECO27      -------------------IAVSSATAGMHITLMAEIGKGDEVITPSLTWVSTLNMISLLGATPVMVDVR
1A1C_DIACA      ------ARDEKVIFNPDRIVMS-GGASASETLLFCLANPGDAFLIPSPYYPAFNRDLRWRTGVPFTCSSS
1A14_ARATH      AFADFMSENRGVSFDSNNLVLTAGATSANETLMFCLADPGDAFLLPTPYYPGFDRDLKWRTGVEI-VPIQ
DAPAT_CHLCV     --------------------------------------PGKTIAVQDPSYPVYIDTALLAGAKKVKLPCR
HIS8_GEOMG      ---------------PSWIIMANGSDEVLNNLIRAFAAEGEEIGYVHPSYSYYGTLAEVQGARVRTFGLT
HIS8_FRASC      --------DAGFGVHTSQVWAANGSNEILQQLLQAFGGPGRVALGFEPSYSMHRLIALATATEWVAGQRA
HIS8_COLP3      ------------------ILATRGADEGIELIIRSFCRAQDSVLICPPTYGMYAISAENHGAGIISVPLV
HIS81_RHILO     ------------------IILGNGSEDLLSVISRAVLRPGDSVVTLYPSFPLHEDYATLMGASVKRVTVN
DEGT_BACST      -------------------IGCGNGSDAIHIALQAGVGPGDEVIXXXXXXXXXXGSIARAGAKPVFVDI-
DAPAT_DESDA     VIMQYDYKVRGVTLAPDEIFVSDGAKPDVGNFQELFAQDSI-VAVTDPVYPVYVDSNVMAGRSG---EIK
DAPAT_CYAP7     KIAQNDFQARGCDI-DASEIFISDGSKCDTGNILDIFGKNNTIAVTDPVYPVYVDTNVMAGANDKGEYL-
HIS8_PSEST      ---------------------------------------GPNAVFSAHAFAAYPLCTQAAGAESRVVPAV
HIS8_FLAJ1      -----------------------GSDEVLDLLFRAFCEPNDNIISLPPTYGMYGVLANINAVENREILLT
DAPAT_PARUW     AIAEQYYQGK---IDPQEVFVSDGGSDATIAVQNAYVDTGGQASFFQTSTKQYQRITYMSC-----LPEN
ALAT1_BOVIN     DVARYERRDGGIPADPNNIFLSTGASDAIVTVLKLLVTGEGRVLIPIPQYPLYSAALAEFNAVQVDYYLD
1A1C_MALDO      FMAE--IRGNKVTFDPNHLVLTAGATSANETFIFCLADPGEAVLIPTPYYPGFDRDLKWRTGVPIHCTSS
1A18_ARATH      FMSEN--RGNRVSFNPNKLVLTAGATPANETLMFCLADPGDAFLLPTPYYPGFDRDLKWRTGAPIQCKSA
1A11_CUCPE      ---------------PSRIVMGGGATGASETVIFCLADPGDAFLVPSPYYAGFDIIRVHCNGSNNFQVTK
HIS8_MYCLE      DLASYLTAQTGIRLGVENIWAANGSNEILQQLLQAFGGPGRSAIGFVPSYSMHPIIADGTHTEWLETVRA
HIS8_MYCLB      DLASYLTAQTGIRLGVENIWAANGSNEILQQLLQAFGGPGRSAIGFVPSYSMHPIIADGTHTEWLETVRA
HIS8_HELHP      ----KNALASHFDVESKHIIIGAGSDQIIEFCMQALNHHNAQVLMAKTTFAMYEVYAKLAGVEISKTPSD
HIS8_CYTH3      -----------------------GSDEPIDLLIRATCQPGDSILILPPTYGMYEVSAGINDVDIISVPLT
DAPAT_PROM3     AIAKHDFQNKGCQIN-AEEIFVSDGSKCDSSNILDILGSSNRIAVTDPVYPVYVDSNVMAGGRYAGLPIN
DAPAT_CHLFF     KLSEVCYRGK---VSPEEIFISDGAKTDI-FRLFSLFGPGKTIAVQDPSYPAYIDAAILAGARKVKLPCT
ARNB_EDWI9      -------------------IAVCSATAGMHVTLMAGIGPGDEVITPSMTWVSTLNIITLLGATPVMIDVR
HIS8_BUCAP      ------------------ILVTRGADEGIELLIKAFCEPGDAIIYCPPTYDMYAINAKIANVEIKEIPFK
HIS8_BRAHW      --------------------------EILAFCFMAFFNRGDKIYYPNITYSFYSVYSSLFDLNEVKIPLK
HIS8_BACSK      ALAAKHKVDEGQ------LILGNGTDEVIQLLCRSFLTPETNTVMATPSFSQYKLNATIEGATIKEITVK
HIS82_BACCR     ------------------VLCGSGLDEIIQIISRAVLRAGDNIVTAGATFPQYRHHAIIEGCEVKEVALN
HIS82_BACAN     ------------------VLCGSGLDEVIQMISRAVLKAGDNIVTAGATFPQYRHHAIIEGCEVKEVALN
DAPAT_LEPBL     SIANNDYGSLGIKIDESEIFVS-DGSKCDCGNIQEIFSTDAKIAVSDPVYPVYVDTNVMAGRTEIGADGR
DAPAT_LEPBJ     SIANNDYGSLGIKIDESEIFVS-DGSKCDCGNIQEIFSTDAKIAVSDPVYPVYVDTNVMAGRTEIGADGR
ARNB_SERP5      -------------------IAVCSATAGMHITLMANIGPGDEVITPSQTWVSTLNMIELLGATPVMIDVR
ARNB_SALPB      -------------------VAVSSATAGMHIALMAGIGEGDEVITPSMTWVSTLNMIVLLGATPVMVDVR
ARNB_SALG2      -------------------VAVSSATAGMHIALMAGIGEGDEVITPSMTWVSTLNMIVLLGATPVMVDVR
ARNB_SALEP      -------------------VAVSSATAGMHIALMAGIGEGDEVITPSMTWVSTLNMIVLLGATPVMVDVR
ARNB_SALDC      -------------------VAVSSATAGMHIALMAGIGEGDEVITPSMTWVSTLNMIVLLGATPVMVDVR
ARNB_SALA4      -------------------VAVSSATAGMHIALMAGIGEGDEVITPSMTWVSTLNMIVLLGATPVMVDVR
HIS8_THENN      ELIEKILEYLDADFLRENNVSIGNGADEIIYVMMLMFERA--VFFP-PTYSCYRIFAKAVGAKYLEIPLT
HIS82_DECAR     -------------VSAQQVFVGNGSDEVLAHIFMALLKHDQPIIFPDITYSFYPVYCGLYGVEYQTLPLA
HIS82_BACHK     ------------------VLCGSGLDEVIQMISRAVLKAGDNIVTAEATFPQYRHHAIIEGCEVKEVALN
GLDSA_STRRI     -------------------VPAASGTASLMLALEAGIGAGDEVIVPGLSWVASGSTILGVNAVPIFCDVD
DAPAT_PROMA     AIAKNDFQSRGCQIS-ADEIFVSDGSKCDSSNILDILGTGNKIAVTDPVYPVYVDSNVMAGQTGIAASSG
DAPAT_METS3     EIIKNDFEPFGVSLDTDEVFISDGAKCDTGNIQEIF-DLGNKIAXXXXXXXXXXXXXXMAGGEMKDDGMY
DAPAT_GEOSL     AIIEKSYKPLGVDLKTEEMFISDGSKDCANILDIFALD--NVVAIGDPVYPVYNDTNVMIGGEADDKGYY
DAPAT_EUBE2     AIADHDYKKRGCDISADEIFVSDGASDSGNIGDIFSVD--NKIAVCDPVYPVYVDTNAMAGSNVVYMPCT
DAPAT_CYAP4     SIAEHDFQRRGCEIDASEIFVSDGSKCDTGNILDIFGD-NNTIAVTDPVYPVYVDTNVMAGHTGAANEQG
DAPAT_CYAA5     KIAAQDFQARGCDIDASEIFVSDGAKCDTGNILDIF-GKNNKIAVTDPVYPVYVDTNVMAGGETNEKGEY
COBD_THETN      ------------------IIVGNGAAELIHLFARAF--KLKKPLIPSPSFLEYERAVKLNGGEPVYLKLE
ARNB_PECCP      -------------------IAVSSATGGMHVTLMAGIGPGDEVITPSQTWVSTVNMITLLGAEPVMVDVR
1A11_CUCMA      -----------VQFDPSRIVMGGGATGASETVIFCLADPGDAFLVPSPYYAAFDRIIRVHCNSSNNFQVK
HIS8_SYNY3      ----------GVDLNQ--VLAGNGSDDILNIVVRTFVDPGETVAFLDLTYSLYETIASVHGAKVQKIATD
HIS8_LACLS      -----------------------GSDEVLSLSFLTFFNGQRAILMPDISYSFYPIYCELYRIPYQKIPLA
HIS8_CLOAB      -----------------------GSDEVLAFSFMTFFSPRKTVFFADITYSFYKVYANLLNLNCELIPLK
DAPAT_PROM4     AIAKFAYQARNCEITPEEIFVSDGSKCDSSNILDILGD-NNRIAVTDPVYPVYVDSNVMVGGRYQGLPMN
ARNB_YERPY      -------------------IAVCSATAGMHITLLAGIGPGDEVITPSQTWVSTINMIVLLGAEPVMVDVR
ARNB_YERPS      -------------------IAVCSATAGMHITLLAGIGPGDEVITPSQTWVSTINMIVLLGAEPVMVDVR
ARNB_YERPP      -------------------IAVCSATAGMHITLLAGIGPGDEVITPSQTWVSTINMIVLLGAEPVMVDVR
ARNB_YERPN      -------------------IAVCSATAGMHITLLAGIGPGDEVITPSQTWVSTINMIVLLGAEPVMVDVR
ARNB_YERPG      -------------------IAVCSATAGMHITLLAGIGPGDEVITPSQTWVSTINMIVLLGAEPVMVDVR
ARNB_YERPE      -------------------IAVCSATAGMHITLLAGIGPGDEVITPSQTWVSTINMIVLLGAEPVMVDVR
ARNB_YERPB      -------------------IAVCSATAGMHITLLAGIGPGDEVITPSQTWVSTINMIVLLGAEPVMVDVR
ARNB_YERPA      -------------------IAVCSATAGMHITLLAGIGPGDEVITPSQTWVSTINMIVLLGAEPVMVDVR
ARNB_YERP3      -------------------IAVCSATAGMHITLLAGIGPGDEVITPSQTWVSTINMIVLLGAEPVMVDVR
ALAT1_MOUSE     DVAQYERRDGGIPADPNNIFLSTGASDALLVAGEGRARTG--VLIPIPQYPLYSAALAELDAVQVDYYLD
1A1L1_MOUSE     ----------------------------------------------------------------------
1A19_ARATH      -------RGNRVTFDPSKIVLAAGSTSANETLMFCLAEPGDAFLLPTPYYPGFDRDLKWRTGAEIGFQIT
1A16_ARATH      -------RNNKVKFDPDRIVMSGGATGAHETVAFCLANPGDGFLVPTPYYPGFDRDLRWRTGVPVTCHSS
HIS8_PHOPR      DLIQAYADYAGIDSKQ--VLTSRGADEGIELLIRTFCEPNDSILYCPPTYGMYAISAETFDIKTKTVPLT
HIS81_BORPA     -----------VGVQADQVFVGNGSDEVLAHVFMALFRHGRPVRFPDISYSFYPVYCGLYEIPYQVVPLT
HIS81_BORBR     -----------VGVQADQVFVGNGSDEVLAHVFMALFRHGRPVRFPDISYSFYPVYCGLYEIPYQVVPLT
DAPAT_SYNPX     AIAKHDFQARGCDIS-AEEIFVSDGSKCDSSNILDILGEGNRIAVTDPVYPVYVDTNVMXXXXXXXLPIS
DAPAT_NOSP7     KIAAQDFQARGANIDASEIFISDGSKCDTGNILEIF-GHDNLIAVTDPVYPVYVDTNVMVGGDANDKGEF
HIS8_ACIBS      ALKQAIAKQQNIDVSQ--VFVGNGSDEVLAHIFKAFFLQDEPILYPDITYSFYPVYSQFFGTKTKEIPLN
DAPAT_PROMM     AIAKHDFQTKGCQIN-AEEIFVSDGSKCDSSNILDILGSSNRIAVTDPVYPVYVDSNVMAGGRYAGLPIN
DAPAT_GEOMG     AIIEKSYKPLGVSLKTEEMFISDGSKDCANILDIFALD--NVVAIGDPVYPVYNDTNVMIGGDADEKGYY
DAPAT_DESAH     KIASEDFKARGADI----------DSDEIFVSDGAKCDTGNRIAIPDPVYPVYLDTNVMAGGRYGGVSYM
DAPAT_CHLPN     ----------------------------------------------DPVYPAYRDIAHITGRDIIPLACR
ARNB_YERE8      -------------------VAVCSATAGMHITLMAGIGPGDEVITPSQTWVSTINMIVLLGAEPVMVDIR
ARNB_SODGM      -------------------IAVSSATGGMHVTLMAGLGPGDEVITPSLTWVSTLNMICLLGAEPIMIDVR
ARNB_SALTI      -------------------VAVSSATAGMHIALMAGIGEGDEVITPSMTWVSTLNMIVLLGATPVMVDVR
ARNB_PSEU2      -------------------VALSSATGAMHVALLAGVGPGDEVITPSQTWVSTANMICLLGATPVFVDVR
HIS8_SULNB      ----KEALSRKFDVEDENIIIGAGSDQVLEFISRALLNEASSVLMSAVTFAMYEIYAKQMGAKIIRTESY
HIS8_DESHY      ----KEALSRYTGVPAEGILTGNGSDELIQLLMTTFGGEKGAVVIHPPTFSMYEAAARVTGTGVLEVPL-
HIS8_CELJU      ------------NISPEQVFVGNGSDEVLGLLFMAFFQQGKAVLFPDITYSFYPVYCKLFNIDYRTVPLN
HIS82_BACCZ     ------------------VLCGSGLDEVIQIISRAVLKAGDNIVTAGATFPQYRHHAIIEGCEVKEVALN
HIS81_BORPE     -----------VGVQADQVFVGNGSDEVLAHVFMALFRHGRPVRFPDISYSFYPVYCGLYEIPYQVVPLT
GLDSA_STRFR     -------------------VPAASGTAGLMLALEAGVGAGDEVIVPGLSWVASGSTVLGVNAVPVFCDVD
AADAT_RAT       WLKQKLHNPPTVNYSPMDLCITSGCQDGLCKVFEMLINPGDTVLVNEPLYSGALFAMKPLGCNFISVP-S
1A1L1_HUMAN     -----------VPLRPENVVVLNGGASLFSALATVLCEAGEAFLIPTP---YYGAITRLADSEVTGLDTR
1A15_ARATH      -------RGNRVTFDPKKIVLAAGSTSANETLMFCLAEPGDAFLLPTPYYPGFDRDLKWRTGAEIGFQIT
HIS8_ROSCS      ---------------PERIICGAGSDELIDLIMRAVLRPGDVMVDCPPTFAMYSFDAALYGARIVAVPRT
HIS8_CORGL      ELAAYITKQTGVAVTRDNLWAANGSNEILQQLLQAFGGPGRTALGFQPSYSMHPILAKGTHTEFIGADFR
HIS8_CORGB      ELAAYITKQTGVAVTRDNLWAANGSNEILQQLLQAFGGPGRTALGFQPSYSMHPILAKGTHTEFIGADFR
HIS8_ARCB4      ALAKKY------NLESSNIIIGSGSDQILEFCIHAKCKKDSKILMAKTTFAMYEIYGKHVGAEIIKTNSE
HIS8_ACIBT      ALKQAIAKQQNIDVSQ--VFVGNGSDEVLAHIFKAFFLQDEPILYPDITYSFYPVYSQFFGTKTKEIPLN
DAPAT_DESHY     KIIANDYAPRGVQLGMDEVFVSDGASDTANFQEIFGVD--NIMAVTDPVYPVYVDSNVMAGGRIIYLPCT
DAPAT_DESHD     KIIANDYAPRGVQLGMDEVFVSDGASDTANFQEIFGVD--NIMAVTDPVYPVYVDSNVMAGGRIIYLPCT
DAPAT_CLOPH     AIAKHDYEARGVQIALDEIFISDGAKSDSGNIGDIFAE-NNKIAVCDPVYPVYVDTNVMAGSNVIYMPCT
ARNB_AERS4      --------------------ATAG----MHVTLMAGIGPGDEVITPSQTWVSTINLITLLGAEPVFVDVR
1A12_CUCMA      ALVEFMAEIRGVSFEANNIVLTAGATSANETLMFCLAEAGDAFLLPTPYYPGFDRDLKWRTGVPIHCTSS
HIS8_CHRSD      ALAETY------DVATEQVFVGNGSDEVLALAFQAFFRQSRPLLMPAISYSFYPVYCKLYDVAYRSVAL-
HIS8_ACIB5      ALKQAIAKQQNIDVSQ--VFVGNGSDEVLAHIFKAFFLQDEPILYPDITYSFYPVYSQFFGTKTKEIPLN
HIS8_ACIB3      ALKQAIAKQQNIDVSQ--VFVGNGSDEVLAHIFKAFFLQDEPILYPDITYSFYPVYSQFFGTKTKEIPLN
HIS81_OCEIH     -----------------------GSDEVLAFSFMSFFEPGNRIKYPEITYSFYPVYAKLFNISTDVIPLN
DAPAT_METST     DVIENDYKPLGVELKNSEVFISDGAKCDTGNFQELF-SKDNIIAVTDPVYPVYVDSNVMAGGKMGEDGFY
DAPAT_DESPS     AIAENDFQSRGAGIV-ADEIFVSDGAKCDTSNIQEIFSAETKIAIPDPVYPVYLDTNVMAGRTGLFADGR
ALAT1_RAT       DVAQYERRDGGIPADPNNIFLSTGASDALKLLVSGEGRARTGVLIPIPQYPLYSAALAELDAVQVDYYLD
HIS8_VESOH      -----------------GVLLGNGSDELIQLLALA-CNTGDTVLSVEPSFVMYGMITKFTRLNYQSVLLT
HIS8_DIAST      ------------------VLLGNGSDELISLVALACARAQATVLAPVPGFVMYAMSAQLQGLGFVGVPLT
GLDSA_STRKN     ----------------AHCVPASSGTASLMLALEAGVGAGDEVILPGVTWVASASTVVGVNAVPVFADID
DAPAT_PELPD     SVIEKSYNKLGVELKTSEIFVSDGSKDCANILDIFAMD--NVVAIGDPVYPVYNDTNVMIGGEADDRGYY
DAPAT_METTH     AIAENDYASRGVDIT-ADEIFISDGAKCDTGNIQEIFGLDNVVAVTDPVYPVYVESNVMAGSGLVYLPCT
DAPAT_AZOPC     AILKNDFTDKGISIEADEIFVNDGAKSDTGNIGDI-LGQDNHIAITDPAYPVYVDTNRMAGRTIELLPCT
1A1L1_BOVIN     ----------------------------------------------------------------------
HIS8_STRTD      -----------------------GSDDILSMAFLAFFNSEEKIIFPDLTYGFYKVWADL-----YRIPFR
HIS8_RHOOB      DLAAYLVRQTGVPVTVDNVWAANGSNEILQQLLQAFGGPGRSAM----GFVSYSMHPIIADGTETELPIR
HIS8_BIFLO      ------ARESGTRLDVDELWGANGSNEIMLQLFQAFGGPGRTALGADPTYSMYPEYARDTFTGWKLAHRN
HIS8_ACIBY      ATVLKQAKQQNIDVSQ--VFVGNGSDEVLAHIFKAFFLQDGPILYPDITYSFYPVYSQFFGTKTKEIPLN
HIS8_ACIBC      ATVLKQAKQQNIDVSQ--VFVGNGSDEVLAHIFKAFFLQDGPILYPDITYSFYPVYSQFFGTKTKEIPLN
DAPAT_PROMT     IISENDYISRGCEISAEEIFVSDGSSNILDLGKENKIAVTDPVY---PVYVDTNVMTGRTGANSVGIPIN
DAPAT_PELCD     TLIEKAYKPLGVELKTSEIFISDGSKDCANILDIFALD--NKVAICDPVYPVYNDTNVMVGGEADDKGYY
DAPAT_EUBR3     AISDNDYKARGCDIS-ADEIFVSDGAKSDSANIQELFSANSRIAVTDPVYPVYVDSNVMAGSNVIYMPST
AVTA_ECOLI      LLAGMLREKLGWDIEPQNIALTNGSQSAFFYLFNLFAGRRADVLFPAPEYIGYDAGLE----EDLFVSAR
AADAT_HUMAN     ---------------------TSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINV-AS
HIS8_MYCUA      DLANYLTAQTGTRIGFENVWAANGSNEILQQLLQAFGGPGRTAIGFVPSYSMHPIISDGTHTEWVETARA
HIS8_LACLM      -----------------------GSDEVLSLSFLTFFNSEKPLLMPDISYSFYPIYCGLYHIPYQKIPLA
ARNB_PHOLL      -------------------VALASATAGMHLTLMAGIGPGDEVITPSQTWVSTINMICLLGAEPIMIDVR
