[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for halo0:AAG19981.1

[Show Plain Result]


## Summary of Sequence Search
    1::462
    1::477     2e-83  45%  481 aa  PHR_HALSA RecName: Full=Deoxyribodipyrimidine photo-lyase;       
    6::457     8e-59  37%  484 aa  PHR_SYNP6 RecName: Full=Deoxyribodipyrimidine photo-lyase;       
   20::485     5e-50  30%  488 aa  PHR_SYNY3 RecName: Full=Deoxyribodipyrimidine photo-lyase;       
    4::471     3e-47  32%  472 aa  PHR_ECOLI RecName: Full=Deoxyribodipyrimidine photo-lyase;       
    7::472     3e-46  35%  474 aa  CRYD_NATPD RecName: Full=Cryptochrome DASH;
  103::334     4e-44  40%  339 aa  PHR_BACPF RecName: Full=Deoxyribodipyrimidine photo-lyase;       
    7::469     8e-44  36%  500 aa  CRYD_GLOVI RecName: Full=Cryptochrome DASH;
  238::472     1e-43  40%  473 aa  PHR_SALTY RecName: Full=Deoxyribodipyrimidine photo-lyase;       
  240::471     4e-42  38%  483 aa  PHR_BUCAI RecName: Full=Deoxyribodipyrimidine photo-lyase;       
  275::472     1e-41  41%  478 aa  PHR_BUCBP RecName: Full=Deoxyribodipyrimidine photo-lyase;       
  239::427     2e-41  46%  469 aa  PHR_VIBCH RecName: Full=Deoxyribodipyrimidine photo-lyase;       
  194::440     7e-40  40%  455 aa  PHR_STRGR RecName: Full=Deoxyribodipyrimidine photo-lyase;       
  359::641     3e-39  38%  642 aa  PHR_NEUCR RecName: Full=Deoxyribodipyrimidine photo-lyase;       
    9::482     1e-36  29%  489 aa  CRYD_SYNY3 RecName: Full=Cryptochrome DASH;
    5::468     1e-36  30%  488 aa  CRYD_RHOBA RecName: Full=Cryptochrome DASH;
  296::565     2e-34  36%  565 aa  PHR_YEAST RecName: Full=Deoxyribodipyrimidine photo-lyase,
   18::447     4e-33  28%  449 aa  CRYD_IDILO RecName: Full=Cryptochrome DASH;
    5::92      7e-32  40%  420 aa  PHR_THET8 RecName: Full=Deoxyribodipyrimidine photo-lyase;       
    5::104     9e-32  39%  420 aa  PHR_THET2 RecName: Full=Deoxyribodipyrimidine photo-lyase;       
   81::178     9e-32  36%  577 aa  CRYD_SOLLC RecName: Full=Cryptochrome DASH,
   12::92      1e-29  37%  520 aa  CRYD_DANRE RecName: Full=Cryptochrome DASH;AltName: Full=Protein
    8::74      1e-29  35%  612 aa  CRY2_ARATH RecName: Full=Cryptochrome-2;AltName: Full=Blue light
   13::99      2e-28  38%  523 aa  CRYD_XENLA RecName: Full=Cryptochrome DASH;
    8::74      3e-28  34%  501 aa  CRY1_SINAL RecName: Full=Cryptochrome-1;AltName: Full=Blue light
   87::185     1e-27  35%  582 aa  CRYD_ORYSJ RecName: Full=Cryptochrome DASH,
  245::499     4e-25  36%  678 aa  CRYD_GIBZE RecName: Full=Putative cryptochrome DASH;
   15::112     4e-25  31%  681 aa  CRY1_ARATH RecName: Full=Cryptochrome-1;AltName: Full=Blue light
   87::184     1e-24  37%  569 aa  CRYD_ARATH RecName: Full=Cryptochrome DASH,
  280::524     2e-24  38%  745 aa  CRYD_NEUCR RecName: Full=Putative cryptochrome DASH,
  265::493     9e-24  31%  545 aa  CRY1_AEDAE RecName: Full=Cryptochrome-1;
  251::489     1e-23  29%  620 aa  CRY1_SYLBO RecName: Full=Cryptochrome-1;
  251::489     1e-23  29%  620 aa  CRY1_ERIRU RecName: Full=Cryptochrome-1;
  251::489     1e-23  29%  621 aa  CRY1_CHICK RecName: Full=Cryptochrome-1;
  251::489     2e-23  29%  588 aa  CRY1_RAT RecName: Full=Cryptochrome-1;
  251::489     2e-23  29%  606 aa  CRY1_MOUSE RecName: Full=Cryptochrome-1;
  251::489     2e-23  