ARNB_ERWCT      -------------------IAVSSATGGMHVTLMAGIGPGDEVITPSQTWVSTVNIITLLGAEPVMVDVR
AADAT_BOVIN     ---------------------TCGSQEGLCKVFEMIVNPGDNILVNEPIYSGTIHALQPLGCNMINVS-S
PTSJ_SALTY      ---------------------TSGAIDAIERLLCAHLLPGDSVAVEDPCFLSSINMLRYAGASPVSV---
ARNB_PSEPF      -------------------VALSSATGAMHVTLLAGIGPGDEVITPSQTWVSTANMISLLGATPVFVDVR
ALAT2_XENTR     DVAKYERRDGGIQSDPNNIYLSTGASDSLKLLVSGQGKSRTGVLIPIPQYPLYSAALAELNAVQVNYYLD
1A11_PRUMU      AMFMSKARGGRVTFDPNRVVMSGGATGANELVMFCLADPGDAFLVPSP---YYPAFFRDLGWRPVDCDSS
1A11_ORYSJ      ALARFMSEQRGYKVVPSNIVLTAGATSANEALMFCLADHGDAFLIPTPYYPGFDRDLKWRTGAPVHCASA
1A11_ORYSI      ALARFMSEQRGYKVVPSNIVLTAGATSANEALMFCLADHGDAFLIPTPYYPGFDRDLKWRTGAPVHCASA
HIS8_PELCD      ---EEAGRLYGFD--PDWVIMANGSDEVLNNLIRAFAGEGEEIAYVHPSYSYYSTLAEIQGAKVRTFLLD
DAPAT_SYNP2     KIAAHDFQARGCDIDASEIFVSDGAKCDTGNILDIF-GKDNTIAVTDPVYPVYVDTNVMAGGEADESGKY
ARNB_PSEF5      -------------------VALSSATGAMHITLLAGIGPGDEVITPSQTWVSTANMICLLGATPVFVDVD
AADAT_MOUSE     ---------------------TSGCQDGLCKAFEMLINPGDTILVNEPLFPGTLYAMKPLGCNIINVP-S
NTDA_BACSU      ------------------VIATSSGTDAIMIGLLAGLNPGDEVIMPANSFSATENAVLASGGVPIYVDIN
NORG_STAAC      IIVERMSK-QGINVGRENVMITSGALHAIQLLSIGFLGQDAIIISNTPSYIHSTNVFEQLNFRHIDVPYN
NORG_STAA8      IIVERMSK-QGINVGRENVMITSGALHAIQLLSIGFLGQDAIIISNTPSYIHSTNVFEQLNFRHIDVPYN
NORG_STAA3      IIVERMSK-QGINVGRENVMITSGALHAIQLLSIGFLGQDAIIISNTPSYIHSTNVFEQLNFRHIDVPYN
HIS8_POLNA      -----------------------GSDELIALLALACDVPGGSVLAPLPGFVMYAMSAQLQGLKFIGVDLT
HIS8_BACTN      -------------VSPQHIFLGNGSDEAIDLVFRAFCEPEDNVVAIDPTYGMYQVCADVNNVEYRKVLLD
HIS81_NITMU     -----------------------GSDEIIQIIALACGKPGAVLMSVEPAFVMFRMIATFASMNYVGVPLH
HIS81_NITEU     ---------------PAGIMLGNGSDEIIQIIMLAAAKPEAKLLTIEPGFAMFKMIATFANMQYIGIPLK
DAPAT_TRIEI     KIAAQDFQGRGCDI-DASEIFISDGSKCDSGNILDIIGNNNTIAVTDPVYPVYVDTNVMAGNTGVYLPIR
DAPAT_PROM1     IISENDYISRGCEISAEEIFVSDGSSNILDLGKENKIAVTDPVY---PVYVDTNVMTGRTGANSVGIPIN
ARNB_PSEAE      -------------------VALSSATGALHVTLLAGIGPGDEVITPSLTWVSTANVITLLGATPVFVDVR
ARNB_PSEAB      -------------------VALSSATGALHVTLLAGIGPGDEVITPSLTWVSTANVITLLGATPVFVDVR
ARNB_PSEA8      -------------------VALSSATGALHVTLLAGIGPGDEVITPSLTWVSTANVITLLGATPVFVDVR
ARNB_PSEA7      -------------------VALSSATGALHVTLLAGIGPGDEVITPSLTWVSTANVITLLGATPVFVDVR
HIS8_STRGC      -------------VSPDQLIIGNGSDDILSMAFLAFFNSGESVLFSDLTYGFYKVWADLYQVPFREIPLT
HIS8_MYCMM      DLANYLTAQTGTRIGFENVWAANGSNEILQQLLQAFGGPGRTAIGFVPSYSMHPIISDGTHTEWVETARA
HIS8_CLOBK      -----------------------GSDEVLALSFLTFFNPEETVVFSDISYSFYPVYANLYKLDYKLAKIR
HIS81_BACC1     ----------------------SGLDEVIQMISRALLHEGTNVVMANPTFSQYHHHAVIEGAKVREVPLK
GLDSA_STRSD     SAERRFARDFAAYNGVAHCVPAASGTASLMLALESGVGVGDEVIAPGLSWVA--SASTIVGVNAVPVLVD
ARO8_YEAST      ------------------VLATAGNTNAWESTLRVFCNRGDVILVEAHSFSSSLASAEAQGVITFPVPID
1A13_SOLLC      ------------------LVLTAGATSANETLMFCLANQGDAFLLPTPYYPGFDRDLKWRTGAPIHCSSS
HIS8_CLOB8      -----------------------GSDEILAFSFMTFFSKNKKILFPDISYTFYKVYAELFDLNYELVKLD
HIS8_CAMLR      ----KQALAQKYDILKENLIIGSGSDQIIEYIVHAKLDHSKAYLQCGVSFAMYEIYAKQLGVKVYKTPLT
1A1C_TOBAC      ---------------PERVVMAGGATGANETIIFCLADTGDAFLVPSPYYPAFNRDLRWRTGVPIPCDSS
HIS8_SULDN      ----KNALSKRYNVDSENVIIGSGSDQVIEFLIHAKAHSGSKILMNSITFAMYEIYSKHVGADVIRTSSQ
HIS8_ACISJ      ------------------VLLGNGSDELISLVALACARAQATVLAPVPGFVMYAMSAQLQGLGFVGVPLT
HIS82_GLUOX     -----------------------GSDEVLAHAFRALFHDDAPVLFSDVTYGFYPVYCGLFEQPFRHIPLN
ARNB_AERHH      HELEQQFCDTGCQHAVALCSATAG----MHVTLLAGIGPGDEVITPSQTWVSTINIITLLGAEPVFVDVP
NORG_STAAB      IIVERMSK-QGINVGRENVMITSGALHAIQLLSIGFLGQDAIIISNTPSYIHSTNVFEQLNFRHIDAPYN
HIS8_XANC5      --------------APEQLLIGRGSDEAIDLLVRGLCVPGDAVLVTPPVFGMYAVCARLQNAPLVDVPLV
HIS83_RHIME     ------------DVENNQVILGNGSEDLIAVICRSVVRAGDTVVTLYPSFPLHEDYTTLMGGKVDRVTVT
NORG_STAAN      IIVERMSK-QGINVGRENVMITSGALHAIQLLSIGFLGQDAIIISNTPSYIHSTNVFEQLNFRHIDVPYN
NORG_STAAM      IIVERMSK-QGINVGRENVMITSGALHAIQLLSIGFLGQDAIIISNTPSYIHSTNVFEQLNFRHIDVPYN
HIS8_CAMC1      ------------------LIIGSGSDQIIEFALHAKANRQSGVLMAGVTFAMYEIYAKQTGAKIYRTKVE
GSA_MYCSS       EIISRVAPVERLRMVNSGTEATMS---AIRLARGFTGRPKSDALLADAGLPSSPGVTGAATADTIVLPYN
GSA_MYCSK       EIISRVAPVERLRMVNSGTEATMS---AIRLARGFTGRPKSDALLADAGLPSSPGVTGAATADTIVLPYN
DAPAT_DESOH     AVAANDYQARGADIQPDEVFISDG----------AKCDTGNRVAIPDPVYPVYLDTNVMAGGNIVYMECT
COBD_SALTY      ---------------PASWILAGNGETESIFTVASGLKPR-RAMIVTPGFAEYGRALAQSGCEIRRWSLR
1A1L2_HUMAN     -------------------------------------DPGEAFLVPAPFYGGFASSSRYAKVELIPVHLE
HIS8_HYDS0      ------------EVEPENIMVCNGSDEAIQYLMLGIGELDEGVLIPRPTFPMYEVIANALGKPIYDVDLD
DAPAT_ARATH     ----------------------------------------------------------------------
COBD_SALTI      ---------------PASWILAGNGETESIFTVASGLKPRRAIIVT-PGFAEYGRALAQIGCEIRRWSLR
HIS82_RHIME     AIAARH------QVSVGEVFVGNGSDEVLAHTFAALLKHDRPLLFPDISYSFYTTYAGLFGIEAVEVPLD
ALAT2_XENLA     DVAKYERRDGGILSDPNNIYLSTGASDSLKLLVSGQGKSRTGVMIPIPQYPLYSAALAELDAVQVNYYLD
HIS8_PSEU2      ----KHAVADYYKVQPSQVFLGNGSDEVLAHIFHALFQHDAPLLFPDISYSFYPVYCGLYGIDYETVPLD
HIS8_CAMFF      -------------VEPKNVIIGSGSDQIIEFALHAKANEKKGILVSGVTFAMYEIYAKHVGAKIYKTKSK
GSA_MYCSJ       EIISRVAPVERLRMVNSGTEATMS---AIRLARGFTGRPKSDALLADAGLPSSPGVTGAATADTIVLPYN
DAPAT_PROM0     KISEHDFISRGCQISSEEIFVSDGSKDSSNILDILGKDNSIAVTDPVPVYVDSNVMTGRTGGTYKGLTIN
ALAT_YEAST      ----------------------------------------------------------------------
HIS8_BUCDN      ------------------ILVTRGADEGIELLIRAFCESGDAIIYCPPTYDMYRVNAEIYNIKYKEVPIK
HIS8_BACCN      -------------VQPEQLLFGSGLDEVIQMISRALLHKGTNVVMARPTFSQYRHHAIIEGAEVREVPLK
HIS8_ACIAD      ASLLKQAIAKQQHLSVEQVFVGNGSDEVLAHIFKAFFIQDEPILYPDISYSFYPVYSQFFGVQTKQIPLN
HIS8_ACIAC      -----------------------GSDEIITLLALACARPGTAMLAPMPGFVMYPMSAQLQGLDFVAVPLT
GSA_PROAC       AIIERMAPVEKVRFVSTGTEATM---TAVRLARGA---TGRDVIVKFAGYHGHSDVLLAAAGSGVGLPTA
GLDSA_MICEC     -------------------VPTSSGTASLMVALEAGVGAGDEVIIPGLTWVANSTXXXXXXXXXXXXXXX
1A11_ARATH      ----ERARGGRVRFEAERVVMSGGATGANETIMFCLADPGDAFLVPTPYYAAFDRDLRWRTGIPVECSSS
HIS8_PSEE4      ----KQAVAEYYGVTPAQVFVGNGSDEVLHIFHGLFQHDRGPLLFPDVSYSFYPVYCGLYGIAFEQVELD
HIS8_LACLA      ------------------VIIGNGSDEVLSLSFLTFFNSQSPLLMPDITYSFYPIYCELYRIPFQKVPVD
HIS82_LEGPL     ----------------------------------------------------------------------
HIS82_LEGPH     ----------------------------------------------------------------------
DAPAT_LAWIP     EIIANDYTSRNVHIE-ADEIFVSDGTKCDIANIQELFDPSDTVAIIDPVYPVYIDSNVMSGGKLIN-GIW
DAPAT_CYAP8     KIATHDFQARNCDVDASEIFVSDGAKCDTGNILDI-FGKNNKIAVTDPVYPVYVDTNVMAGGEVNDKGEY
RFFA_ECOLI      ----------------AKVLLTPSCTASLEMALLLDIQPGDEVIMPSYTFVSTANAFVLRGAKIVFVDVR
HIS8_PROAC      ---EDLARYIGFGISSSQIWPANGSNEVMTHILQAFGGPGRSMLTFTPTYSMYPEYARNTHTNYVTRPRN
HIS82_LEGPA     ----------------------------------------------------------------------
HIS81_BACCZ     ----------------------SGLDEVIQMISRALLHEGTNVVMANPTFSQYHHHAVIEGAEVREVSLK
GLADA_MICEC     --------------AKYGLLAT-NGTVTLSMALRAGIHAGDEVITTAFTWVGTVAGIVHVNAVPVLADIS
Y2256_MYCBO     AVAERHGRTRD-EVLP--LVGAAEGFALLHN------------LSPVRAAIVVPAFTEPAIALSAAGITA
Y2231_MYCTU     AVAERHGRTRD-EVLP--LVGAAEGFALLHN------------LSPVRAAIVVPAFTEPAIALSAAGITA
MFNA_METST      ---------------PCGHIVT-GGTEANIMAMEEENEGTPELILPKSAHFSFKKVLSMLSVKPVYVPLN
HIS8_XANAC      --------------APEQLLIGRGSDEAIDLLVRGLCVPEDAVLVTPPVFGMYAVCARLQNAPLVDVPLV
HIS8_PSEPK      ----KQAVAEYYGVTPAQVFVGNGSDEVLAHIFHGLFQHDAPLLFPDISYSFYPVYCGLYGIAFEQVALD
HIS8_PSE14      ----KHAVADYYKVQPNQVFLGNGSDEVLAHIFHALFQHDASLLFPDISYSFYPVYCGLYGIDYEMIALD
HIS8_DEIRA      ----------------AGVVITPGSNVLIKILTELG-GIGQTVLTTDPTFSVYTLEAAMLGAELVLTPLN
HIS81_BACHK     ----------------------SGLDEVIQMISRALLHEGTNVVMANPTFSQYHHHAVIEGAEVREVSLK
HIS81_BACAN     ----------------------SGLDEVIQMISRALLHEGTNVVMANPTFSQYHHHAVIEGAEVREVSLK
GLYA_DIAST      -VIEQLAIDRIKQLAEAANVQPNSGSQANQAVLMAFLKPGDTILLAEGGHLTHGMPLNMSGKNVVSYGLN
GLYA_ACISJ      -VIEQLAIDRIKQLAEAANVQPNSGSQANQAVLMAFLKPGDTILLAEGGHLTHGMPLNMSGKNVVSYGLN
HIS8_XANCB      --------------APEQLLIGRGSDEAIDLLVRGLCVPEDAVVVTPPVFGMYAVCARLQNAPLVEVPLV
HIS8_SYNAS      ---QKIARKYSVDVD--NIFVGNGSDEILSFVWYAFFDGYGKLVFPQFTYSFYPVYCDFYEIPYRRIPLR
HIS8_PSEPG      ----KQAVAEYYGVTPAQVFVGNGSDEVLAHIFHGLFQHDAPLLFPDISYSFYPVYCGLYGIAFEQVALD
HIS8_CAMHC      -------------VSEKNVIIGAGSDQIIEFLIHAKCNENNGILTAGTTFSMYGIYAKHAKAKHFSTASK
MALY_ECOLI      ----------------------------------------------------------------------
DAPAT_PROM5     KISKNDFISRGCQITPEEIFVSDGSSNILDILGHDNLIAVTDPVYPV--YVDSNVMTGRTGGTYQGLAIN
HIS8_NITSB      ----KSALAKRFEIDQKNIIIGAGSDQVLEFCARAVLNEKSSVLMSKITFAMYEIYALQQGAKIIRSSCR
GCSPB_PYRHO     -----------------------------------HLDRGDEILVPDSAHGTNPASASMAGFKVVEIPSN
ALAT2_DANRE     DVAKYERRDGGIPSDPDNIYLTTGASDGIVTILKL-LTAGEGVMISIPQYPLYSASIAELGAVQINYYLN


                         +         .         .         .         .         *         .:210
query           DDLTLAPETVEDHITDDTAAFVVNSPANPTGAVQSPADMRAFARIADEHDVLCISDEVYEHIVFEGEHRS
AAT1_METJA      ENFNIDLEKVKESITKKTKLIIFNSPSNPTGKVYDKETIKGLAEIAEDYNLIIVSDEVYDKIIYDKKHYS
AAT_PYRHO       EENNFLPDPNEEKISKNTRMIVINYPNNPTGATLDKELAKTIADIAEDYNIYILSDEPYEHFIYEDAKHY
AAT_PYRAB       NEFRLNVDELKKYVTEKTKALIINSPCNPTGSVLKKKDLEEIADFAVEHDLIVISDEVYEHFIYDDVKHY
AAT_BACST       NHFKITPEQLKQAITPRTKAVIINSPSNPTGMIYTAEELKALGEVCLAHGVLIVSDEIYEKLTYGGKHVS
AAT1_BACSU      NHFKISPEQLKNAITEKTKAIVINSPSNPTGVMYTEEELSALGEVCLEHDILIVSDEIYEKLTYGGKHVS
AAT_THEAQ       EGFVPDPERVRRAITPRTKALVVNSPNNPTGVVYPEEVLRALAEMALQHDFYLVSDEIYEHLIYEGAHFS
AAT_BACY2       SEQNITAEQLKNAITDKTKAVIINSPSNPTGMVYTREELEDIAKIALENNILIVSDEIYEKLLYNGEHFS
AAT_AQUAE       KEFQLSLEDVKEKVTERTKAIVINSPNNPTGAVYEEEELKKIAEFCVERGIFIISDECYEYFVYDAKFVS
AATA_RHIME      NNFKLKAEDLDRAITPKTKWFVFNSPSNPSGAAYSHEELKALTDVLMKHHVWVLTDDMYEHLTY-GDFRT
AAT_STRVG       DETTVSVEQLEAARTERTKVVLFVSPSNPTGSVYSEADAKAIGEWAAEHGLWVLTDEIYEHLVY-GEAKP
AAT_THET8       EGFVPDPERVRRAITPRTKALVVNSPNNPTGAVYPKEVLEALARLAVEHDFYLVSDEIYEHLLYEGEHFS
AAT_SYNY3       TDYKITPEQLRQAITSKSKLFVLNSPSNPTGAVYTPAEIRALAAVILEYDLYVVSDEIYERILYDGEHLS
AATB1_RHIME     SGFRLTAEKLEAAITPRTRWVLLNSPSNPSGAAYSAADYRPLLEVLLRHHVWLLVDDMYEHIVYDGFRPA
AATB2_RHIME     SGFRLTAQKLEAAITPRTRWVLLNSPSNPSGAAYSAADYRPLLDVLLKHHVWLLVDDMYEHIVYDAFRPA
AAT_SULTO       FNFSLNLSELESKINKKTKMIVLNNPHNPTGMVFDPIEIEKLMEITKEKKVLLLSDEIYDYFIYEGKMKS
AAT_SULSO       EGFSIDVDDLQSKISKRTKMIVFNNPHNPTGTLFSPNDVKKIVDISRDNKIILLSDEIYDNFVYEGKMRS
AAT_SULAC       EDFSLNLNDLENKITDKTKMVVLNNPHNPTGMVFDPKEIDQLIEIAKSKNLIVLSDEIYDYFVYEGKMRS
DAPAT_CARHZ     PENGFLPDSIPEEVARKAKLMFINYPNNPTGAVADLGFFEKVVHFAKKYEILVCHDAAYSEITFDG-YRA
PATA_BACSU      SHFKLTARLIEDALTPNTKCVVLPYPSNPTGVTLSEEELKSIAALLKGRNVFVLSDEIYSELTYDRPHYS
AAT_RICBR       SNFKLSGEALEQLITPKTKWLIINSPSNPTGASYSHSELKNIAEVLRKHPVNVMSDDIYEHITFDGKFYT
AAT_RHILP       HNFKLQAADLEKAITPKTKWFIFNSPSNPTGAAYTHDELKALTDVLMKNQVWVLTDDMYEHLTYDFKFVT
DAPAT_HALOH     EENNFLPDAIDEDIARKAKLFFINYPNNPTGAIAPEEFYEELIDFADKYDIIIAHDAAYSEIGLDGYNPS
AAT_THEMA       KNFQPSLEEVEGLLVGKTKAVLINSPNNPTGVVYRREFLEGLVRLAKKRNFYIISDEVYDSLVYTDEFTS
AAT_RICFE       NNFKLSAEALERSITDKTKWLIINSPSNPTGASYNFEELENIAKVLRKYHVNVMSDDIYEHITFDDKFYT
AAT_RICCN       NNFKLSAEALERSITDKTKWLIINSPSNPTGASYNFEELENIAKVLRKYSVNVMSDDIYEHITFDDFKFY
DAPAT_SYNFM     RENGFLPDL--DSIPADVAVMFINYPNNPTGATAERDFFEKVIAFAREYDVIVCHDAAYTEMAFGGYR--
AAT_RICPR       NNFKLSVEALEHSITDKTKWLIINSPSNPTGAGYNCKELENIAKTLRKYNVNIMSDDIYEHITFDDKFYT
AAT_RICTY       NNFKLTVEALERSITDKTKWLIINSPSNPTGAGYNCKELENIAKTLRKYNVNIMSDDIYEHITFDDKFYT
DAPT2_ANASP     AENKFLPDLIPEEVARKAKMLWINYPNNPTGALATLEFFEELVALCQQYSILLCHDHAYSEMAYDGKPPS
DAPAT_MOOTA     AANGFLPDAIPSDVARRAKLMFINYPNNPTGAV---ADLKFFQEVVESYDLIVCHDAAYSEITYDG-YRA
DAPAT_GLOVI     PENQLLPEAVPETVARKAKLLWLNYPNNPTGAVASLEFFEKVVHFAKKHDILVCHDNAYSEMAYDG-YKP
AAT2_METJA      -DFTV--ESLEEALSDKTKAIIINSPSNPLGEVID----REIYEFAYENIPYIISDEIYNGLVYEGKCYS
DAPT2_ANAVT     AENKFLPDLIPEEVARKAKMLWVNYPNNPTGALATLEFFEELVAFCQQHSILLCHDHAYSEMAYDGKPPS
DAPAT_DEHSB     KGNNFLPEAIPQNILSKAKVLWINYPNNPTGAVAGLSFFQEVANFAAKHNLAVCHDGPYSEIAFDG--YK
MTNE_BACSU      KDRAFLPDSITAEIREQAKLMYLNYPNNPTGAVATSEFFEDTVRFAAENGICVVHDFAYGAVGFDG--CK
KAT1_MOUSE      NDWQLDPTELASKFTPRTKILVLNTPNNPLGKVFSKKELELVAALCQQHDVLCFSDEVYQWLVYDGQHIS
DAPAT_DEHSC     KGNNFLPEAIPQNILSKAKVLWINYPNNPTGAVAGLSFFQEVANFAAKHNLAVCHDGPYSEIAFDG--YK
KAT1_RAT        NDWQLDPAELASKFTPRTKILVLNTPNNPLGKVFSRMELELVANLCQQHDVVCISDEVYQWLVYDGQHVS
DAPAT_DESAD     EENDFLPDAISDEKWDKCKIFFVNYPNNPTSATATPEFYAELVAKAKKHNVIIAADAAYTEVYYD-EDKK
DAPAT_DEHE1     KENNFLPDAIPQDVLSKAKILWINYPNNPTGAVAGLDXXXXXXXXXXXHNLAVCHDGPYSEIAFDGYR--
AATC_RHIME      PDESFFPERAVRHSIPKPLALILNYPSNPTAQVATLDFYKDVIAFAKKHDIIVLSDLAYSEIYFDAPPPS
KAT3_DANRE      ADWVLDQEELASKFNSKTKAIIVNTPNNPIGKIFSRSELQAIADLCIKHDTLCFSDEVYEWLIYKGHEHV
KAT_DICDI       EEESINKEELAAAFTDKTKLIILNNPHNPVGKVYSKEELQEIADVVAKHNTTVISDEVYEWMTFDGEHRF
KAT3_RAT        SDWTFNPQELESKFSSKTKAIILNTPHNPIGKVYTREELQVIADLCIKHDTLCISDEVYEWLVYTGHKHI
DAPAT_NATTJ     QDNGFIPESIPQSRLSKGKIVFMNYPNNPTSAVASKDFYSHAVKFCQKNKLLLCNDAAYSEIAFDDQPQS
DAPAT_DESDG     EENDFLPDAVDEATWEKARCIFVNYPNNPTAAMAPRSFFEKLIGIARKHNVIVVHDAAYTEMYYNENNRS
KAT3_HUMAN      SDWTLDPQELESKFNSKTKAIILNTPHNPLGKVYNREELQVIADLCIKYDTLCISDEVYEWLVYSGKHLK
DAPAT_DESVH     EENDFLPDL--DAIPEDTKMIFVNYPNNPTAATAPLGFYEKLVDICRRFDVIIAHDTAYTEIYYDEDNRP
DAPAT_DESVV     EENDFLPDL--DAIPEDTKMIFVNYPNNPTAATAPLGFYEKLVDICRRFDVIIAHDTAYTEIYYDEDNRP
KAT3_MOUSE      SDWTFDPRELESKFSSKTKAIILNTPHNPLGKVYTRQELQVIADLCVKHDTLCISDEVYEWLVYTGHTHV
KAT3_BOVIN      SDWTLDPQELASKFNSKTKAIILNTPHNPLGKVYTKEELQVIADLCIKYDTLCISDEVYEWLVYTGKHFK
DAPAT_AQUAE     EENNFLPDL--DSIPEDVAKKAINYPNNPTSAPPTLEFYKKLVDWAKEYNVIIASDNAYSEI-YTGQEKP
KAT1_HUMAN      SNWQLDPMELAGKFTSRTKALVLNTPNNPLGKVFSREELELVASLCQQHDVVCITDEVYQWMVYDGQHIS
AAT_STRGR       DETTVSVEQLEAARTEKTKVVLFVSPSNPTGAVYSEADAEAIGRWAVEHGLWVMTDEI------------
DAPAT_DESVM     EENDYLPDAIPAATWDRAKMIFVNYXXXXXXXXXXRAFYEKLIGICRKHNVIIAHDTAYTEVYYD-ENDK
AAT2_BACSU      EENGYLPEKIDPAVLEKAKLMFLNYPNNPTGXXXXXXXXXXXXXXXXEHNIHLIHDFAYGAFEFDQKPAS
YBDL_ECOLI      PPFRVDWQEFAALLSERTRLVILNTPHNPSATVWQQADFAALWQAIAGHEIFVISDEVYEHINFSQQHAS
AAT3_BACSU      SRFEIDIEAVRQSITPQTKGLILNTPHNPTGTVLSQKDLGALLKEIEEQTIYVLFDEPYSQLIYDEELAN
YFDZ_ECOLI      EGVDFFNE-LERAIRESPKMMILGFPSNPTAQCVELEFFEKVVALAKRYDVLVVHDLAYADIVYDGKAPS
BNA3_YEAST      EEWTIDFEQFEKAITSKTKAVIINTPHNPIGKVFTREELTTLGNICVKHNVVIISDEVYEHLYFTDSFTR
AAT_MYCTU       ETQGWQPDILESKITERTKALVVINPNNPTGAVYSCEILTQMVDLARKHQLLLLADEIYDKILYDAKHIS
AAT_MYCBO       ETQGWQPDILESKITERTKALVVINPNNPTGAVYSCEILTQMVDLARKHQLLLLADEIYDKILYDAKHIS
ATTY_MOUSE      PEKSIDLKQLESLIDEKTACLVVNNPSNPCGSVFSKRHLQKILAVAERQCVPILADEIYGDMVFSDCKYE
DAPAT_DESAP     AGNGFLPDLAA--IPAETAVMFINYPNNPTGAV---ASKEFFARVVDEYGILVCHDAAYSEIAFDG-YRP
ATTY_RAT        PEKSIDLKQLESLIDEKTACLVVNNPSNPCGSVFSKRHLQKILAVAERQCVPILADEIYGDMVFSDCKYE
Y1527_METMP     EKNNFLPEAISKEVRENAKILYLNYPNNPTGAQATKKFYKEAVDFAFENDLIVIQDAAYAALTYGDKPLS
Y1391_METJA     EENDFLPESIPEDIKKRAKILYLNYPNNPTGAQATKKFYKEVVDFAFENEVIVVQDAAYGALVYDGKPLS
ATTY_DICDI      QGFNVDLEHLRSLIDDKTKAILVNNPSNPCGIVYSKQHLLDIIQVAREYCLPIIADEIYSDLTF-GEHKF
ATTY_HUMAN      PEKSIDLKQLEYLIDEKTACLIVNNPSNPCGSVFSKRHLQKILAVAARQCVPILADEIYGDMVFSDCKYE
Y286_HAEIN      EDANWFP-TIDDKVNAKTKAIVIINPNNPTGAVYSKELLQEIVEIARQNNLIIFADEIYDKILYDGAHHH
YFBQ_SHIFL      ESSDWFPDLIRAKITPRTRGIVIINPNNPTGAVYSKELLMEIVEIARQHNLIIFADEIYDKILYDAEHHS
YFBQ_ECOLI      ESSDWFPDLIRAKITPRTRGIVIINPNNPTGAVYSKELLMEIVEIARQHNLIIFADEIYDKILYDAEHHS
YFBQ_ECOL6      ESSDWFPDLIRAKITPRTRGIVIINPNNPTGAVYSKELLMEIVEIARQHNLIIFADEIYDKILYDAEHHS
ATTY_BOVIN      KNWEIDLKQLESLIDEKTVCLIVNNPSNPCGSVFSRRHLQKILAVAARQCVPILADEIYGDMVFSDSKFE
ATTY_TRYCR      NDWEADLDEIRRLKDDKTKLLIVTNPSNPCGSNFSRKHVEDIVRLAEELRLPLFSDEIYAGMVFKGKFTS
HIS8_AZOC5      EDLQMDVDAIIGAVTERTRVIFLANPNNPTGTYLPFNEVRRL-HAALPPNVLLVLDAAYSEYVRRNDYET
HIS8_SILPO      QRV-VDVDAILAAVNDRTRLVFLANPANPTGTMISEAEVTRLADGLPGH-VLLVLDGAYAEFV-EGFDGG
AAT_PYRKO       LDERWIPR-VEEIKAD---LIIINYPNNPTGRVLSGKEIRGLLDVAEENGVKVLSDEVYAELSFT---RF
PATR_PROAC      VDLRHDLDAMADAITDRTRVIFLCTPNNPTGTVLHTDEVVEFARVPE--NVVVVMDEAYCHFNRDDAAVD
YDT4_SCHPO      XXXXXSVKPVSNAITEKTKMIVINTPHNPLGKIFSEEELNEIADLVLKHNLLVVSDEVYDRLSFVPFVRA
HIS8_UNCMA      ADFSLDVDAVLKQVTDRTKFIFITSPNNPTGNLTSLAEIRS---VANAVDGIVFVDEAY--IDFSGGKTA
HIS8_BEII9      KDLTTDVDAILAAVTPRTRIVYIANPNNPTGTYLPFAEVKRLATSLPP-NVLLVLDAAYGEYVTRNDYSA
PATR_STRGG      DGEVHDLDAMAEAITDRTRLIFVCNPNNPTGTVVRRAELERFLRVPS--DVLVVLDEAYKEFIRDAEVPD
HIS8_METS4      DH-TADVDAILAAVTPRTRIVYLANPNNPTG-TYLPFDEVRRLHAGLPGDVLLVLDAAYAEYVRRNDYAA
HIS8_CALS8      -NYTHDLEEFSKHINERTRVIWICNPNNPTGTIVKKDELYNFIKSVPS-EIAVVVDQAYKEYIDDPEYPD
HIS8_HALMA      DDFAQTADTVKDY--DGERIVYLTSPHNPTGAEFTTDAVRTIAEETDE-QTLVVVDEAYGEFT-EKPSKR
HIS8_MAGSA      VDLTANVDNLLAAVTPRTKILFLANPNNPTG-TYLPATEVARLRAGLRADILLVIDAAYTEFVSRNDYSG
HIS8_XANP2      RDLTADVDAILALVTPRTRLVFLANPNNPTG-TYLPFDEVRRLHAGLPANVLLVLDAAYAEYVRRNDYET
HIS8_ROSDO      KDRTVDIDAIIDRLTPATRLVYIANPANPTGTAIGLEALRRLAQSVPPTSLLVLDGAYAE--FFEGYDGG
Y104_SULSO      EDLDELERKIKDAHSNGKKVYVIPTAQNPAGTTMNTEDRKRLLEIASKYDFLIFEDDAYGFLVFEGESPP
HIS8_SPHAL      DFAT-DVDALLAAVTDRTRVVYLANPNNPTGTLATREEVRLYAGL--PQNVLFVIDQAYAEYLTPDEDDG
PATR_MYCA9      DH-TYDLAAMAAAVTDVTRLIFVCNPNNPTGTVVRPAELRRFVESVPPHILIAI-DEAYVEYVREDFTDS
YISV_BACSU      DEGVKAGLVSSNRKQGGQLLYTIPSFHNPTGTVMSEQRRKEIISLSKKEQMPIIEDDAYGDLWFEEKPPQ
PATR_STRCO      PGEVHDLDAMADAITDRTRLIFVCNPNNPTGTVVRRAELERFLRVPS--DVLVVLDEAYREFIRDAEVPD
HIS81_RHIME     QE-RVDVDAILAAVTERTKIVFIANPANPTGTYIPVEEVRRL-HAGLPAGVLLVLDAAYAEYVRRNDYEA
HIS8_METNO      DH-TADVDAILKAVTPRTRIVYLANPNNPTG-TYLPFDEVRRLHAGLPGNVLLVLDAAYAEYVRRNDYAA
HIS8_RUBXD      EEHRVKPEALLSAVTGETRAVILCNPNNPTGTHLTLEEVSALADALPE-DVLLILDEAYQEFVYHGSHAL
HIS8_ZYMMO      DDYRCSVDALLKAVTPRTRVVFIANPNNPTGTWITRAEVEKLHNGLPRNCLLVIDQAYAEYLDPECDDGA
PATR_RHOSR      ADHGHDLDAMLAAITDRTRLIFVCNPNNPTGTALTKAELERFLD-AVPADVLVALDEAY----FE-YNRS
HIS8_METFL      DDAMLAA------ITDKTRLFIAN-PNNPTGTLLSKPALRDFAKV--PRQVLVVLDEAYEYLAAELKSEA
HIS8_DINSH      ERVT-DVDAILAGVTDRTRLVFIANPNNPTGTM---IGGNALARLADPEGCLLVLDGAYAEYVPDYDAGK
HIS82_RALEJ     ADFTLDRGAMLAAMAEHQPAIVLAYPNNPTGNLFDAADMEAIVRAAQGSRSLVVVDEAYQPFAQES---W
HIS8_PELLD      RGLDFDADLILERAKAEAVDLIVSTPNNPTGKSLSPDDIR---RIATESGAIVLVDEAY---IEFSRHPS
HIS8_BRUME      NE-RIDVDAILAGVTARTKIVFIANPANPTGTYLPFEEVRRLHAGLPQH-VLLVLDAAYAEYVRRNDYEA
HIS8_SILST      ERVTDVDALLAGCTAQTKLVFIAN-PNNPTGTMISEAEV---ARLADPEDAILVLDGAYAEYV-EGFDAG
HIS8_BRUSU      NE-RIDVDAILAGVTARTKIVFIANPANPTGTYLPFEEVRRLHAGLPQH-VLLVLDAAYAEYVRRNDYEA
HIS8_BRUO2      NE-RIDVDAILAGVTARTKIVFIANPANPTGTYLPFEEVRRLHAGLPQH-VLLVLDAAYAEYVRRNDYEA
HIS8_BRUAB      NE-RIDVDAILAGVTARTKIVFIANPANPTGTYLPFEEVRRLHAGLPQH-VLLVLDAAYAEYVRRNDYEA
HIS8_BRUA2      NE-RIDVDAILAGVTARTKIVFIANPANPTGTYLPFEEVRRLHAGLPQH-VLLVLDAAYAEYVRRNDYEA
PATR_THEFY      EE-THDLEALAAAVTDRTRMVFVCNPNNPTGTAVRETELAEFLDTVPEH-VLVVLDEAYREYVQDPRVPD
HIS8_BURM1      ADLTLDVDAMLAAIAEHRPAIVLAYPNNPTGTLYDDADIERILRAATHS--LIVIDEAYQPF---AQHSW
YDCR_ECOLI      EGIDLQALELALQEYPVKACWLMTNSQNPLGFTLTPQKKAQLVALLNQYNVTLIEDDVYSELYFGREKPL
PATR_STRAW      PGDVHDLDAMADAITDRTRLIFVCNPNNPTGTVVRRAELERFLRVPS--DVLVVLDEAYREFIRDPEVPD
HIS8_PROVI      ASLDFDVDAIIQSAQEESVDFVVSSPNNPTGKSITFDDIR---RIASSCDALVLVDEAY--IEFSRQDSA
HIS8_MESSB      DE-RADVDAILAAVTERTKIVFLANPNNPTGTYLPMEEVKRL-RSGLPRKVLLVLDAAYAEYVRRNDYEA
HIS8_ERYLH      XXXXXXXXXXXXXXXKTRVVFVAN-PNNPTGSF-LPRDEIARLHAGLPQDVLFVLDQAYEYLTPEEDDGG
HIS81_BURS3     ADLTLDVDAMLAAIAEHRPAIVLAYPNNPTGTLYDDADIERI--VAAARHSLIVIDEAYQPFAVRSWLPR
HIS8_CHLL2      PSLDFDADSLIERAKQEKVDFIVSTPNNPTGKSLASPDI---ARIVRECDAIVLVDEAY--IEFSREHSV
HIS8_NOVAD      DYGT-DVDALLACVTERTRVVFLANPNNPTGS-WLPREEVARLHAGLRSDILLVLDGAYAEYLDPANDDG
HIS8_METMA      QDFSLNPEKILEAVSPRTKIIFLCSPNNPSGNLLPEADLR---KIIENTDALVFVDEAY--VEFADRNLA
PATR_RHOE4      EDFGHDLDAMLAAITDRTRLIFVCNPNNPTGNALSKAELESFLDAVPAHVVVALDEAYFEYSRSDAD--G
HIS8_METJA      KDFKLNVESVLNNITDKTKVIFLCTPNNPTGNIIENRDVE---RVINETDALVVIDHAYIEYA-KKEYDW
CBL_BACSU       EKYAIDFEDLETKLSDPSVTFILCNPHNPSGRSWSREDLLKLGELCLEHGVTVVSDEIHSDLMLYGHKHT
HIS8_MOOTA      NDLA----AMAAAITPRTRLVFVCNPNNPTGTIVGQAALDGFLKQVPP-SVLVVLDEAYSDYVTAEHYPN
HIS8_METM7      NEFKLDIESVLNNITEKTKAIFLCTPNNPTGNVIPTEDIK---KIVESTDALVMIDHAY--IEYSNEDYD
HIS8_HYPNA      TDMTAGVNAILGAVSPRTKILFLANPNNPTGTMLSVDELKALQDALPPH-VLFVVDGAYSEYLGPDYEAQ
PATR_MYCVP      DH-TFDLDAMLAAITDRTRLIFVCNPNNPTSTVVDPDALARFVEAVPPH-IMVVVDEAYVEYIRDG--LA
PATR_MYCS2      DH-THDLDAMLAAITDRTRLIFVCNPNNPTSTVVDPGELARFVAAVPPH-ILVVLDEAYVEYIRDGLLPD
HIS8_RHOP2      KDLTTDVDAILSKVTPNTKLVWLANPNNPTG-TYIPFDEVKRLRAGLPSHVVLVLDAAYADYVSKNDYEI
HIS8_ALKOO      DDL----DGFVEKINENTKIIYICNPNNPVGNILSKEEMEGFVARVPENVVIVLDEAYYDYAKVNPEYPE
HIS8_PELPB      PDLDFDLEAILRTAHDEAVDFVISTPNNPTGKSLTFEEVRL---IAQSSDAIVLVDEAY---IEFSRQRS
HIS8_HALLT      DGFAQDAETVLSAYGGERIVY-LTSPHNPSGSVMPLDEVRAIAD-ATAEETLVVVDEAYGEFA-EVDSAI
PATR_MYCTU      DH-TFDLYAMLATVTDRTRLIFVCNPNNPTSTVVGPDALARFVEAVPAHILIAI-DEAYVEYIRDGMRPD
PATR_MYCTA      DH-TFDLYAMLATVTDRTRLIFVCNPNNPTSTVVGPDALARFVEAVPAHILIAI-DEAYVEYIRDGMRPD
PATR_MYCBT      DH-TFDLYAMLAAVTDRTRLIFVCNPNNPTSTVVGPDALARFVEAVPAHILIAI-DEAYVEYIRDGMRPD
PATR_MYCBP      DH-TFDLYAMLAAVTDRTRLIFVCNPNNPTSTVVGPDALARFVEAVPAHILIAI-DEAYVEYIRDGMRPD
PATR_MYCBO      DH-TFDLYAMLAAVTDRTRLIFVCNPNNPTSTVVGPDALARFVEAVPAHILIAI-DEAYVEYIRDGMRPD
HIS8_RHOPB      KNLTCDVDAILAKVSPSTKLVWLANPNNPTGTYVPFDEVKRLRAGLPEH-VILVLDGAYADYVGKNDYES
HIS8_METMP      EEFKLDVESVLNNITEKTKAIFLCTPNNPTGNVIPTEDIK---KIVESTDALVMIDHAY--IEYSKEEYD
HIS8_MARMM      -DYRSDVDAILEAAGDDTRIVFLANPNNPTGTYISAAEVRRL-RDGLPASTLLVLDAAYAEFVDNPDYEA
HIS8_CHLTE      DDLSFDVDAIIEAARREKVDFIVSTPNNPTSKSLSHDEIE---RIVEAADAIVLVDEAY--VEFSRE-QS
HIS8_THETN      EDYTYNVERFAEAVERYKPKLVLCNPNNPTGSVXXXXXXXXXXXKARG---IVIVDEAY----FEFYGKT
HIS8_SALPK      ENWQLDLQGISDNLDGTKVAFVC-SPNNPTGQLINPQDLRTLLELT-RGKAIVVADEAY--IEFCPQATL
HIS8_SALPA      ENWQLDLQGISDNLDGTKVAFVC-SPNNPTGQLINPQDLRTLLELT-RGKAIVVADEAY--IEFCPQATL
HIS8_PROA2      DDLTFDVDAIIARTNQERAGFVVSTPNNPTSQSLRLDDVR---RIVSGVEALVLVDEAY--VEFSREESA
HIS8_HALSA      DGFEMTADAVVDAYDGERVVY-LTTPHNPTGARFTLDEIVAVADRTDE-DTLVLVDEAYGEFLFDGQPAG
HIS8_HALS3      DGFEMTADAVVDAYDGERVVY-LTTPHNPTGARFTLDEIVAVADRTDE-DTLVLVDEAYGEFLFDGQPAG
HIS8_ENTS8      DGWQLDLPAIAEQL-DGVKVIFVCSPNNPTGQLINPQDLRTLLEMA-RGKAIVVADEAY--IEFCPQATL
PATR_RHOOB      ADYRHDLDAMAAAVTDRTRLIFVCTPNNPTGPALSTSELERFLDAVPDRVVVALDEAYFEY------NRS
HIS8_SYMTH      GWTMDLPAMAEAAARGAKLLFLCR-PNNPTGTVFAEADLRA-ALERVPPSTLVVVDEAYREF-DETPFDS
HIS8_SALTY      ENWQLDLQGISDNL-DGTKVVFVCSPNNPTGQLINPQDLRTLLELT-RGKAIVVADEAY--IEFCPQATL
HIS8_SALSV      ENWQLDLQGISDNL-DGTKVVFVCSPNNPTGQLINPQDLRTLLELT-RGKAIVVADEAY--IEFCPQATL
HIS8_SALPC      ENWQLDLQGISDNL-DGTKVVFVCSPNNPTGQLINPQDLRTLLELT-RGKAIVVADEAY--IEFCPQATL
HIS8_SALHS      ENWQLDLQGISDNL-DGTKVVFVCSPNNPTGQLINPQDLRTLLELT-RGKAIVVADEAY--IEFCPQATL
HIS8_SALG2      ENWQLDLQGISDNL-DGTKVVFVCSPNNPTGQLINPQDLRTLLELT-RGKAIVVADEAY--IEFCPQATL
HIS8_SALEP      ENWQLDLQGISDNL-DGTKVVFVCSPNNPTGQLINPQDLRTLLELT-RGKAIVVADEAY--IEFCPQATL
HIS8_SALDC      ENWQLDLQGISDNL-DGTKVVFVCSPNNPTGQLINPQDLRTLLELT-RGKAIVVADEAY--IEFCPQATL
HIS8_SALA4      ENWQLDLQGISDNL-DGTKVVFVCSPNNPTGQLINPQDLRTLLELT-RGKAIVVADEAY--IEFCPQATL
HIS8_METVS      KDFKLDVESVLNNITEKTKAIFLCTPNNPTGNVISNEDIK---KIIESTDALIMIDHAY--IEYSKKEYD
HIS8_GRABC      QALTTDVDALLDAITPRTKVVCIANPNNPTGTMLPTAEI-ARLRASLPSDVLLVLDAAYAEYVDDPDYDP
HIS82_BORPA     AGLELLPATLAAIEAHQPKVVFLALPNNPTGGLWPDAAVRA---ILDAAPGLVVLDEAYQ--PFAGHTWM
HIS82_BORBR     AGLELLPATLAAIEAHQPKVVFLALPNNPTGGLWPDAAVRA---ILDAAPGLVVLDEAYQ--PFAGHTWM
HIS8_SALCH      ENWQLDLQGISDNL-DGTKVVFVCSPNNPTGQLINPQDLRTLLELT-RGKAIVVADEAY--IEFCPQATL
HIS8_METBF      QDFSIDPEKLLEATSSRTKIIFLCSPNNPSGNLLPEKDLR---KVLENTRALVFVDEAY--VEFADRNLA
HIS8_ECOSE      DNWQLDLQGISDKL-DGVKVVYVCSPNNPTGQLINPQDFRTLLELT-RGKAIVVADEAY--IEFCPQASL
HIS8_ECOLI      DNWQLDLQGISDKL-DGVKVVYVCSPNNPTGQLINPQDFRTLLELT-RGKAIVVADEAY--IEFCPQASL
HIS8_ECOHS      DNWQLDLQGISDKL-DGVKVVYVCSPNNPTGQLINPQDFRTLLELT-RGKAIVVADEAY--IEFCPQASL
HIS8_ECODH      DNWQLDLQGISDKL-DGVKVVYVCSPNNPTGQLINPQDFRTLLELT-RGKAIVVADEAY--IEFCPQASL
HIS8_ECOBW      DNWQLDLQGISDKL-DGVKVVYVCSPNNPTGQLINPQDFRTLLELT-RGKAIVVADEAY--IEFCPQASL
HIS8_ECO8A      DNWQLDLQGISDKL-DGVKVVYVCSPNNPTGQLINPQDFRTLLELT-RGKAIVVADEAY--IEFCPQASL
HIS81_ANAVT     ENNVL---PVAELIAADGAVTFIASPNSPSGHIVPNDDLR---KLASELSGVLVIDEAYVDFAEESALDL
HIS8_METM5      EEFKLDVESVLNNITEKTKVIFLCTPNNPTGNVIPTEDIK---KIVESTDALVMIDHAYIE-YSKGEYDL
HIS8_CHLPD      PGLAFDADAIIRKAGEERVDFIVSTPNNPTGMSLASEEV---CRIAEAADALVLVDEAY--IEFSRQKSV
HIS82_MANSM     EDFQLDLPEIEKNLAGVKVIFVC-SPNNPTGNVLNQADLIRLLDIT-AGSAIVVVDEAY--IEFSPETSM
HIS82_BORPE     AGLELLPATLAAIEAHQPKVVFLALPNNPTGDLWPDAAVRA---ILDAAPGLVVLDEAYQ--PFAGHTWM
HIS8_RHOCS      -NLTTDVDALLARVSERTRIVYVANPNNPTGS-YLPADALARLHAGLPPHVLLVIDAAYAEYVTANDYAD
HIS8_ACICJ      -NLTADIDAMLAEVTPATRLVFLANPNNPTGSLVPASDVSRL-RAELPPDVLLVLDAAYAEYVERADYDP
PATR_CORGL      ADQNHDLDAMAAAITDKTRLIFICNPNNPSGTTITQAQFDNFMEKVPNDVVVGLDEAYFEFNRADDTPVA
HIS8_YERPS      ADWQLDLPAIANNL-DQVKVIYVCSPNNPTGNLINPADLQAVLALAQGRAIVAI-DEAY--IEFCPQASV
HIS8_YERPB      ADWQLDLPAIANNL-DQVKVIYVCSPNNPTGNLINPADLQAVLALAQGRAIVAI-DEAY--IEFCPQASV
HIS8_SHIDS      ENWQLDLQGISDKL-DGVKVVYVCSPNNPTGQLINPQDFRTLLELT-RGKAIVVADEAY--IEFCPQASL
HIS8_SHIB3      DNWQLDLQGISDKL-DGVKVVYVCSPNNPTGQLINPQDFRTLLELT-RGKAIVVADEAY--IEFCPQASL
HIS8_SALPB      ENWQLDLQGISDNLDGAKVVFVC-SPNNPTGQLINPQDLRTLLELT-RGKAIVVADEAY--IEFCPQATL
HIS8_SALNS      ENWQLDLQGISDNLDGAKVVFVC-SPNNPTGQLINPQDLRTLLELT-RGKAIVVADEAY--IEFCPQATL
HIS8_ECO27      DNWQLDLQGISDKL-DGVKVVYVCSPNNPTGQLINPQDFRTLLELT-RGKAIVVADEAY--IEFCPQASL
PATR_MYCSS      DH-THDLDAMLAAITDRTRLIFVCNPNNPTSTVVDPAALKRFVEAVPPHILVVIDEAYVEYIRGDQVPDS
PATR_MYCSK      DH-THDLDAMLAAITDRTRLIFVCNPNNPTSTVVDPAALKRFVEAVPPHILVVIDEAYVEYIRGDQVPDS
PATR_MYCSJ      DH-THDLDAMLAAITDRTRLIFVCNPNNPTSTVVDPAALKRFVEAVPPHILVVIDEAYVEYIRGDQVPGS
PATR_CORGB      ADQNHDLDAMAAAITDKTRLIFICNPNNPSGTTITQAQFDNFMEKVPNDVVVGLDEAYFEFNRADDTPVA
HIS8_SHIBS      DNWQLDLQGISDKLEGVKVVYVC-SPNNPTGQLINPQDFRTLLELT-RGKAIVVADEAY--IEFCPQASL
HIS8_METAC      PDFSLDPEKILGAVSPRTKIIFLCSPNNPSGNLLPEADLR---KIVENTHALVFVDEAY--VEFADRNLT
HIS8_ECO55      ENWQLDLQGISDKL-DGVKVVYVCSPNNPTGQLINPQDFRTLLELT-RGKAIVVADEAY--IEFCPQASL
HIS8_ECO24      DNWQLDLQGISDKL-DGVKVVYVCSPNNPTGQLINPQDFRTLLELT-RGKAIVVADEAY--IEFCPQASL
HIS8_CITK8      ENWQLDLRGIADKL-DGVKVMFVCSPNNPTGQLINPQDLRTLLEMT-RGNAIVVADEAY--IEFCPQATL
HIS8_AGRT5      KDCVVDVDAILAAVTPKTKMVFLANPGNPTGTYVPVAEIRRLQAGLPKHVVL-VLDAAYAEYVRKNDYEA
HIS8_SHISS      DNWQLDLQGISDKL-DGVKVVYVCSPNNPTGQLINPQDFRTLLELT-RGKAIVVADEAY--IEFCPQASL
HIS8_ECOLU      DNWQLDLQGISDKL-DGVKVVYVCSPNNPTGQLINPQDFRILLELT-RGKAIVVADEAY--IEFCPQASL
HIS8_ECO5E      ENWQLDLQGISDKL-DGVKVVYVCSPNNPTGQLINPQDFRTLLELT-RGKAIVVADEAY--IEFCPQASL
HIS8_ECO57      ENWQLDLQGISDKL-DGVKVVYVCSPNNPTGQLINPQDFRTLLELT-RGKAIVVADEAY--IEFCPQASL
HIS8_ECO45      ENWQLDLQGISDKL-DGVKVVYVCSPNNPTGQLINPQDFRTLLELT-RGKAIVVADEAY--IEFCPQASL
HIS8_THEPX      EDYNYDVDSFIKVIEKYQPKLVLCNPNNPTGSVIEREDI---IKIIQKSNGIVVVDEAY----FEFYGNT
HIS8_THEP3      EDYNYDVDSFIKVIEKYQPKLVLCNPNNPTGSVIEREDI---IKIIQKSNGIVVVDEAY----FEFYGNT
HIS8_SHIFL      ENWQLDLQGISDKL-DGVKVVYVCSPNNPTGQLINPQDFRTLLELT-RGKAIVVADEAY--IEFCPQASL
HIS8_SHIF8      ENWQLDLQGISDKL-DGVKVVYVCSPNNPTGQLINPQDFRTLLELT-RGKAIVVADEAY--IEFCPQASL
HIS8_SALTI      ENWQLDLQGISDNLDGAKVVFVC-SPNNPTGQLINPQDLRTLLELT-RGKAIVVADEAY--IEFCPQATL
HIS8_RHORT      SDLTADIDAMLAAVRDTTKLVFLANPNNPTGTC-LPTSEVVRLREGLRDDIILVVDAAYAEYVERNDYDA
HIS8_ECOLC      DNWQLDLQGISDKL-DGVKVVYVCSPNNPTGQLINPQDFRTLLELT-RGKAIVVADEAY--IEFCPQASL
HIS8_YERPY      ADWQLDLPAIANNL-EQVKVIYVCSPNNPTGNLINPADLQAVLALAQGRAIVAI-DEAY--IEFCPQASV
HIS8_YERPP      ADWQLDLPAIANNL-EQVKVIYVCSPNNPTGNLINPADLQAVLALAQGRAIVAI-DEAY--IEFCPQASV
HIS8_YERPN      ADWQLDLPAIANNL-EQVKVIYVCSPNNPTGNLINPADLQAVLALAQGRAIVAI-DEAY--IEFCPQASV
HIS8_YERPG      ADWQLDLPAIANNL-EQVKVIYVCSPNNPTGNLINPADLQAVLALAQGRAIVAI-DEAY--IEFCPQASV
HIS8_YERPE      ADWQLDLPAIANNL-EQVKVIYVCSPNNPTGNLINPADLQAVLALAQGRAIVAI-DEAY--IEFCPQASV
HIS8_YERPA      ADWQLDLPAIANNL-EQVKVIYVCSPNNPTGNLINPADLQAVLALAQGRAIVAI-DEAY--IEFCPQASV
HIS8_YERP3      ADWQLDLPAIANNL-EQVKVIYVCSPNNPTGNLINPADLQAVLALAQGRAIVAI-DEAY--IEFCPQASV
HIS8_RHOP5      KNLTCDVDAILAKVSPNTKLVWLANPNNPTGTYIPFDEVRRLRAGLPEHVVL-VLDGAYADYVAKNDYET
HIS82_THICR     EDL----EAMAEAITDKTKLIYLANPNNPTGTLFTQKEWEAFISKVPS-NVIVVLDEAYTEYVTHDEYAN
HIS8_SALAR      ENWQLDLQGIYDNLDGAKVVFVC-SPNNPTGQLINPQDLRTLLELT-RGKAMVVADEAY--IEFCPQATL
HIS8_ECOUT      DNWQLDLQGISDKL-DGVKVVYVCSPNNPTGQLINPQDFRTLLELT-RGKAIVVADEAY--IEFCPQASL
HIS8_ECOL6      DNWQLDLQGISDKL-DGVKVVYVCSPNNPTGQLINPQDFRTLLELT-RGKAIVVADEAY--IEFCPQASL
HIS8_ECOL5      DNWQLDLQGISDKL-DGVKVVYVCSPNNPTGQLINPQDFRTLLELT-RGKAIVVADEAY--IEFCPQASL
HIS8_ECO81      ENWQLDLQGISDKL-DGVKVVYVCSPNNPTGQLINPQDFRTLLELT-RGKAIVVADEAY--IEFCPQASL
HIS81_PASMU     ADFQLNLPEIERQLTGVKVVFVC-SPNNPTGTLVNRTDLLALLEMT-RNKAIVVVDEAY--IEFCPQATM
PATR_NOCFA      PDYXXXXXXXXXXVTEHTRLIFVCNPNNPTGTAHGRAALERFLDAVPAHVLVVLDEAYYEYMRLTPQDRD
PATR_MYCMM      NH-TFDLEAMLAAVTERTRLIIVCNPNNPTSTVVQPEALAEFVRSVPPHILVAIDEAYVEYLRDGTVPDS
HIS8_ENT38      DDWQLDLPAIADNLDGVKVVFVC-SPNNPTGQIINPQDVRTLLEMT-RGKALVVADEAYIEFCPQATLTG
PATR_MYCUA      NH-TFDLEAMLAAVTERTRLIIVCDPNNPTSTVVQPEALAEFVRSVPPHILVAIDEAYVEYLRDGTVPDS
PATR_MYCPA      EH-TYDLDAMLAAITDRTRLIFVCNPNNPTSTVVDPDALVRFVD-AVPADILIAIDEAYVEYIRDGLLPN
PATR_MYCA1      EH-TYDLDAMLAAITDRTRLIFVCNPNNPTSTVVDPDALVRFVD-AVPADILIAIDEAYVEYIRDGLLPN
HIS8_AKKM8      EDWTHDLDGFLAAITENTRVVFITNPTNPVGTVVGQQEIDDFMAKVPEH-VLVVFDEAYRE--FSDNPPD
HIS8_PELUB      KNFKVSINEIIKKVTRKTKLVFIANPNNPTGTYLTRAELIDLRKKLNK-NILLVLDDAYFEYMKNKDYKS
HIS8_HALWD      KEQDFQ-QRASDILTDDERLLYVTTPHNPSGSELPIPEITALAEGVDDQTLIVI-DEAYGE--YSNNPSA
HIS8_PARDP      DRVTDIDALIAG-ATPRTRLIFVANPNNPTGTMVGLPELERLARAVPQ--AILVVDAAYAEYV--GDYDG
HIS8_ECO7I      DNWQLDLQGISDKL-DGVKVVYVCSPNNPTGQLINPQDFRTLLELT-RGKAIVVADEAY--IEFCPQASL
HIS8_CHLP8      PDLSFDVDAIIAAAEREKVDFIVSTPNNPAGKSMSHDEVE---RIVSTCDAIVLADEAY---IEFSQQES
HIS82_PASMU     NDL----DGFLQAISDKTKLIYLANPNNPTGTFLSAGEISQFLNQVPAH-VIVVLDEAYTEFTLPEERVD
HIS8_YERE8      ADWQLDLPAIKASL-DRVKLIYICSPNNPTGNLINPADLRAVLELAQGRAIVAI-DEAY--IEFCPQASV
HIS8_RHOPT      KNLTTDVDAMLAAVTPNTKLVWLANPNNPTG-TYIPFDEVKRLRAGLPSHVVLVLDAAYADYVMKNDYEL
HIS8_RHOPA      KNLTTDVDAMLAAVTPNTKLVWLANPNNPTG-TYIPFDEVKRLRAGLPSHVVLVLDAAYADYVMKNDYEL
HIS8_METS3      EENKLDTDSILNSINNKTKMIFLCTPNNPTGTLIDEKDIRDIA--SGNPDVLIVVDEAY----FEAEVTN
HIS8_KLEP3      ADWQLDLPGIEAQLDGVKVVFVC-SPNNPTGQIIDPQSIRDLLEMTRDKAIV-VADEAY--IEFCPQATL
HIS8_ECOSM      KNWQLDLQGISDKL-DGVKVVYVCSPNNPTGQLINPQDFRTLLELT-RGKAIVVADEAY--IEFCPQASL
PATR_COREF      PDTQGHDEGMLDAITDRTRLIFLCNPNNPSGTTFTEEQFEAFMQRVPADVVVGLDEAYFEFNRAEDSPVS
HIS8_NITWN      TGYTADIDAILERVTPKTKMVWLANPNNPTGTYLPFDEIRRLRAGLPPH-VLLVLDGAYSDYVSRNDYEF
HIS8_META3      KDFKLDVDSVLNNITDKTKIIFLCTPNNPTG---NXXXXXXXXXXXNSTDALVMIDHAY--IEYSKEEYD
HIS8_ERWCT      SDWQLDLDAIESQL-DGTKVVYVCSPNNPTGNLIARDDLRQLLTLA-QGKALVVIDEAY--IEFCPQAST
HIS82_BRAJA     KNLTCDVDAILKAVTPKTKLVWLANPNNPTG-TYIPFDEVKRLRAGLPSHVLLVLDAAYCDYVSRNDYEM
HIS81_HAEI8     DDFQLNLPEIKNHLNDVKVVFVC-SPNNPTGNLLKQSDILDLLQITAGKAIVVV-DEAY--IEFCPEASV
DAPAT_CHLTB     QENAFFPEFPEDTHID---ILCLCSPNNPTGTVLNKDQLRAIVHYAIEHEILILFDAAYSTFISDPSPKS
DAPAT_CHLT2     QENAFFPEFPEDTHID---ILCLCSPNNPTGTVLNKDQLRAIVHYAIEHEILILFDAAYSTFISDPSPKS
HIS8_PECCP      ADWQLDLESIEAQL-DGTKVIYVCSPNNPTGNLIAREDLRQLLTMA-QGNALVVIDEAY--IEFCPQATT
HIS8_MACCJ      EG-KFDLESFKDKMNDETSIIWICNPNNPTGTYVTETELTGFLESVHE-DVMVVLDEAYFEFVLREDYPD
HIS8_ESCF3      ENWQLDLQGISDKL-DGVKVVYVCSPNNPTGQLINPQDFRTLLELT-RGKAIVVADEAY--IEFCPQASL
HIS8_CHRVO      ADFTLLPATLAAIEREQPAVVFVSYPNNPTGPRYGRDEVMAICRAAPG---LVVVDEAYQSFASD----S
HIS81_ARCFU     GENYRIDESIFDAITQKTKIILICNPNNPTGNAE---DAKLIEELVNSTNALIFLDEAYVEF-------S
HIS81_ANASP     EYNIL---PVADLIAAHGSVTFIASPNSPSGHVVPSDDLR---KLASELSGVLVIDEAY---VDFAEESA
HIS8_STAAW      DDL----EGILKEVNEDTSLVWLCNPNNPTGTYFNHESLDSFLSQVPPH-VPVIIDEAYFEFVTEEDYPD
HIS8_STAAS      DDL----EGILKEVNEDTSLVWLCNPNNPTGTYFNHESLDSFLSQVPPH-VPVIIDEAYFEFVTEEDYPD
HIS8_HAEIG      DDFQLNLPEIKNHLNDVKVVFVC-SPNNPTGNLLKQSDILDLLQITAGKAIVVV-DEAY--IEFCPEASV
HIS8_HAEIE      DDFQLNLPEIKNHLNDVKVVFVC-SPNNPTGNLLKQSDILDLLQITAGKAIVVV-DEAY--IEFCPEASV
HIS8_ECOK1      DNWQLDLQGISDKL-DGVKVVYVCSPNNPTGQLINPQDFRTLLELT-RGKAIVVADEAY--IEFCPQASL
HIS82_NITEU     NDL----EAMLAAVTPETRIIFIANPNNPTGTLCDARDLLRFMERVPQ-DVLVILDEAYDEYLPEANKAN
HIS81_RALSO     ADLTLDREAMLAAMAEHQPAVILAYPNNPTGNLXXXXXXXXXXXXGPVCQSLVVVDEAYQPF---AQHSW
HIS81_HAEIN     DDFQLNLPEIKNHLNDVKVVFVC-SPNNPTGNLLKQSDILDLLQITAGKAIVVV-DEAY--IEFCPEASV
HIS8_KLEP7      ADWQLDLPGIEARLDGVKVVFVC-SPNNPTGQIIDPQSMRDLLEMT-RGKAIVVADEAY--IEFCPQATL
HIS8_CHLCH      SDLSFDVEAIMKAAHNEAVDVIVLXXXXXXXXXXMSYD--AVRKIAESTQALVLVDEAY--IEFSRERSM
PATR_LEIXX      ADGGHDLPALAAAITDRTRAVIVCTLNNPTGPVVTAAEFASFMAEV-PGDLLVLLDEAYHE--FETDEAA
HIS8_LACPL      PNDHVNFEGLMKAITPHVKMVWLCNPNNPTGTVESLAAIEAFVQQVPPETMVLI-DEAYIDFTPGAAQVT
HIS8_DESPS      DDL----QTILDTVNEKTRLIFIDNPNNPTGTYLEPELLIDFINSLPEHVILVLDEAYVDFMDLDKWLDV
HIS8_ANOFW      DGLEAMLEAIDDH----TRVVWICSPNNPTGTYVNDASLRAFLNKVPQHVLVVVDEAYYEYVQAEDYPNT
DAPAT_CHLTR     QENAFFPEFPEDTHID---ILCLCSPNNPTGTVLNKDQLRAIVHYAIEHEILILFDAAYSTFISDPSPKS
DAPAT_CHLTA     QENAFFPEFPEDTHID---ILCLCSPNNPTGTVLNKDQLRAIVHYAIEHEILILFDAAYSTFISDPSPKS
ALAT_SCHPO      EENNWDIDFDQFKKSFDEASCVVINPGNPTGACISENSMEKVLRFAKAKGIVLLADEVYQNNIYQNKFHS
HIS8_LEUMM      DNGNVDFDAILDAIDDKTAMVWIANPNNPTGVFETTSSIKRFLDKLPANITLVV-DEAYYDFVDEPDATV
HIS81_RALEJ     DDL----DAMAAAITSDTRLVFIANPNNPTGTFVPAAALETFAKVPAE--VVVVLDEAYEYLDDDQQYDS
DAPAT_BACV8     SENNFVPEIPDRRID----ILYLCYPNNPTGTVISKAELKKWVNYALENDTLILYDAAYEAYIQDPDPHS
PATR_CORDI      SDGFNDLDAMAAAITPKTKLVFVCNPNNPSGVVRREAFLEFMAKV--PADVVVALDEAYTEYVRDEDTIF
HIS8_STAAR      DDL----DGILKEVNDDTSLVWLCNPNNPTGTYFNHESLDSFLSQVPSHVPVLIDEAYFEFVTAEDYPDT
HIS8_LEUCK      QDTGHVDDAMFDAVDEHTTMVWLANPNNPTGVFETRSDILSFLQKLPQSVVLVV-DEAYYDFVDQIDATV
HIS8_COREF      IDMDAALAAIEEHVPD---IIFVTTPNNPTGDITSLADIE---KIINAAPGIVIVDEAYAEF-------S
HIS82_RHILO     DE-RADIDAMLAAVTPRTKIVFLANPNNPTGTYVPFQEVRRLHAGLPRH-VLLVLDAAYAEYVRRNDYEA
HIS81_PSYA2     HDLKAMSQAIENN--SNTKIVFIANPNNPTGTQLEHGELREFXXXXXXXXXXXX-DEAYIEYSPESNNRA
CBL_MYCLE       RDGRLDLAALQDAFSNGKVAYLLCNPHNPTGSVHTVAELHGVAELARRFGVRVISDEIHAPLVLSGARFT
HIS8_THEGJ      EDFTLDGEAVAEKAKNARVVFIA-SPNNPTGNLQPEEEI---IRVLETRRPV-VLDEAYAEFVGKSLWRL
HIS8_RHOPS      KDLTCNVDAILAKVSPKTKIVWLANPNNPTG-TYIPFDEVKRLRAGLPGHVVLVLDAAYADYVSRNDYEI
HIS8_NITHX      VDYTADVDAILQRVTPKTKMVWLANPNNPTGTYLPFDEIKRLHGGLPPH-VLLVLDAAYSDYVSRNDYEL
HIS81_MANSM     NDL----EAFLAAINEKTKLIFIANPNNPTGNFLTEAEIDSFLAKVPPHIVVALDEAYTEFTAKEERVNS
DAPAT_SYNPW     ADNGFAAQIPSDPVDLIYLCF----PNNPTGAVATKEQLKAWVDYARANDALILFDAAYEHSIFEIE---
ALAM_YEAST      SGWSTNPEEIETVVKEKPTVLVVINPGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPG----
HIS8_STAAT      DDL----EGILKEVNEDTSLVWLCNPNNPTGTYFNHESLDSFLSQVPPHVPVIIDEAYFEFVTAEDYPDT
HIS8_STAAN      DDL----EGILKEVNEDTSLVWLCNPNNPTGTYFNHESLDSFLSQVPPHVPVIIDEAYFEFVTAEDYPDT
HIS8_STAAM      DDL----EGILKEVNEDTSLVWLCNPNNPTGTYFNHESLDSFLSQVPPHVPVIIDEAYFEFVTAEDYPDT
HIS8_STAAE      DDL----EGILKEVNEDTSLVWLCNPNNPTGTYFNHESLDSFLSQVPPHVPVIIDEAYFEFVTAEDYPDT
HIS8_STAAC      DDL----EGILKEVNEDTSLVWLCNPNNPTGTYFNHESLDSFLSQVPPHVPVIIDEAYFEFVTAEDYPDT
HIS8_STAAB      DDL----EGILKQVNEDTSLVWLCNPNNPTGTYFNHESLDSFLSQVPPHVPVIIDEAYFEFVTAEDYPDT
HIS8_STAA9      DDL----EGILKEVNEDTSLVWLCNPNNPTGTYFNHESLDSFLSQVPPHVPVIIDEAYFEFVTAEDYPDT
HIS8_STAA8      DDL----EGILKEVNEDTSLVWLCNPNNPTGTYFNHESLDSFLSQVPPHVPVIIDEAYFEFVTAEDYPDT
HIS8_STAA3      DDL----EGILKEVNEDTSLVWLCNPNNPTGTYFNHESLDSFLSQVPPHVPVIIDEAYFEFVTAEDYPDT
HIS8_STAA2      DDL----EGILKEVNEDTSLVWLCNPNNPTGTYFNHESLDSFLSQVPPHVPVIIDEAYFEFVTAEDYPDT
HIS8_STAA1      DDL----EGILKEVNEDTSLVWLCNPNNPTGTYFNHESLDSFLSQVPPHVPVIIDEAYFEFVTAEDYPDT
HIS8_PYRKO      EDFTIDGDTIAEKAKKASAVFIA-SPNNPTGNLQPVEEVLKVL----ETGKAVVVDEAY--VEFAGKDLL
HIS8_GEOBB      E--SFEPEGIPEHY--DGKLFFLTNPNAPLGFTYS---QRYIADLAGRLSGVLVVDEAYVDFAEETSLEL
HIS83_RHILO     KDHSLPMEQLLFGPAKDAKFILLANPNNPTGTFVPVADIE---RLVAKSDRLIVLDEAYVDFAPENGLRL
DAPAT_SYNS9     AGLTYLPISADNNFSAEIPSEPVDLPNNPTGAVATRAQLKAWVDYARSHNALILFDAAYEHSIFEGAREC
HIS8_PHOLL      ENWQLDIEAIENNL-DRVKLIYICSPNNPTGNAINPDSLRKILELTANRAIVTI-DEAY--IEFCPENSI
HIS8_METST      EENKLDVDSVLNNITDKTKVIFLCTPNNPTGGLIPQEDI---VRIIEATDALVVIDEAYWEF---SEXXX
HIS8_METBU      KDFSINVDKLLAALTPNTKMIFLCSPNNPTGNVIPEEDI---LKIATATDALVFVDEAY---VEFAEKNI
HIS8_GEOSM      E--SFEPEGIPEHY--DGKLFFLTNPNAPLGFTYS---QRYIADLAGRLSGVLVVDEAYVDFAEETSLDL
HIS82_RALSO     DDL----DAMAAAITPDTRLIYVANPNNPTGTF-LPADAVAAFLAKVPPTVVVVLDEAYEFLKPEQQYDS
HIS82_NITMU     NDL----DAMLDAVAPETRVVFIANPNNPTGTL-LPADLRFLERVSP--DVLVVLDEAYEYLPPALKGDS
HIS8_HAHCH      DDFQIDAQTTLDAIKRHQPALVIAQPNNPTGNLFDDETLR---QIVAASPGLVVIDEAYTAFT-NADYMS
HIS81_IDILO     DDL----DGMAKAVTDKTKMIFIANPNNPTGTFLSTSALKSFLDKIPQHIIVVLDEAYYEYVPEDQRAPS
HIS8_BREBN      DGVHDL-EAMAAAINEQTKVVWVCNPNNPSGTIVTTSELEAFMKKTPK-DVLVVLDEAYYEYVVDPEYPQ
HIS83_BURS3     EDFALDLNQALDSIAHQPGVVLLTSPNNPTGTALPIDDIRA---ILDAAPGVVVVDEAYAEFRRHGVPSA
HIS81_THIDA     DDL----ERMRAAIRDDTRVVWIANPNNPTGTFLPWNEIEAFLETVPPR-VLVVLDEAY------GEYLA
HIS8_TOBAC      PDFSLDVERIAEVVEHEKPKCILTSPNNPDGSI---VDDETLLKILD-LPILVILDEAY--VEFSGMESK
HIS8_LYSSC      EDL----EAMAAAIDDQTAVIWVCSPNNPTGVVIPDTALRAFAKV--PNDVLVVLDEAYIEYVTHPEHKD
HIS81_NITOC     GDL----EAMVKAVNSQTRLVYIANPNNPTGTWLHSDELEAFLAALPEH-VLVVLDEAYYEYVNEAQYPY
HIS8_VIBFM      SDWQLDLPAIEASLENVKVVFVC-SPNNPTGNIVDRKDILSLLEMTKDRAIV-VMDEAY--IDFCMEKST
HIS8_STAS1      NG-EFDLDGILSEIDNDTKLVWLCNPNNPTGRYFTHDALRNFLERVPSH-IPVIVDEAYV------EFAT
HIS8_RHOS1      -ERTTDVDAILAACTPHTRLVFLANPNNPTGTMIGQADLARLAAGLPAQAILVLDGAYAEYVPGYDAGRA
HIS8_NICPL      PDFSLDVERIAEVVEHEKPKCILTSPNNPDGSI---IDDETLLKILD-LPILVILDEAY--VEFSGMESK
HIS8_CLONN      EDFKLNVNKIIEYINEEPKMFIFSNPNNPTGGVIPKYDI---IKIIENVNCIVVVDEAY--MEFYGD--S
HIS8_BACA2      SDGAHDLDRMLEAIDGETKIIWVCNPNNPTGTYTSEQELIAFLNRVPEHILVVLDEAYYEYVTAEDYPES
HIS82_CARHZ     EH-RLDLKTMAEAVNEKTRLVYLCNPNNPTGTYITKGXXXXXXXXXXXXXXXXXXXAYFEFARLFNDYPD
DAPAT_BACFR     SNVTYMPCTAENHFIPAIPEKRIDIPNNPTGTTLTKAELKKWVDYALANDTLILFDAAYEHSIYEGAKKC
YJIR_ECOLI      PETGISVEALELALEQWPIKGIILVPNNPLGFIMPDARKRAVLSLAQRHDIVIFEDDVYGELATEYPRPR
HIS8_VIBPA      SDWQLDLAGIESNLDNVKLVFVC-SPNNPTGNLVKREDIVSLLEMTKDRAIV-VMDEAY--IDFCPEAST
HIS8_STAHJ      NDL----ENIIKEVDEETALVWLCNPNNPTGTYFNHDELESFLERVPSH-VPVLIDEAYFEFVTAEDYPD
HIS8_RHOBA      DPWELPQSFGENR--EDLKLVLLPNPNSPSGTIVSKPQI---AELSNSLNCPLVVDEAYAD--FAEENCL
HIS8_HALVO      DDFEQTADLVLDAYDGERMVY-LTTPHNPTGSVLPRXXXXXXXXXXXXHTLLVV-DEAYGE--FAEEPSA
1A112_ARATH     DNFTVTVSALEQALNSKVSGILFSNPSNPVGNILSRETLCDILRFAQEKNIHVISDEIFAGSVYDKEFVS
MOCR_RHIME      DGWSLEDET----RPSPRLIFVTPSCQWPLGCLMRMEDRLRLLQIGERHDAWIVEDDYDSEYRFRGRPVP
HIS8_STAES      DDL----DGMLQQIDNKTSLIWLCNPNNPTGTYFSHDELFNFLKRVPS-DIPVLIDEAYVEFVTADDFPD
HIS8_STAEQ      DDL----DGMLQQIDNKTSLIWLCNPNNPTGTYFSHDELFNFLKRVPS-DIPVLIDEAYVEFVTADDFPD
HIS8_BACHD      DGVHDLDGMLE-VIDENTRIVWVCNPNNPTGTYVSAEAFQSFLAKVPE-DVLVVSDEAYVEYVTADDYPD
HIS8_ACEPA      DDMQV---NVADY-AGPCSGVVVANPNAPTGIALDLADVRKLLELQPNRVVLI--DEAY---VDFGAESA
HIS82_METCA     DG-SRGPETMLERVDPDTRVVFIANPNNPTGTLLGRGELYSFLAALPEH-VIAVVDEAYFEYARRPDHPD
DAPAT_SYNR3     GGLSYLPITAANDFTAPLPSTPVDLPNNPTGAVASREQLKSWVDYALEHKALILFDAAYEHSIFEGARQC
DAPAT_BACFN     SNVTYMPCTAENHFIPAIPEKRIDIPNNPTGTTLTKAELKKWVDYALANDTLILFDAAYEHSIYEGAKKC
HIS8_VIBCM      TDWQLDLPSIEANLDRVKLVFVC-SPNNPTGNLVKRADIIKLLEMTQDRAIV-VMDEAY--IDFCPEAST
HIS8_VIBC3      TDWQLDLPSIEANLDRVKLVFVC-SPNNPTGNLVKRADIIKLLEMTQDRAIV-VMDEAY--IDFCPEAST
HIS8_SULSO      EDNEWWKENTDDLLAEKVELVIIDDPNNPTGSPMLNGKKELIGQLAENTKGFVVIDEAYYE--FGGYTVS
HIS8_RHOS5      -ERTTDVDAILAACTPHTRLVFLANPNNPTGTMIGQADLARLAEGLPPQAILVLDGAYAEYV--------
HIS8_RHISN      ESSLLPIHELLFGPAKQAKFILLANPNNPTGTFVPIADIESLVALSDQ---LVVLDEAYVDFAPDSALRL
ARNB_ESCF3      DTLMVTPEIVEAAITPRTKAII---PVHYAGA---PADTNALYAIAERHGIAVIEDAAHAGTYYKGQH--
ALA2_PANMI      TGWGLEISDLKKQLEDDVRALVVINPGNPTGQVLAEDNQCDIVRFCKNEGLVLLADEVYQENIYVDDKRS
HIS8_VIBCH      TDWQLDLPSIEANLDRVKLVFVC-SPNNPTGNLVKRADIIKLLEMTQDRAIV-VMDEAY--IDFCPEAST
HIS8_RHOSK      -ERTTDVDAILAACTPHTRLVFLANPNNPTGTMIGQADLARLAAGLPAQAILVLDGAYAEYV--PGYDAG
HIS8_RHOS4      -ERTTDVDAILAACTPHTRLVFLANPNNPTGTMIGQADLARLAAGLPAQAILVLDGAYAEYV--PGYDAG
HIS8_ANADF      GRFHYDLDALRKLLSRRTKLVFLANPDNPTGTWFTEAELTPFLD-AVPKDTLVVLDEAYEYVDAPGFQDG
ALAM_DICDI      EEKGWSLEISQEHSYNDAVALVIINPGNPTGQCLDRANMEEIVKFCLEKNVVLLADEVYQENVYVKESKP
HIS8_VIBVY      EDWQLDLSGIEANLDKVKLVFVC-SPNNPTGNLVKREDIIALLEMTKDRAIV-VMDEAY--IDFCPEAST
HIS8_VIBHB      SDWQLELAGIEANLDNVKLVFVC-SPNNPTGNLVKREDIVSLLEMTKDRAIV-VMDEAY--IDFCPEAST
HIS8_METPP      ADFELDAAAMLAAVREHRPALTLAYPNNPTANLWDDAVIERVVDAVREHGGLVVIDEAYQPFA----SRS
HIS8_DESDG      ADFSFDYDAFVGAADADTAVAFITTPDNPSGYCPPVEEIIDLARRLPSSCLLVVDEAYMDFADDPAAHSV
DAPT1_ANAVT     EGLVYLPVTAENNFTAEIPSQKVDLPNNPTGATATKEHLQAWVDYAKAHNSIIFFDAAYEYITDPSLPHS
DAPAT_ACAM1     DQLTYLPINAGNNFTAQIPSQKVDLPNNPTGAVASKSHLQDWVNYAKSHGSIILFDAAYEAFITDPEHSI
ALA2_HORVU      ESTGWGLETVKKQLEDNVRALVVINPGNPTGQVLAEENQYDIVKFCKNEGLVLLADEVYQENIY------
HIS8_PYRFU      EDFTIDGERIAEEGKAASAIFIA-SPNNPTGNSQPENEV---LKVLDSGRVV-ILDEAYSE--FSGKSFI
HIS8_GEOTN      HDL----EAMLKEIDENTRIVWVCNPNNPTGTYVNETELRAFLDRVPSHVLVVLDEAYYEYVTADDYPQT
HIS8_DESVV      PDFTFDWDAFLAATDENTAIAFVTTPDNPSGWCPPVSELEHVARTLPPSCLFVIDEAYMDFCGDEAAHSL
HIS8_DESVH      PDFTFDWDAFLAATDENTAIAFVTTPDNPSGWCPPVSELEHVARTLPPSCLFVIDEAYMDFCGDEAAHSL
HIS8_BDEBA      FDLPAIADYFLKHPEKNIRLIFVSNPNNPTGTYATKAEVEAFQKVGNRDDVMIIFDEAYNEFVRAKDYAS
DAPAT_SYNP6     DGLVYLPISAENNFTAEIPSEKVDLPNNPTGAVASREYLQAWVDYARANGAIILFDAAYEHSIFEGARDC
DAPAT_SYNE7     DGLVYLPISAENNFTAEIPSEKVDLPNNPTGAVASREYLQAWVDYARANGAIILFDAAYEHSIFEGARDC
DAPAT_CHLMU     QENDFLPVFPENTHID---ILCLCSPNNPTGTALNKNQLRAIVRYAIEHNILILFDAAYSAFISAPSPKS
DAPAT_CHLAB     KETHFFPEIPQDEAID---IFCICSPNNPTGTVLNREQLKELVDYANAQGSIILFDAAYS--AFISDPTL
HIS8_METTH      NENRLDLESVLDAVDESTRLVFLCTPNNPTGGLIDKKDIRA---VLESTDTLVVVDEAYTE--FAGVDNT
HIS8_BACP2      DGGAHDLKGMLDEIDENTKVVWVCNPNNPTGNHLSESELVAFLDQVPAH-VLVVLDEAYEYVRAEDYPNS
HIS82_NITOC     EDFSLDLPAMLQVIRERVPAVVIAYPNNPTGNLFSAEELQA---IIEASPGLVIVDEAYS--VFAGETFM
HIS81_CAUCR     VNHRVDIDEVIKCVDERTRLVFIANPANPTGTWLTGEEIRAL-HAALPPSVVLVLDGAYAEFCSDPHFED
ALAT1_HUMAN     EERAWALDVAELHRALGQAALCVINPGNPTGQVQTRECIEAVIRFAFEERLFLLADEVYQDNVY------
HIS8_SERP5      QDWQLDLPAIADSL-DNVKLIYVCSPNNPTGNLIDANDLRSLLEMAKGKAIVAV-DEAY--IEFCPQASV
HIS8_LISW6      ADGEHNLEGMLDAIDEKTTIVWICNPNNPTGNYIELADIQAFLDKVPS-DVLVVLDEAYIEYVTPQPEKH
HIS8_CAMC5      EDLAEFLEIYEAH-KDEISVIFLCLPNNPLGECLDTKEVYEFLKRIDE-DVLVVLDCAYNEFAKFKDARK
HIS81_BURPS     DDFSI----VVDDYLDDAGCVLFPNPNAPTGRALPLADIERI--VAANPSSVVVIDEAY---VDFGAESA
HIS81_BURP1     DDFSI----VVDDYLDDAGCVLFPNPNAPTGRALPLADIERI--VAANPSSVVVIDEAY---VDFGAESA
DAPT1_ANASP     EGLVYLPVTAENNFTAEIPSQKVDLPNNPTGATATKEHLQAWVDYAKAHNSIIFFDAAYEYITDPSLPHS
DAPAT_MICAN     EGLIYLPITAENNFTAQIPAEKVDLPNNPTGATATKEHLTAWVNYARANGSIIFFDAAYEAFIIEGARQC
DAPAT_BACTN     SNVTYMPCTSENEIPDKRIDIVLCYPNNPTGTTLTKPELKKWVDYALANDTLILFDAAYEHSIYEGAKKC
HIS8_VIBF1      SNWQLDLPAIEASLENVKVVFVC-SPNNPTGNIVDRKDILSLLEMTKDRAIV-VMDEAY--IDFCMEKST
HIS8_LISMF      VDGAHDLDGMLNAIDDNTTIVWVCNPNNPTGNYIDLADIQAFLDKVPS-DVLVVLDEAYIEYVTPQPEKH
HIS8_LISMC      VDGAHDLDGMLNAIDDNTTIVWVCNPNNPTGNYIDLADIQAFLDKVPS-DVLVVLDEAYIEYVTPQPEKH
HIS8_LACF3      ------PAT--GHFDFAGALAVINNPNNPTGVLESPQAIEDFVRQVPK-DTLVFIDEAYLDFADDPAKAT
HIS8_STACT      ENGQFDLDGILNEIDEDTALVWICNPNNPTGTYVTHEELEAFLEKVPS-NVPVLVDEAYFEFVTADDFPD
HIS8_MICAN      DKFALEGPI----ICPEAKLIFLASPNPPLGKHLDRDYLEATCANASG---LVLIDEAY--VDFSDDNH-
HIS8_LISMH      VDGAHDLDGMLNAIDDNTTIVWVCNPNNPTGNYIDLADIQAFLDKVPS-DVLVVLDEAYIEYVTPQPEKH
HIS8_DEHE1      AGYDVNIGGIKNALTPKTKLIFIAAPNNPTGTAISKEDIRQILDLG----VPTVIDEAYYE--FTGQ-TM
HIS8_CYAP8      NQFELNGPI----ICPEAKLIFVASPNPPVGKHLNRDYLEETCKQATG---VVLIDEAY--VDFSDENH-
HIS8_ARATH      PDFSLNVDRIAEVVLEKPKCIFLTSPNNPDGSIISEDDLLKIL----EMPILVVLDEAY--IEFSGVESR
HIS8_METI4      EIADVSLKAMLEAIGPKTKLIFIANPNNPTGTRVSNEDLYLFLRVPDE--VIVAIDEAY--IDFVPDPPQ
HIS8_MARMS      DDFDIIP---ADYENLDVSGVVITNPNAPTGKALPLADIEAILKA--NPDVVVLVDEAY---VDFGAQSA
HIS8_BUCBP      KSFQLDLNLIFRNICGVKLIYLCN-PNNPTGNLIKKQDIIALLTYT-KGKALIVVDEAY--IEFCAMHSI
HIS8_BACLD      ENGCHDLDAMLKAIDEQTKVVWVCSPNNPTGTYESGRNLIRFLEKVPEHVLAVVDEAYYEYVTAEDYPET
ALAT2_MOUSE     DELRRALRQAKDHC--DPKVLCIINPGNPTGQVQSRKCIEDVIHFAWEEKLFLLADEVYQDNVYSPDCR-
HIS8_VIBVU      EDWQLDLSGIEANLDKVKLVFVC-SPNNPTGNLVKREDIIALLEMTKDRAIV-VMDEAY--IDFCPEAST
HIS8_BACSU      PDGSHDLDAMLEAIDEQTQVVWICSPNNPTGTYTSEGELLAFLERVPSRVLVVLDEAYYEYVTAEDYPET
HIS8_BACNA      PDGSHDLDAMLEAIDEQTQVVWICSPNNPTGTYTSEGELLAFLERVPSRVLVVLDEAYYEYVTAEDYPET
HIS82_BURPS     ADLTLDIDAMLAALAEHRPALVLAYPNNPTGTL-------------------------------------
HIS82_BURP1     ADLTLDIDAMLAALAEHRPALVLAYPNNPTGTL-------------------------------------
HIS81_DECAR     NDLN----AMRAAIRPDTRIVWIANPNNPTGNFLPYPEVRAFLEXXXXXXXXXLDEAYNEYIPPAERVDT
HIS81_BURMA     ADLTLDIDAMLAALAEHRPALVLAYPNNPTGTL-------------------------------------
DAPAT_SYNSC     AGLTYLPISADNGFSEPVDLIYLCFPNNPTGAVATREQLQAWVNYARANGALILFDAAYEAFIQDPEPRS
Y1479_METJA     DPYNYWYPDIDDKYNPAVSGILVINPDNPTGAVYPKKILNEIVDLANEYDLFIICDEIYCNLVYNGKKQH
HIS8_CLOK5      EEFNLVDKLIESANVEKVKVLFLSNPNNPTGKV---LKREQIFKILNGCDCAVVIDEAYVEFHEESIVDS
HIS8_CLOK1      EEFNLVDKLIESANVEKVKVLFLSNPNNPTGKV---LKREQIFKILNGCDCAVVIDEAYVEFHEESIVDS
HIS82_HAEIN     NDL----QGFLTALSDKTKLIYIANPNNPTGNFLTSQEIEDFLAEVPEN-VIVVLDEAYTEFTRSEERVD
HIS82_HAEI8     NDL----QGFLTALSDKTKLIYIANPNNPTGNFLTSQEIEDFLAKVPEN-VIVVLDEAYTEFTRSEERVD
HIS81_GLUOX     ADARFLPQLHQAVTSDPLKVLMFSNPSNPVGCLMTGDAMQSLID-ACPADTLIVIDEAYWEYA-----RS
HIS8_RHOSR      ADFALDVDAATAAITERRPDVVVTSPNNPTGHSVGIAELR---RVLDAAPGIVIVDEAYAEF---SDAPS
HIS8_GEOUR      DDWKLAPERYDGKI------FFLTNPNAPYGFTFSREFIEELARVAG----MLVVDETYAD--FAGDTAL
HIS8_GEOSF      EDWKLKPKIYEGRI------FFLTNPNAPLGFTFSQTYIE---ELAGRVSGTLVIDETYADF---AEVTS
HIS8_FRAP2      EENNFEINITEANIPDNCKLLFLCTPNNPTGKSIPLADIEQILSELAGNCVVVV-DEAY--IEFSNEKSV
HIS8_BACFN      DDFQFSADELLAVADERTKMIFLCSPNNPTGNDLLRSEI---IKVINDFEGLVILDEAYND--FSDEPSF
HIS82_PSYA2     ADFSISP----DAYRRPCSGIIIANPNAPTGLLLSLADIR---KLAGEHDSVIVIDEAYEEASAESQMSA
HIS82_CAUCR     ANFDIDVPAVCAAAALGPKLLVLCTPNNPTGNALKAADFQAILAATPRSTVVFV-DEAYREY-----HEA
DAPAT_GEOSM     KGLVYMPCTEENYPKEKVDMIYLCFPNNPTGAVATKEQLKGWVDYALANDSIILFDAAYEHSIYEGAKKC
DAPAT_GEOBB     KGLVYMPCTEENYPKEKVDMIYLCFPNNPTGAVATKAQLKGWVDYALANDSIILFDAAYEHSIYEGAKKC
ARNB_ERWT9      DTLMVTPELIEAAITERTRAIV---PVHYAGA---PADIDAVHALGKRHGIAVIDDAAH-----------
HIS8_THEMA      KDLRIP----EVNVGEGDVVFIPN-PNNPTGHVFEREEIE---RILKTGAFVALDEAYYE---FHGE--S
HIS8_STRMU      EDFTI---NTEDYLADN-GGIILTNPNAPTGIYKPLNEIEKLLKA--NQDTVVIIDEAY--ISFGGQSAL
HIS8_NEIMF      GDFTLLPAVLEAVRKHRPALTFIAYPNNPTGVCFTRAEIEA---VIEASDGIVVVDEAYG--AFNGDSFL
HIS8_NEIMA      GDFTLLPAVLEAVRKHRPALTFIAYPNNPTGVCFTRAEIEA---VIEASDGIVVVDEAYG--AFNGDSFL
HIS8_NEIM0      GDFTLLPAVLEAVRKHRPALTFIAYPNNPTGVCFTRAEIEA---VIEASDGIVVVDEAYG--AFNGDSFL
HIS8_METMJ      EDFSVDTGAFIDACHGAKLAFLC-SPNNPTGNSVPPEDVEA---ILEGMDGLLFLDNAY-----------
HIS8_LISIN      QDGEHDLEGMLNAIDEKTTIVWICNPNNPTGNYIELADIQAFLRVPS--DVLVVLDEAYIEYVTPQPEKH
HIS8_DEHSC      ASYXXXXXXXXXXXTPQTKLIFIAAPNNPTGTAISKEEIRQILDLG----VPTVVDEAYYE--FTGQ-TM
HIS8_DEHSB      ASYXXXXXXXXXXXTPQTKLIFIAAPNNPTGTAISKEEIRQILDLG----VPTVVDEAYYE--FTGQ-TM
HIS8_CLOCE      DNFSYADKIIKTYELEQPKVIYICNPNNPTGNLMPQDEILRVLKACTKSVV--VVDEAY-----------
HIS82_PSEF5     NDLPAMLKAIDDR----TRVVFIANPNNPTGTWFGAEELDEFLQDVPAH-VLVVLDEAYIEYAEGSDLPD
HIS82_BURMA     GDFSI----VVDDYLDDAGCVLFPNPNAPTGRALPLADIERI--VAANPSSVVVIDEAY---VDFGAESA
YDFD_BACSU      DNEGLLPENVHLTRGERGRAILYTNPCNPTGILMSKKRREEILAVSENTQLPIIEDDIYRELWIDEIPPY
HIS8_SULTO      ENDNWWKMNFEKFLDENARLVIIDDPNNPTGSPMLKAEEDKVRALAESINGFILIDEAYYE--FSGYTVA
HIS8_LISMO      TDGAHDLEGMLNAIDEKTTIVWICNPNNPTGNYIDLADIQAFLDKVPS-DILVVLDEAYIEYVTPQPKKH
HIS8_BACFR      DDFQFSADELLAVADERTKMIFLCSPNNPTGNDLLRSEI---IKVINDFEGLVILDEAYND--FSDEPSF
HIS8_AZOSE      DDFAIRPDDYLPHGSVAAGGIIFPNPNAPTGRLMPLSDIERI--VAGNPQCVVVIDEAY--VDFGGESAI
DAPAT_GEOLS     EANNFIPSLPTQKVDIIYLCF----PNNPTGTVASKAELKKWIDYANANDAIIFFDAAYEAFIIEGAKKC
HIS8_THESQ      KDLRIP----EVNVGEGDVVFIPN-PNNPTGHVFEREEIE---RILKTGAFVALDEAYYE---FHGESYV
HIS8_NEIMB      GDFTLLPAVLEAVRKHRPALTFIAYPNNPTGVCFTRAEIEA---VIEASDGIVVVDEAYG--AFNGDSFL
HIS8_NATPD      DDFEQSPDAILESYDGERIVYLT-SPHNPTGSEVSLSDVEAVAEGTDE-ETLVVVDEAYGEFADSPSAVA
HIS8_METM6      ----LDAESVLNNITEKTKAIFLCTPNNPTGNVIPTEDIK---KIVESTDALVMIDHAY--IEYSKEEYD
HIS8_BAUCH      DNWQLDLDTIYAQL-DCVKLIYICHPNNPTGNIINPSDIRQLLDITHGRTILVV-DEAY--IDFYPTASI
HIS8_ARTAT      DDYGLDAQSAAAQVRETGANIVLCSPNNPTGTGLSLDVVEAVYEAGEASQAIVIVDEAYHEFAHDNTPSA
HIS8_ALISL      SEWQLDLPSIERNLDNVKLVFVC-SPNNPTGNVINRKDILSLLEMTKDRAIV-VMDEAY--IDFCMEVST
HIS81_BRAJA     -DAAMRIE-IADYRRPSSAILLCN-PNAPTG-IALPRDAVA-ALLAENPDRLVVVDEAY--VDFGAESAV
ALAT2_HUMAN     EELRRAVQEAKDHC--DPKVLCIINPGNPTGQVQSRKCIEDVIHFAWEEKLFLLADEVYQDNVYSPDCR-
1A14_SOLLC      NNFKITIEAIEEAYEKGQQALILTNPCNPLGTILDRDTLKKISTFTNEHNIHLVCDEIYAATVFNSKFVS
HIS8_THIRO      DDFSIDLPVMLDAIEREQPALILAYPNNPTG---------------------------------------
HIS8_NEIG2      GDFTLLPAVLEAVRKHRPALTFIAYPNNPTGVCFTRAEIEA---AIEASDGIVVVDEAYG--AFNGDSFL
HIS8_NEIG1      GDFTLLPAVLEAVRKHRPALTFIAYPNNPTGVCFTRAEIEA---AIEASDGIVVVDEAYG--AFNGDSFL
HIS8_GEOSW      HDL----EAMLNAIDEQTRVVWICNPNNPTGTYVNEQELTSFLERVPSHVLAVLDEAYYEYATANDYPQT
HIS8_GEOKA      HDL----EAMLAVIDENTRIVWICNPNNPTGTYVNDTELRAFLDRVPRHVLVVVDEAYYEYATAPDYPQT
DAPAT_PARD8     SDVVYIPCTAENNFVPDLPSRRVDIPNNPTGTTLTKDELKKWVNYALANDVLIMYDSAYEYIQDPNIPHS
1A12_ARATH      DNFKLTVDAAEQESNKKVKGLILTNPSNPLGTMLDKDTLTNLVRFVTRKNIHLVVDEIYAATVFAGEVVN
HIS8_ROSS1      DDVDIXXXXXXXXXXXXKLLFLA-APNNPTGTPLARSDVE---RLLDLPIILAI-DEAYAE--FAGTSVV
HIS8_GRAFK      HDFEPDLTAIFKQITKDTKIIFLCSPNNPSG---NSFEAEKIEMILEKFNGLVVIDEAY--IDFSDSKSW
HIS82_OCEIH     KEGYHQLDKMLGSIDDHTAIVWLCTPNNPTGAAFSKEELITFLDNCPK-EVLVVLDEAYYEYLHSDKDLD
HIS82_BURS3     DDFSI---RVDDYL-DDAGGVLFPNPNAPTGRALPLADVERI--VAANPSSVVVIDEAY---VDFGAQSA
DAPAT_SYNS3     ADNGFAAQIPSEPVD----LIYLCYPNNPTGAVATKAQLKKWVDYARANKALILFDAAYEAFIQDPEHSI
DAPAT_SYNJA     EGLVYLPLTAENHFTASLPQQKVDVPNNPTGAVATREHLQAWVDYARAHNSLILFDAAYEAYITEGIPHS
ARNB_KLEP7      DNLMITPDAVEAAITSRTKAII---PVHYAGA---PADIDAIRAVGERHGISVIEDAAH-----------
1A1C_SOYBN      NNFKLTKQALEDKAKEDNIGLLITNPSNPLGTVMDRNTLRTVMSFINEKRIHLVSDEIYSATVF--SHPS
1A1C_PHAAU      NNFVLTKEALEDKAREDNIGLLITNPSNPLGTIMDRKTLRTVVSFINEKRIHLVCDEIYAATVFSQEDET
HIS8_STRSV      DDFEVHP---SDYFGDNGGIILAN-PNAPTGIYLPLEQLEEI--LASNQDVVVVVDEAYIH--FGGQSAL
ARNB_KLEP3      DNLMITPDAVEAAITSRTKAII---PVHYAGA---PADIDAIRAVGERHGIPVIEDAAH-----------
ARNB_ECO5E      DTLMVTPEAIESAITPRTKAII---PVHYAGA---PADINAIRAIGERYGIAVIEDAAHAGTYYKGRH--
ARNB_ECO57      DTLMVTPEAIESAITPRTKAII---PVHYAGA---PADINAIRAIGERYGIAVIEDAAHAGTYYKGRH--
1A111_ARATH     CVSSNGYKITEDALEDNVKGVLITNPSNPLGTSTTREELDLLLTFTSTKKIHMVSDEIYSGTVFDSEFTS
HIS8_SHEON      YGL---PADFATAARGAKLVFICN-PNNPTGTVIDKA--RIEQAIQALPDSIVVVDEAY--IEFCPEYSV
HIS8_SHEAM      EDFSL-PDDISA-LTGSKLVFVCN-PNNPTGTLLPLGEI---ARVAKTFNALVVVDEAYIEFAHNADG-S
HIS8_PARD8      ENFDLDAEAVLESADEWTKVIFLCSPNNPSG---NSLDRGSIYKILKNYEGIVVIDEAY--IDFSAYPSF
HIS8_BUCAT      NTWQLDLLNIKLNLSRVKLIYICN-PNNPTGNIFFKKDLIFLLNIT-LGQALVVIDEAY--IEFSPEESM
HIS8_BUCAI      NTWQLDLLNIKLNLSRVKLIYICN-PNNPTGNIFFKKDLIFLLNIT-LGQALVVIDEAY--IEFSPEESM
HIS8_BUCA5      NTWQLDLLNIKLNLSRVKLIYICN-PNNPTGNIFFKKDLIFLLNIT-LGQALVVIDEAY--IEFSPEESM
HIS82_PSEPF     EWGHDLPAMLAAIDANTRVVFIAN-PNNPTGTWFGAEALDDFLQDVPEH-VLVVLDEAYIEYAEGSDLPD
DAPAT_SYNJB     EGLVYLPITAENHFTASLPSQKVDVPNNPTGAVATREHLQNWVDYARAHGSLILFDAAYEAYITEGIPHS
DAPAT_GEOUR     KGIVYMPCNEENHFTEKVDIIYLCFPNNPTGTVASRAELKKWVDYANANDAVIFFDAAYEAFITDPEPHS
CBL_MYCTU       GDGRIDLDALQEAFXXXNVAYLLCNPHNPTGSVHTADELRGIAERAQRFGVRVVSDEIHAPLIPSGARFT
CBL_MYCBO       GDGRIDLDALQEAFXXXNVAYLLCNPHNPTGSVHTADELRGIAERAQRFGVRVVSDEIHAPLIPSGARFT
1A110_ARATH     DNFNMSMVVLDKKXXXXXXXXXXSNPSNPMGSLLSRENLYALLDFARERNIHIISNEIFAGSVHEGEFVS
PATR_CORJK      HDL----KAMSEAIGERTRLVFVCNPNNPTGTTVSRDEFREFGRV--PADVTVVLDEAY--VEYNRDAES
HIS8_JANSC      DARHVDVDALIAGITPATRLIFIANPSNPCATM---IDNGEITRLADALPDQCL-------LILDGAY--
HIS8_GEOSL      DDLRIAPGRYEGKL------FFLTTPNSPLGFA---FPLAYIEELATRCAGVLVVDEAY-----------
HIS8_CYAA5      ENFELDSPL----ICPEAKLIFVASPNPPLG---KHLNRQYLKETCEQATGVVLIDEAYVDFSDEDHWDF
HIS8_BUCSC      NSWQLDLKVIKKCINNFKLIYLCN-PNNPTGSLINFRDVLALLKMTYGKSLVII-DEAY--IEFSPMNSL
ARNB_SHISS      DTLMVTPEAIESAITPRTKAII---PVHYAGA---PADIDAIRAIGERYGIAVIEDAAHAGTYYKGRH--
ARNB_SHIFL      DTLMVTPEAIESAITPRTKAII---PVHYAGA---PADIDAIRAIGERYGIAVIEDAAHAGTYYKGRH--
ARNB_SHIF8      DTLMVTPEAIESAITPRTKAII---PVHYAGA---PADIDAIRAIGERYGIAVIEDAAHAGTYYKGRH--
ARNB_SHIBS      DTLMVTPEAIESAITPRTKAII---PVHYAGA---PADIDAIRAIGERYGIAVIEDAAHAGTYYKGRH--
ARNB_PROMH      DTLMVSAESVKKAITPRTKAII---PVHYAGA---PCDLDALRAVADEAGIPLIEDAAH-----------
ARNB_ECOSM      DTLMVTPEAIESAITPRTKAII---PVHYAGA---PADIDAIRAIGERYGIAVIEDAAHAGTYYKGRH--
ARNB_ECOSE      DTLMVTPEAIESAITPRTKAII---PVHYAGA---PADIDAIRAIGERYGIAVIEDAAHAGTYYKGRH--
ARNB_ECOLU      DTLMVTPEAIESAITPRTKAII---PVHYAGA---PADIDAIRAIGERYGIAVIEDAAHAGTYYKGRH--
ARNB_ECOLC      DTLMVTPEAIESAITPRTKAII---PVHYAGA---PADIDAIRAIGERYGIAVIEDAAHAGTYYKGRH--
ARNB_ECO8A      DTLMVTPEAIESAITPRTKAII---PVHYAGA---PADIDAIRAIGERYGIAVIEDAAHAGTYYKGRH--
ARNB_ECO81      DTLMVTPEAIEAAITPRTKAII---PVHYAGA---PADIDAIRAIGERYGIAVIEDAAHAGMYYKGRH--
ARNB_ECO7I      DTLMVTPEAIESAITPRTKAII---PVHYAGA---PADIDAIRAIGERYGIAVIEDAAHAGTYYKGRH--
ARNB_ECO55      DTLMVTPEAIESAITPRTKAII---PVHYAGA---PADIDAIRAIGERYGIAVIEDAAHAGTYYKGRH--
ARNB_ECO24      DTLMVTPEAIESAITPRTKAII---PVHYAGA---PADIDAIRAIGERYGIAVIEDAAHAGTYYKGRH--
AATR1_SCHPO     DQFGFLPESMDDILTNWDATYTIPTGQNPTGSTLSVERRKQIYTLAQKHDIIILEDEPYYYLQMDAYEGK
1A17_ARATH      NHFQITPEALESAYQTARDAVLITNPSNPLGATVQKKVLEDLLDFCVRKNIHLVSDEIYSGSVFHSEFTS
1A12_CUCPE      NNFQVTEAALEQEANMKVKGVIITNPSNPLGTTYDRDTLKTLVTFVNQHDIHLICDEIYSATVFKAEIVE
HIS8_THEP1      KDLRIP----EVNVGEGDVVFIPN-PNNPTGHVFEREEIE---RILKTGAFVALDEAYYE---FHGESYV
HIS82_BACC1     NGVYDLDE-ISSAVNNNTKIVWICNPNNPTGTYVNDRKLTQFIEGISENTLIVIDEAYYEYVTAKDFPET
DAPAT_LEPIC     SNLIYMPATKENEIPKEKADIVLCYPNNPTGTVTTKESLKAWVEYAKKNNSIILYDSAYEAFISEGVPRS
DAPAT_HELMI     EANGMKPELPKTRVDMIYLCF----PNNPTGMTLTKEELKQWVDYARENKSIILYDAAYEAFIQEAHPRS
ARNB_SALTY      DTLMVTPEHIEAAITPQTKAII---PVHYAGA---PADLDAIYALGERYGIPVIEDAAH-----------
ARNB_SALSV      DTLMVTPEHIEAAITPQTKAII---PVHYAGA---PADLDAIYALGERYGIPVIEDAAH-----------
ARNB_SALPK      DTLMVTPEHIEAAITPQTKAII---PVHYAGA---PADLDAIYALGERYGIPVIEDAAH-----------
ARNB_SALPC      DTLMVTPEHIEAAITPQTKAII---PVHYAGA---PADLDAIYALGERYGIPVIEDAAH-----------
ARNB_SALPA      DTLMVTPEHIEAAITPQTKAII---PVHYAGA---PADLDAIYALGERYGIPVIEDAAH-----------
ARNB_SALNS      DTLMVTPEHIEAAITPQTKAII---PVHYAGA---PADLDAIYALGERYGIPVIEDAAH-----------
ARNB_SALHS      DTLMVTPEHIEAAITPQTKAII---PVHYAGA---PADLDAIYALGERYGIPVIEDAAH-----------
ARNB_SALCH      DTLMVTPEHIEAAITPQTKAII---PVHYAGA---PADLDAIYALGERYGIPVIEDAAH-----------
ARNB_ECOLI      DTLMVTPEAIESAITPRTKAII---PVHYAGA---PADIDAIRAIGERYGIAVIEDAAHAGTYYKGRH--
ARNB_ECOHS      DTLMVTPEAIESAITPRTKAII---PVHYAGA---PADIDAIRAIGERYGIAVIEDAAHAGTYYKGRH--
ARNB_ECODH      DTLMVTPEAIESAITPRTKAII---PVHYAGA---PADIDAIRAIGERYGIAVIEDAAHAGTYYKGRH--
ARNB_ECOBW      DTLMVTPEAIESAITPRTKAII---PVHYAGA---PADIDAIRAIGERYGIAVIEDAAHAGTYYKGRH--
1A12_SOLLC      NNFKITSKAVKEAYENKVKGLILTNPSNPLGTTLDKDTLKSVLSFTNQHNIHLVCDEIYAATVFDTPQEQ
MFNA_METKA      SDYTVDVDAVQDLISRDTALIVGIVGTTETGSVD---DIEALSDVAEDHGV-------------------
HIS82_PSEAE     HDL----EAMLAAIDGQTRVVFVANPNNPTGTFGADALERFLAQVPAE--VLVVLDEAYIEYAEGDELPD
DAPAT_THEEB     AGLVYLPITAENHFTATLPSEPVDLPNNPTGAVASREHLQAWVDYARAHKAILFFDAAYEHSIYEGAREC
DAPAT_LEPIN     SNLIYMPATKENEIPKEKADIVLCYPNNPTGTVTTKESLKAWVEYAKKNNSIILYDSAYEAFISEGVPRS
DAPAT_GEOSF     EANGFIPELPKEKVDIIYLCF----PNNPTGTVASKAELKKWVDYANANDAVIFFDAAYEAFIIEGAKKC
DAPAT_CLOTH     ENITYLPCTAENNFIPELPKEKVDIPNNPTGMTLSREELKKWVDYARENRAIILFDSAYEAYIREKDPHS
ARNB_ENT38      DTLMVTPQAIEAAITPRTKAII---PVHYAGA---PVDIDAIRAVADRHGIPVIEDAAHAGTYYKGSH--
ARNB_ECOUT      DTLMVTPEAIEAAITPRTKAII---PVHYAGA---PADIDAIRAIGERYGIAVIEDAAHAGTYYKGRH--
ARNB_ECOL6      DTLMVTPEAIEAAITPRTKAII---PVHYAGA---PADIDAIRAIGERYGIAVIEDAAHAGTYYKGRH--
ARNB_ECOL5      DTLMVTPEAIEAAITPRTKAII---PVHYAGA---PADIDAIRAIGERYGIAVIEDAAHAGTYYKGRH--
ARNB_ECOK1      DTLMVTPEAIEAAITPRTKAII---PVHYAGA---PADIDAIRAIGERYGIAVIEDAAHAGTYYKGRH--
ARNB_ECO45      DTLMVTPEAIEAAITPRTKAII---PVHYAGA---PADIDAIRAIGERYGIAVIEDAAHAGTYYKGRH--
ARNB_ECO27      DTLMVTPEVIEAAITPRTKAII---PVHYAGA---PADIDAIRAIGERYGIAVIEDAAHAGTYYKGRH--
1A1C_DIACA      NNFKITKEALQSAYEDKVKGIIVTNPSNPLGTVLDKDTLKMLLTFVNAKNIHLVCDEIYATTVFNAEVIK
1A14_ARATH      SSSTLALEEAYEQLDLNVKGILITNPSNPLGTTTTQTELNLFDFITKNKNIHLVSDEIYSGTVFSSEFIS
DAPAT_CHLCV     KETDFFPVIPQGEEID---IFCLCSPNNPTGTVLTKEQLEELITYANSHGSIILFDAAYSAFISDPSPKS
HIS8_GEOMG      GDFRIAPERYEGKV------FFLTTPNAPLGP---SFPLEYIDELARRCAGMLVLDETYAEFA---ESNA
HIS8_FRASC      EDFTLSPAVVTDAIARHRPALVLCSPNNPTGTALPPXXXXXXXXXXXTGSGMVVVDEAYAEFRRAGVPST
HIS8_COLP3      NQCQLDLEGLKQQVGKAKVVFLC-SPGNPTGNTLSSAQIKAAIEIFKDSAMVVVDEAYYEYTNKEAEQVN
HIS81_RHILO     DDLTINADALIDAVRERPRMLLFSNPMNPVGSWLSAGDLSKVLDAVSDETLIVVXXXXXXXXXXXXXXSS
DEGT_BACST      DPVTIDPAQVEAAVTEKTKAII------PVHLYGQMADMEAIAAIAKRHGLVVIED--------------
DAPAT_DESDA     DSIVYLPCIKENDFVPDFPAIYLCYPNNPTGTVLSRAALQGWVEYARREGCVILYDSAYEAFITEADPHS
DAPAT_CYAP7     -GLVYLPMTANNNFTPELPSQKVDLPNNPTGATATKENLTKWVNYAKENGSIIFFDAAYEAFITDPSHSI
HIS8_PSEST      DDL----DGMLKAIDEQTAVIFIANPNNPTGNLVRAQALESFLDRVPER-VLVVLDEAYIEF-YRGTNCQ
HIS8_FLAJ1      TDFQPQVEKILEAVDENTKIIFLCSPNNPTGNSFSDESV---VKLLQNFKGLVVIDEAY--IDFSEKESW
DAPAT_PARUW     NDLANLPKT-------DLIYFC--SPNNPTGSAATNEQLRELVQFAKKRQSIIIFDAAYASFVRSSHPRS
ALAT1_BOVIN     EERAWALDVAEDHCRP--RALCVINPGNPTGQVQTRECIEDVIRFAYEEKLFLLADEVYQDNVY------
1A1C_MALDO      NGFQITETALEEAYQERVKGVLVTNPSNPLGTTMTRNELYLLLSFVEDKGIHLISDEIYSGTAFSSSFIS
1A18_ARATH      NGFRITKVALEEKLNLKVKGVLITNPSNPLGTTTTRTELNHLLDFISRKKIHLISDEIYSGTVFEVLKDR
1A11_CUCPE      AALEIAYKKAQE-ANMKVKGVIITNPSNPLGTTYDRDTLKTLVTFVNQHDIHLICDEIYSATVFKAEIVE
HIS8_MYCLE      DDFSLDVEAAVTAVADRKPDVVIASPNNPSGQSISLADLR---RLLDVVPGILIVDEAYGEVALVGEYPT
HIS8_MYCLB      DDFSLDVEAAVTAVADRKPDVVIASPNNPSGQSISLADLR---RLLDVVPGILIVDEAYGEVALVGEYPT
HIS8_HELHP      EHILYQSEKERKHI----SAVFLCAPNNPLGECLDAAAIEQFIQAVDK-DTLVIVDGAYQEFAAKAKAIN
HIS8_CYTH3      KAFDLDVDAILAAVKTHTKIIFICSPNNPTGNLMSEDKVK---RILNAFSGIVVVDEAY-----------
DAPAT_PROM3     AENGFAAKIPSEPVDLIYLCF----PNNPTGAVATRAQLQEWVNYARTNSVLILFDAAYEAFIIEGAREC
DAPAT_CHLFF     KETDFFPVIPQEENID---IFCLCSPNNPTGTVLNREQLKELIDYANSHGSIILFDAAYS--AFISDPSL
ARNB_EDWI9      DTLMVTPEAIADAITPRTKAII---PVHFAGA---PVDLDPIRALAQRQGIALIEDAAH-----------
HIS8_BUCAP      NTWKIDLLNIRSNLNKVKLIYICN-PNNPTGNIVSQEDLKSLLKVTLGQS-LVIIDEAY--IEFSPKNSM
HIS8_BRAHW      DDFTI---DINDYKNLDSGIFIAN-PNAPTGLLLT-LDQLXXXXXXXXXXXXXXXXAYIDFAAIESAYKL
HIS8_BACSK      EDGSHDLDAMLAAIDDQTRIVWVCNPNNPNGVALGEAELKTF---LDAVPTTCXXXXXXXXXXXXXXXXF
HIS82_BACCR     NGV-YDLEEISSVVDNDTKIVWICNPNNPTGTYVNDRKLTQFIEGISENTLIVIDEAYYEYVTAKDFPET
HIS82_BACAN     NGVYDLDE-ISSVVDNDTKIVWICNPNNPTGTYVNDRKLTQFIEGISENTLIVIDEAYYEYVTAKDFPET
DAPAT_LEPBL     SNLIYMPATKENEIPKEKADIILCYPNNPTGTVTTKKALRAWVEYAKKNNSIILYDSAYEAFISEGVPRS
DAPAT_LEPBJ     SNLIYMPATKENEIPKEKADIILCYPNNPTGTVTTKEALRAWVEYAKKNNSIILYDSAYEAFISEGVPRS
ARNB_SERP5      DTLMVSASDVEAAITTKTKVIV---PVHYAGA---PLQMDALREVAKRHNLPLIEDAAH-----------
ARNB_SALPB      DTLMVTPEHIEAAITPQTKAII---PVHYAGA---PADLDAIYALGERYGIPVIEDAAH-----------
ARNB_SALG2      DTLMVTPEHIEAAITPQTKAII---PVHYAGA---PADLDAIYALGERYGIPVIEDAAH-----------
ARNB_SALEP      DTLMVTPEHIEAAITPQTKAII---PVHYAGA---PADLDAIYALGERYGIPVIEDAAH-----------
ARNB_SALDC      DTLMVTPEHIEAAITPQTKAII---PVHYAGA---PADLDAIYALGERYGIPVIEDAAH-----------
ARNB_SALA4      DTLMVTPEHIEAAITPQTKAII---PVHYAGA---PADLDAIYALGERYGIPVIEDAAH-----------
HIS8_THENN      KYLKIP----EVDVGEGDVVFIPN-PNNPTGHVFEREEIE---KILKKGAFVALDEAYYE---FHGESYI
HIS82_DECAR     DDFSINPA---DYCDRPNGGIIFPNPNAPTGRLL-PLDAIEQMLKANPDSVVVV-DEAY--VDFGGE--T
HIS82_BACHK     NGVYDLDE-ISSVVDNNTKIVWICNPNNPTGTYVNDRKLTQFIEGISENTLIVIDEAYYEYVTAKDFPET
GLDSA_STRRI     PDLCLSPEAVEAAITEHTRAIVV------VHLYSALADMDALSAIAERHGLPLIEDCAQAH---------
DAPAT_PROMA     EGLVYIPLNAENGFEAELPSEPVDLPNNPTGAVASKVQLTKWVEYAKKNHALILFDAAYEHSIFEID---
DAPAT_METS3     EGLTYLKCNAENGFVEDVDIIYLCYPNNPTGTTLTYDQLKVFVDYAIEHKAIILFDAAYECFIREDDPHT
DAPAT_GEOSL     KGIVYMPCTEENGFTEKVDIIYLCFPNNPTGTVATKAELKKWVDYAIANDAVIFFDAAYEAFIIEGAKKC
DAPAT_EUBE2     AETNFAPELPKE--TPDIIYLCF--PNNPTGSTITKDELQKWVDYANKVGAVIIYDAAYEAYISEPD--V
DAPAT_CYAP4     EGLVYLPVTAENGFTASLPEQKVDLPNNPTGATASRAHLQQWVDYARANGSIIFFDAAYEAFITDPDPHS
DAPAT_CYAA5     EGLVYLPISADNHFVADIPSEKVDLPNNPTGATATKEYLKAWVDYATANDSIIFFDAAYEFITDESLPHS
COBD_THETN      EEEGFRVNFAKISKIEEADGLILGNPNNPTGQGIIREEIGILLKKAELMNIPVLIDEAFIEFMKDYKKYE
ARNB_PECCP      HTLMVRPQDIEAAITPKTKAII---PVHYAGA---PADLTALRTLSERYGIPLIEDAAH-----------
1A11_CUCMA      AALEIAYKKAQE-ANIKVKGVIITNPSNPLGTTYDRDTLKTLVTFVNQHDIHLICDEIYSATVFKAQIVE
HIS8_SYNY3      ANFDLTGPV----ICPEAKLIFLASPNPPKG---KHLNREFLWQTCAQAEGVVVIDEAYGDFSDEDHWDF
HIS8_LACLS      DDFSLSVNSY----FQENGGIVIANPNAPTGMAISLQEIEEI--LQNNQDSIVLIDEAY--IDFGGESCL
HIS8_CLOAB      EDFSLD----LDNFCRCNGGVIIPNPNAPTAKYIGLSDIK---KILDNKDSVVIIDEAY--IDFGGE--S
DAPAT_PROM4     AENGFEAEIPSEHFDLIYLCF----PNNPTGSVATKEQLMRWVEYAKNHDALILFDAAYEAFIQDPELPH
ARNB_YERPY      DTLMVNAAAIEAAITPNTKAII---PVHYAGA---PCDLDALRQISQRHGIPLIEDAAH-----------
ARNB_YERPS      DTLMVNAAAIEAAITPNTKAII---PVHYAGA---PCDLDALRQISQRHGIPLIEDAAH-----------
ARNB_YERPP      DTLMVNAAAIEAAITPNTKAII---PVHYAGA---PCDLDALRQISQRHGIPLIEDAAH-----------
ARNB_YERPN      DTLMVNAAAIEAAITPNTKAII---PVHYAGA---PCDLDALRQISQRHGIPLIEDAAH-----------
ARNB_YERPG      DTLMVNAAAIEAAITPNTKAII---PVHYAGA---PCDLDALRQISQRHGIPLIEDAAH-----------
ARNB_YERPE      DTLMVNAAAIEAAITPNTKAII---PVHYAGA---PCDLDALRQISQRHGIPLIEDAAH-----------
ARNB_YERPB      DTLMVNAAAIEAAITPNTKAII---PVHYAGA---PCDLDALRQISQRHGIPLIEDAAH-----------
ARNB_YERPA      DTLMVNAAAIEAAITPNTKAII---PVHYAGA---PCDLDALRQISQRHGIPLIEDAAH-----------
ARNB_YERP3      DTLMVNAAAIEAAITPNTKAII---PVHYAGA---PCDLDALRQISQRHGIPLIEDAAH-----------
ALAT1_MOUSE     EERAWALDIAELRRALCQAVLCVINPGNPTGQVQTRECIEAVIRFAFEEGLFLMADEVYQDNVYEGSQFH
1A1L1_MOUSE     ---------------------ILINPQNPLGDVYSPEELQDFLRFAMRHKLHVIMDEVYMLSVFEESYRS
1A19_ARATH      ESXXXXXXXXXXKLDLKVKGVLVTNPSNPLGTMLTRRELNLLVDFITSKNIHLISDEIYSGTVFGFEQVS
1A16_ARATH      NGFKITVEALEAAYENPVKGLLVTNPSNPLGTTLDRECLKSLVNFTNDKGIHLIADEIYAATTFVAEVIE
HIS8_PHOPR      PEWQLDLPSIQNNLDGVKLVFVC-SPNNPTGNVMNRRDIEKLLDMTTD-KALVVIDEAY--IDFCLETST
HIS81_BORPA     DDFRIDPA---DYQPGGQAAIIFPNPNAPTGRALARDEVERI--VTANPDTVVVVDEAY--VDFGAESVA
HIS81_BORBR     DDFRIDPA---DYQPGGQAAIIFPNPNAPTGRALARDEVERI--VTANPDTVVVVDEAY--VDFGAESVA
DAPAT_SYNPX     ADNGFAAQIPSEPVDLIYLCF----PNNPTGAVATKGQLKAWVDYARSNGSLILFDAAYEHSIFEGAREC
DAPAT_NOSP7     EGLVYLPITADNNFTAEIPSKKVDLPNNPTGATATKEYLKAWVDYAKANNSIIFFDAAYEYITDPSIPHS
HIS8_ACIBS      ENFEI---DVRDY-TQPNGGVIITNPNAPTSIALSLAEIEQV--LQANPDCVVVIDEAY---VDFGAESA
DAPAT_PROMM     AENGFAAKIPSEPVDLIYLCF----PNNPTGAVATRAQLQEWVNYARTNSVLILFDAAYEAFIIEGAREC
DAPAT_GEOMG     KGIVYMPCTEANGFTEKVDIIYLCFPNNPTGTVATKAELKKWVDYANANDAVIFFDAAYEAFIIEGAKKC
DAPAT_DESAH     D-CTAENNFVPDLPQEQVDLIYLCFPNNPTGTTITKPELKRWVDYAHEAKALILFDAAYEAFIRDDTPRS
DAPAT_CHLPN     KETGFIPELPNQQSLD---ILCLCYPNNPTGTVLTFQQLQALVNYANQHGTVLIFDAAYSAFVSDPSPKS
ARNB_YERE8      DTLMVNAADIEAAITSKTKAII---PVHYAGA---PCDLDALRQIAQQYKIPLIEDAAH-----------
ARNB_SODGM      DTLMVTPALIEAAITPRTRAIV---PVHYAGA---PADIDAIRALGERYGIPVIEDAAHAGTAYKGRH--
ARNB_SALTI      DTLMVTPEHIEAAITPQTKAII---PVHYAGA---PADLDAIYALGARYGIPVIEDAAH-----------
ARNB_PSEU2      DTLMTSAALIEHAITPRTKAIV---PVHYAGAA---FDLDPLYALADRHGITVIEDAAH-----------
HIS8_SULNB      EHKY--DEFIEAYHTYKPKIIYICTPNNPTGDATSREEVLKIIEGVDK-DTLVVVDGAYMEYAAAKDQKA
HIS8_DESHY      ----LLTETGRDFRLDQVHMIVLCNPNNPTGTLFPREEI---LRIVAESGKIVIVDEAYGE--FSGESVV
HIS8_CELJU      DNFDI---DFNDY-PQDNSGIIFPNPNAPTAIGKPLAEIEAL--LQRNSETVVVVDEAY--IDFGGQTAI
HIS82_BACCZ     NGVYDLDE-ISSVVDNNTKIVWICNPNNPTGTYVNDRKLTQFIEGISENTLIVIDEAYYEYVTAKDFPET
HIS81_BORPE     DDFRIDPA---DYQPGGQAAIIFPNPNAPTGRALTRDEVERI--VTANPDTVVVVDEAY--VDFGAESVA
GLDSA_STRFR     PDLCVSPEAVEALITERTRAVVV------VHLYSAVADMDGLTRVAERHGLPLVEDCAQAH---------
AADAT_RAT       DDCGIIPEGLKKVLTKRTPKFLYTIPNNPTGNSLTGDRKKEIYELARKYDFLIIEDDPYYFLQFTKPWEP
1A1L1_HUMAN     P-FQLTVEKLEMALREKVKGLILISPQNPLGDVYSPEELQEYLVFAKRHRLHVIVDEVYMLSVFEKSYRS
1A15_ARATH      ESXXXXXXXXXXKLDLKVKGVLVTNPSNPLGTALTRRELNLLVDFITSKNIHLISDEIYSGTMFGFEQLK
HIS8_ROSCS      EQFXXXXXXXXXXXXXXXXKLLLAAPNNPTG---TPLARTTVERLLDLPIILAI-DEAYAE--FAG--TS
HIS8_CORGL      IDMDVALEEIRAKQPD---IVFVTTPNNPTGDVTSLDDVERIINVAPG---IVIVDEAYAEFSPSPSATT
HIS8_CORGB      IDMDVALEEIRAKQPD---IVFVTTPNNPTGDVTSLDDIERIINVAPG---IVIVDEAYAEFSPSPSATT
HIS8_ARCB4      QNLEEFSELYKKHGADIIFLCI---PNNPLGECLDKNDVYEFLKTIDKNTLVVVDGAYQEYAAFKDEKKC
HIS8_ACIBT      ENFEI---DVRDY-TQPNGGVIITNPNAPTSIALSLAEIEQV--LQANPDRVVVIDEAY---VDFGAESA
DAPAT_DESHY     EEGDMKPELPTAPVDMIYLCF----PNNPTGMTLTKEELKVWVDYARENKAIILFDSAYEAFIEEGVPRS
DAPAT_DESHD     EEGDMKPELPTAPVDMIYLCF----PNNPTGMTLTKEELKVWVDYARENKAIILFDSAYEAFIEEGVPRS
DAPAT_CLOPH     KENKFVPSLPAE--TPDIIYLCF--PNNPTGSAITKMKLQKWVDYAIEKGAVIIYDAAYE--AYISEENC
ARNB_AERS4      DTLMTSAELIAPLITVNTKAII---PVHYAGA---PVDLDPILKLARQYDIPVIEDAAH-----------
1A12_CUCMA      NGFQITQSALEQAYKDAQTGVLVTNPSNPLGTTMNRDELNLVFDFITSKGIHLISDEIYSGTVFGSKERS
HIS8_CHRSD      DDQWRVPLTAFD---TDNGGIVFANPNAPTGHGHSRDAIAALLERNTESVVLV--DEAY--VDFGGESAV
HIS8_ACIB5      ESFEI---DVRDY-TQPNGGVIITNPNAPTSIALSLAEIEQV--LQANPDRVVVIDEAY---VDFGAESA
HIS8_ACIB3      ESFEI---DVRDY-TQPNGGVIITNPNAPTSIALSLAEIEQV--LQANPDRVVVIDEAY---VDFGAESA
HIS81_OCEIH     DDYTIPVE----HFYNSEGGVIFPNPNAPTGIF---LEIDQIKRILENNNQVVIIDEAYIDFALESAVTL
DAPAT_METST     ENIVYLPATSENDFVPSLPSEKVDIPNNPTGTTLTKEQLKEWVDYAHENDALILFDAAYESFITPGIPHS
DAPAT_DESPS     QNIVYLDSTKENNFTEKVDLIYLCFPNNPTGSTITKAGLKRWVDYAIENKALILFDAAYEAFIQDDTPKS
ALAT1_RAT       EERAWALDIAELRRALCQAVLCVINPGNPTGQVQTRECIEAVIRFAFKEGLFLMADEVYQDNVY------
HIS8_VESOH      DDFEIDDDTMQKAITYNPKLIFIAYPNNPTG---NMFNREIIEHIISSTKAMVVLDEAYYAYTTDS---F
HIS8_DIAST      ADFELDEAAMLDAIAQHRPAITLAYPNNPTATLWDEAVVQRIIDAAGAQGGIVVMDEAYQPFASRSIERM
GLDSA_STRKN     PDLCLDPDAVEAAITPATKAIVV------VHLYAAVADLTRLKEVADRHGIVLIEDCAQAHAEFEG----
DAPAT_PELPD     KGIVYMPCTEANGFTEKVDIIYLCFPNNPTGTVASREELKKWVDYAIANNAVIFFDAAYEAFIIEGAKKC
DAPAT_METTH     EENSFIPSLPEERVD----LIYLCYPNNPTGTTLTEKQLAEWVDYARDSGSLILFDAAYEYIQEDGIPHS
DAPAT_AZOPC     PENYFVP-----NFPRKTADVILCYPNNPTGIALNAAQLKNWVDYALTNKSLILFDAAYEYISQQDVPHS
1A1L1_BOVIN     ---------------------ILINPQNPLGDIYSPGELQEYLEFAKRHELHVMVDEVYMLSVFEAGYRS
HIS8_STRTD      EPLTSSFEIDTQDYLVENGGIILTNPNAPTG-IYKPLD-QVEEIVKANQSVVVIIDESY--INFGGETAL
HIS8_RHOOB      XXXXXXXXXXXXXXXERRPDVVVTSPNNPTGHSVGIAELR---RVLDSAPGIVIVDEAYAEF---SDAPS
HIS8_BIFLO      ADFTLNVDKVLEAIAEVKPSMVLTSPNNPTGTPLPMEDIERILAACETAEVILVIDEAYVEFRKPGTPSA
HIS8_ACIBY      ENFEI---DVRDY-TQPNGGVIITNPNAPTSIALSLAEIEQV--LQANPDRVVVIDEAY---VDFGAESA
HIS8_ACIBC      ENFEI---DVRDY-TQPNGGVIITNPNAPTSIALSLAEIEQV--LQANPDRVVVIDEAY---VDFGAESA
DAPAT_PROMT     SENGFEASIPKDKFDLIYLCF----PNNPTGAVATKEQLVSWVKYAKENNSLILFDAAYEHSIFEIE---
DAPAT_PELCD     EGLTYLACTEENGFTEKVDIIYLCYPNNPTGTVATKEVLKAWVDYALANDAVIFFDAAYEAFITEGIPHS
DAPAT_EUBR3     ADNGFVPELPKE-VPD---MIYLCLPNNPTGTTLKKEQLQVWVDYANKNGSVIIFDAAYEAYISEAD--V
AVTA_ECOLI      PNIELLPEGQFKHIGEETGMICVSRPTNPTGNVITDEELLKLDALANQHGIPLVIDNAY-GVPFPGIIFS
AADAT_HUMAN     DESGIVPDSLRDILSKNTPKFLYTVPNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNKFRVP
HIS8_MYCUA      DDIDAAIAVVSDRRPD---VVFITSPNNPTGQSVSLTELR---RLLDVVPGILIVDEAYGEFSSQPSAVG
HIS8_LACLM      DDFSLSVNSY----FQENGGIVIANPNAPTGMAISLQEIEEI--LQNNQDSIVLIDEAY--IDFGGESCL
ARNB_PHOLL      HTLMVDAQTVKKAITSRTKAII---PVHYAGA---PCDLDILRGIAQEAGIPLIEDAAH-----------
ARNB_ERWCT      HTLMVRSQDIEAAITPKTKAII---PVHYAGA---PADLDALRALSERYGIPLIEDAAH-----------
AADAT_BOVIN     DEHGIIPDSLREILSEDSKNPKKNSPKNPSGNSLTAERKREIYELARKYDFLIIEDDPYYFMQFNKPWAP
PTSJ_SALTY      DSEGMQPEKLERALNQGARAVILTPRANPTGCSLSARRAAALQNLARYPQVVVIIDDHF--ALLSSSPWQ
ARNB_PSEPF      DTLMTDAARIEAAITPRTKAII---PVHYAGAA---FDLDPLYALADKHGIAVIEDAAH-----------
ALAT2_XENTR     EENCWALDINERSLTEDPKVLCIINPGNPTGQVQSRKCIEDVIRFAAEENLFLMADEVYQDNVY------
1A11_PRUMU      NNFKITKEALEQKNNINVKGLIITNPSNPLGTTLDRNTLESLVEFINQKNIHLVCDEIYAATVFSSPTFT
1A11_ORYSJ      NGFRVTRPALDDAYRRRVKGVLITNPSNPLGTASPRADLETIVDFVAAKGIHLISDEIYAGTAF------
1A11_ORYSI      NGFRVTRPALDDAYRRRVKGVLITNPSNPLGTASPRADLETIVDFVAAKGIHLISDEIYAGTAF------
HIS8_PELCD      EGWALKPERYTGKL------FFLTNPNAPLGFCYP---QEFIEELAGRVDGMLVVDEAYADFAKENSRRL
DAPAT_SYNP2     GGLTYIPITADNDFTEKVDLIYLCFPNNPTGATATKEQLQAWVDYAKTNGSIIFFDAAYEFITDESLPHS
ARNB_PSEF5      PDTLMSAATIEAAITPRTKAII---PVHYAGAA---FDLDPLYALADKHGIAVIEDAAH-----------
AADAT_MOUSE     DEHGIIPEGLKKILTKKTPKFLYTVPNNPTGNSLTGDRKKEIYELARKYDFLIIEDDPYYFLQFSKPWEP
NTDA_BACSU      QTFCIDPDKIEEAITPYTKFIL------PVHLYGKHSDMQHIRQIANRYKLKVIED--------------
NORG_STAAC      QINEI--DTIIDRFINNKAIYIEPRFNNPTGRSLTNEQKKNIITYSERHNXXXXXXXXXXXXXXSDPTPS
NORG_STAA8      QINEI--DTIIDRFINNKAIYIEPRFNNPTGRSLTNEQKKNIITYSERHNXXXXXXXXXXXXXXSDPTPS
NORG_STAA3      QINEI--DTIIDRFINNKAIYIEPRFNNPTGRSLTNEQKKNIITYSERHNXXXXXXXXXXXXXXSDPTPS
HIS8_POLNA      PDFELDEAAMLAAIAEHKPSITLAYPNNPTANLWDDAVIENIINAVGEQGGLVVIDEAYQPFASKS---Y
HIS8_BACTN      ENFQFSAEKLLAATDERTKLIFLCSPNNPTGNDLLRSEIEKILR---EFEGLVILDEAYNDF---SEAPS
HIS81_NITMU     PDFSLDAEAMLAAIARQPAVIFIAYPNNPTGNL---FDAVEISRIIDAAPGVVVVDEAY-----------
HIS81_NITEU     PDFSLDIDAIERH---QPSVIFLAYPNNPSGNL---FDTSALEKIIEISPGLVVIDEAYH--PFAGKSFI
DAPAT_TRIEI     AENNFTAEIPTQKVDLIYLCF----PNNPTGATATKEYLQTWVNYARANDAIILFDAAYEAFITDASHSI
DAPAT_PROM1     SENGFEASIPKDKFDLIYLCF----PNNPTGAVATKEQLVSWVKYAKENNSLILFDAAYEHSIFEIE---
ARNB_PSEAE      DTLMCSAQAVEAAIGPRTRAIV------PVHYAGSTLDLEGLRTVAGRHGIALVEDAAH-----------
ARNB_PSEAB      DTLMCSAQAVEAAIGPRTRAIV------PVHYAGSTLDLEGLRTVAGRHGIALVEDAAH-----------
ARNB_PSEA8      DTLMCSAQAVEAAIGPRTRAIV------PVHYAGSTLDLEGLRTVAGRHGIALVEDAAH-----------
ARNB_PSEA7      DTLMCSAQAVEAAIGPRTRAIV------PVHYAGSTLDLEGLRTVAGRHGIALVEDAAH-----------
HIS8_STRGC      ADFEVHP---SDYFGDNGGIILAN-PNAPTGIYLPLKQLEEI--LASNQDAVVVVDEAY--INFGGQSAL
HIS8_MYCMM      DDIDAAIAVVSDRRPD---VVFITSPNNPTGQSVSLTELR---RLLDVVPGILIVDEAYGEFSSQPSAVG
HIS8_CLOBK      EDFSI---DIND-FKNARGGAVITNPNAPTGVYLSLDSIKQI--LEDNVNKVVIVDEAY--IDFGGESSV
HIS81_BACC1     DGIHDLDAMLEQ-VDDKTKIVWICNPNNPTGTYVEKQKLLSFLESVPK-SALVIMDXXXXXXXXXXDYPQ
GLDSA_STRSD     IDLCLDPAAVEAAITPATKAVVV-----------------------------------------------
ARO8_YEAST      AD-GIIPEKLAKVMENWTPGYTIPTGQNPTGTSIADHRKEAIYKIAQKYDFLIVEDEPYYFLQMEKAQSS
1A13_SOLLC      NGFRITESALEEAYLDKVKGVLVTNPSNPXXXXXXXXXXXXXXXFIDEKGIHLISDEIYSGTVFNSPEKN
HIS8_CLOB8      DNFDIPLEELKK----TNGGVIIPNPNAPTGKYINTESLKSL--IEANKDRVVIIDEAY--IDFGGQ--S
HIS8_CAMLR      HDLNELYELYQKHKNEIKVIFLC-LPNNPLGECLDASAVFEFLEKIDEDCLVAIDGAYNEFASFKDKHIN
1A1C_TOBAC      NNFQITTKAVREAYENKVKGLILTNPSNPLGTTLDRDTLKNLLTFTNQHNIHLVCDEIYAATVFNPQFVS
HIS8_SULDN      EDLD---EFYELYKQEKPEIIFICTPNNPTGDALDAQKIYNFLEKID-NDTLVVVDAAYMEYAIVKDAKK
HIS8_ACISJ      ADFELDEAAMLAAIAQHRPAITLAYPNNPTATLWDEAVVQRIIDAAGAQGGIVVMDEAYQPFASRSIERM
HIS82_GLUOX     DDFAIDI----DAYTGDCGGIIIANPNANTGIALPLEQIETLLKRHPDRTV--IIDEAYVDFAIELTHRY
ARNB_AERHH      DTLMTSAELIAPLITANTKAII---PVHYAGA---PVDLDPILALARRHGIAVIEDAAH-----------
NORG_STAAB      QINEI--NTIIDRFINNKALYIEPRFNNPTGCSLTNEQKQNIITYSERHNXXXXXXXXXXXXXXSDPTPA
HIS8_XANC5      DGRADIPAIVARALASNAKLVFLCSPSNPAGSAIA-LDQIEQALQALQGKALVVVDEAYGE--FSDVPSA
HIS83_RHIME     PDLSVDMDALLAAIARKPRMLMFSNPMNPVGSWLTPLQLAKVVAALDPETLIVVXXXXXXXXXXXXXPSA
NORG_STAAN      QINEI--NTIIDRFINNKAIYIEPRFNNPTGRSLTNEQKKNIITYSERHNXXXXXXXXXXXXXXSDPTPA
NORG_STAAM      QINEI--NTIIDRFINNKAIYIEPRFNNPTGRSLTNEQKKNIITYSERHNXXXXXXXXXXXXXXSDPTPA
HIS8_CAMC1      HNLSEFLEIYNAH-KDEISVIFLCLPNNPLGECIDADEVYKFIKNIDENTLVVLDCAYNEFAKFKDSKKE
GSA_MYCSS       D--VDAVEEIFEQVGDQIAAVITESPGNMGAVPPEPGFNAALRRITEEHGALLILDEV------------
GSA_MYCSK       D--VDAVEEIFEQVGDQIAAVITESPGNMGAVPPEPGFNAALRRITEEHGALLILDEV------------
DAPAT_DESOH     AQNSFLPAIPKEPADLVYLCF----PNNPTGAVATKEYLQAWVDWALDAKALILFDAAYEAFIRDPSPKT
COBD_SALTY      EDGWQLTDAILEALTPDLDCLFLCTPNNPTGLLPERPLLQAIADRCKSLNINLILDEAFIDFIPHETGFI
1A1L2_HUMAN     SEVTLTVDKLEEALPEKVRGLVLINPQNPLGDIYSPDSLMKYLEFAKRYNLHVIIDEIYMLSVFDESITS
HIS8_HYDS0      ENFQMNKQTLQKALEKKPSIAFISNPNNPTGNLFRDEDI----ALIRKHTFTVVDEAYYD---FCGKTYI
DAPAT_ARATH     ------------------------SPNNPTGAAATREQLTQLVEFAKKNGSIIVYDSAYAMYMSDDNPRS
COBD_SALTI      EDGWQLTDAILEALTPDLDCLFLCTPNNPTGLLPERQLLQAIADRCKSLNINLILDEAFIDFIPHETGFI
HIS82_RHIME     AAFRI---DIADY-RRPSGAVILPNPNAPTGIGLPLAEIERL--VADHPGQPVVIDEAY--IDFGGESAI
ALAT2_XENLA     EENCWALDIAEARKHCDPKVLCIINPGNPTGQVQSRKCIEDVIRFAAEENLFLMADEVYQDNVY------
HIS8_PSEU2      EQFQI---RAEDYARPN-AGIIFPNPNAPTGCLLGLDKVEQIIKASP--DSVVVVDEAY--IDFGGE--T
HIS8_CAMFF      EHNLAEFREIYRTNKNDISVIFLCLPNNPLGECLDADEVFSFIKDVSEDTLVVIDGAYMEFAKFKSSKKE
GSA_MYCSJ       D--VDAVDEIFEQVGDQIAAVITESPGNMGAVPPEPGFNAALRRITEEHGALLILDEV------------
DAPAT_PROM0     EDNNFLPELPEKKVDILYLCF----PNNPTGATINKADLKKWVDYALQNKSLILFDAAYEAFI-------
ALAT_YEAST      ------------------SVLIVINPGNPTGAVLSEETIARICLIAAKYGITIISDEVYQENIF------
HIS8_BUCDN      NTWQLDLLNIKLNLNSVKLIYICN-PNNPTGSTCSKKDLFDLLEMT-LNTSLVVVDEAY--IEFLPKESM
HIS8_BACCN      DGIHDLDAMLE-QVDYNTRIVWVCNPNNPTGTYVEKQKLLSFLENVPKSS-LVIMDXXXXXXXXXXDYPQ
HIS8_ACIAD      DHFEI---VVEDYXXXXXXXXXXXXXXXTSIAL----SLKNIEQILKNNDRVVVIDEAY---VDFGAESA
HIS8_ACIAC      ADFELDEPAMLAAIAQHRPAITLAYPNNPTATLWDEGAVQRVIDAAGAQGGIVVMDEAYQPFASRWLDRM
GSA_PROAC       DTIVVALDAVFSERGDQIAAVIVESPANMGVVPPEPGFNAAIRRLTTEHGALMITDEV------------
GLDSA_MICEC     QTLCLDPAAVERAITPRTAAIVV------VHLYSAVADLDALTAIAERHEIPLIEDCAQAH---------
1A11_ARATH      NNFQITKQALESYLKAQETGIKIKGISNPLGTSLDRETLESLVSFINDKQIHLVCDEIYAATVFAAEIIQ
HIS8_PSEE4      EQFQIQ---VSDY-SKPNAGIIFPNPNAPTGCL---LPLEAVEQLLQANDSVVVVDEAY--IDFGGE--T
HIS8_LACLA      DDFKVL---IKDYCIEN-GGIVIANPDAPTALALNLKDIEEILK-KNQNSIVLINEA---YIDFGGETCL
HIS82_LEGPL     -----------------TGIIFIANPNNPTGVLIQQEEIKYLLEQIPKSTLLVLDEAYYEFAASQLTVNS
HIS82_LEGPH     -----------------TGIIFIANPNNPTGVLIQQEEIKYLLEQIPKSTLLVLDEAYYEFAASQLTVNS
DAPAT_LAWIP     SKLIYLPCTIENNFTQHPDIIYLCYPNNPTGTVLSKDQLTIWVNYAKKEGAIILFDAAYEAYITDPTIPH
DAPAT_CYAP8     EGLVYLPINAENNFIAEIPSQKVDFPNNPTGATATKDYLKNWVDYAKANGSIIFFDAAYEAFITDSSHSI
RFFA_ECOLI      PDTMNIDETIEAAITDKTRVIV---PVHYAGVA---CEMDTIMALAKKHNLFVVED--------------
HIS8_PROAC      ASWGLTTDEILSAIEEVKPDVVXXXXXXXXXXXXIP--VAVIDEVCAGTDTIVVVDEAYQEFTDAPEDSS
HIS82_LEGPA     -----------------TGIIFIANPNNPTGMLIQQEEIKYLLEQIPKSTLLVLDEAYYEFAASQLTVNS
HIS81_BACCZ     DGIHDLDAMLQQ-VDDQTKIVWICNPNNPTGTYVEKQKLLSFLEAVPK-SALVIMDXXXXXXXXXXDYPQ
GLADA_MICEC     DDWCIDPVKVEEAITDRTRAIMVVHLGNQV------ADMDALLDICRRHNLLLIEDCAHAH---------
Y2256_MYCBO     HHVVLKPPFVLDHVPDDADLVVVGNPTNPT----SVXXXXXXXXXXXXPGRILVVDEAFADWV-PGE---
Y2231_MYCTU     HHVVLKPPFVLDHVPDDADLVVVGNPTNPT----SVXXXXXXXXXXXXPGRILVVDEAFADWV-PGE---
MFNA_METST      NEYKIDVTKLPDLITDNTMAMVGIAGTTELGLVD---DIPEISKIAKSYGV-------------------
HIS8_XANAC      DGPADIPAIVAMALSSNAKLVFLCSPSNPAGSAIA-LDQIEQALQALQGKALVVVDEAYGE--FSDVPSA
HIS8_PSEPK      EQFQIR---IEDY-KKPNAGIIFPNPNAPTGCLMPLQAVEELLQA--NRDSVVVVDEAY--IDFGGE--T
HIS8_PSE14      DQFQIRAE----DYAKPNAGIIFPNPNAPTGCLLGLDKVEQIIKASP--DSVVVVDEAY--IDFGGE--T
HIS8_DEIRA      PDFSLPVETLQALAAHAPGVFYVTQPHAPTGHSXXXXXXXXXXXXXXXLGWVTVIDEAYSQ--YAGTDYR
HIS81_BACHK     DGIHDLDAMLQQ-VDDQTKIVWICNPNNPTGTYVEKQKLLSFLESVPK-SALVIMDXXXXXXXXXXDYPQ
HIS81_BACAN     DGIHDLDAMLQQ-VDDQTKIVWICNPNNPTGTYVEKQKLLSFLESVPK-SALVIMDXXXXXXXXXXDYPQ
GLYA_DIAST      DKEEIDYDALEAKAREHKPKLIIAG----ASAYALRIDFERFAKIAKEVGAIFWVDIAYAGLVVAGEYPN
GLYA_ACISJ      DKEEIDYDALEAKAREHKPKLIIAG----ASAYALRIDFERFAKIAKEVGAIFWVDIAYAGLVVAGEYPN
HIS8_XANCB      DGAADVPVIVQAALDAKAKLVFLCSPSNPAGSAIPLAEIEV-ALQALQGKAVVVVDEAYGE--FSDVPSA
HIS8_SYNAS      PDFTLDLEAMIENGGEPSCGMAFPNPNAPTGIALT---LKQIEDLLNRYDRVVVIDEAY--IDFGGE--S
HIS8_PSEPG      EQFQIR---IEDY-NKPNAGIIFPNPNAPTGCLMPLQAVEQL--LLANRDSVVVVDEAY--IDFGGE--T
HIS8_CAMHC      HDLKEIKELYESH-KDEISVIFLCVPNNPLGECLDAKDVIKFIKSIDD-DTLVVIDAAYEFASFKDKHKE
MALY_ECOLI      ------------------------SPQNPTGKVWTCDELEIMADLCERHGVRVISDEIHMDMVWGEQPHI
DAPAT_PROM5     EDNNFLPEIPKNKVDIVYLCF----PNNPTGATITKDELKKWVDYANHNKSLILFDAAYEAFI-------
HIS8_NITSB      HDLEEFYDLYKKHHPD---IIHICTPNNPTGDALDAEYLYSF--LDNVQEPLVIVDGAYEYAAFKDEKKR
GCSPB_PYRHO     ENGTVDLEALENAVSERTAGLMLTNP--------------------------------------------
ALAT2_DANRE     EELQRSLQAARKHCNPRVLCII--NPGNPTGQVQSRQCIEDVIQFAAKENLFLMADEVYQDNVY------


                         .         .         .         +         .         .         .:280
query           PMEFADTDNVVVVNACSKTYSMTGWRLGWVAASERRAERMLRVHQYVQXXXXXXXXXXXXXXLSGPQGVV
AAT1_METJA      PMQF--TDRCILINGFSKTYAMTGWRIGYLAVSDELINNMIKIHQYSFACATTFAQYGALAALRGSQKCV
AAT_PYRHO       PMIKFAPENTILANSFSKTFAMTGWRLGFVVAPSQVIKEMTKLHAYVIGNVASFVQIAGIEALRSEESAV
AAT_PYRAB       SIASLDFERTITVNGFSKTFAMTGWRLGFVAAPSWIIEKMVKFQMYNATCPVTFIQYAAAKALRDERSAV
AAT_BACST       IAELSPKAQTVIINGVSKSHSMTGWRIGYAAGPKDIIKAMTDLASHSTSNPTXXXXXXXXXXXXGPQEPV
AAT1_BACSU      IAQLSDKEQTVIINGVSKSHSMTGWRIGYAAGSEDIIKAMTNLASHSTSNPTSIAQYGAIAAYNGPSEPL
AAT_THEAQ       PGTLA-PEHTITVNGAAKAFAMTGWRIGYACGPKAVIKAMADVSSQSTTSPDTIAQWATLEALTNREASM
AAT_BACY2       IAQISEKAQTIVINGVSKSHSMTGWRIGYAAGNADIINAMTDLASHSTSNPTTASQYAAIEAYNGPQDSV
AAT_AQUAE       PASFSDVKNITTVNAFSKSYSMTGWRIGYVACPEEYAKVIASLNSQSVSNVTTFAQYGALEALKNPKSFV
AATA_RHIME      PVEVEPYERTLTMNGVSKAYAMTGWRIGYAAGPLHLIKAMDMIQGQQTSGAASIAQWAAVEALNGPQDFI
AAT_STRVG       VLVPALRDKCIIVNGVAKTYAMTGWRVGWVIAPQDVIKAATNLQSHATSNVSNVAQVAALAAVSGNLDAV
AAT_THET8       PGRVA-PEHTLTVNGAAKAFAMTGWRIGYACGPKEVIKAMASVSSQSTTSPDTIAQWATLEALTNQEAFV
AAT_SYNY3       IGAVNDEQRTIISNGFAKSYSMTGWRVGYLAGELPLIQACSTIQGHSTSNVCTFAQYGAIAALENPQTCV
AATB1_RHIME     QLEPGLKNRTLTVNGVSKAYAMTGWRIGYAGGPRELIKAMAVVQSQATSCPSSISQAASVAALNGPQDFL
AATB2_RHIME     RLEPGLKDRTLTVNGVSKAYAMTGWRIGYAGGPRALIKAMAVVQSQATSCPXXXXXXXXXXXLNGPQDFL
AAT_SULTO       VLEDPDRDYVIYVNGFSKTFSMTGWRLGYVVAKEKVIKKMAEIAANIYTCPTSFAQKGALAAFES-FDEV
AAT_SULSO       TLEDSDRDFLIYVNGFSKTFSMTGWRLGYIVAKREIIQKMLAANVYTAPTSFVQKAAVKAFDTFDE---V
AAT_SULAC       VLEDPDWKNFIYVNGFSKTFSMTGWRLGYVVAKENVIKKMSEIAANVYTCPTSFAQKAAVSAFDTFDD-V
DAPAT_CARHZ     PLEVKGAKDVIEFHSLSKTYNMTGWRIGWAVGNAKAIDALGRLKSNIDSGVFQAIQYAGIKALEGPQDVV
PATA_BACSU      IATYL-RDQTIVINGLSKSHSMTGWRIGFLFAPKDIAKHILKVHQYNVSCASSISQKAALEAVTNGFDDA
AAT_RICBR       LAEIAPKDRIFTVNGVSKAYSMTGWRIGYGAGSKALIKAMTIIQSQSTSNPCSISQVAAVEALNGVQGYI
AAT_RHILP       PVEVEPQDRTLTMNGVSKAYAMTGWRIGYAAGPIQLIKAMDMIQGQQTSGATSIAQWAAVEALNGTQDFI
DAPAT_HALOH     FMQFEGAKKVIEFNSLSKPFNMTGWRVGWAVGRSDVIESLGRIKTNIDSGIFEAIQYAGIEALTGPEDNI
AAT_THEMA       ILDVSEFDRIVYINGFSKSHSMTGWRVGYLISSEKVATAVSKIQSHTTSCINTVAQYAALKALEVDNSY-
AAT_RICFE       LAQIAPKERIFTVNGVSKAYSMTGWRIGYGVGSKALIKAMTIIQSQSTSNPCSISQMAAIESLNGPQDYI
AAT_RICCN       TLAQIAPDRIFTVNGVSKAYSMTGWRIGYGAGSKTLIKAMTIIQSQSTSNPCSISQMAAIEALNGPQDYI
DAPAT_SYNFM     PLSFLELPGAVEFHSLSKTYNMTGWRLGFAVGNADILAGLGQVKSNIDSGAFNAVQWAGITALEGDQGCV
AAT_RICPR       LAQIAPKERIFTVNGVSKAYSMTGWRIGYGAGSKALIKAMTIIQSQSTSNPCSISQMAAIEALNGTQDYI
AAT_RICTY       LAQIAPKERIFTVNGVSKAYSMTGWRIGYGAGSKALIKAMTVIQSQSTSNPCSISQMAAIEALNGTQDYI
DAPT2_ANASP     VLQIPGAKDIAIFHSLSKSYNMTGWRIGFAVGNAYAIKGLSQVKTNVDSGVFXXXXXXXXXXXXTDEVEL
DAPAT_MOOTA     PLQAPGAKEVIEFNSVSKPYNMTGWRLGWACGRADVIEALARIKSNIDSGAFQAVQYAGIAALTGPQEGL
DAPAT_GLOVI     PSILGARDVAIEFLSCSKAYNMTGWRVGFVIGNRTGIAGLGQVKTNIDSGVFKXXXXXXXXXFGLDDERL
AAT2_METJA      AIEFDENEKTILINGFSKLYAMTGWRIGYVISNDEIIEAILKLQQNLFISAPTISQYAA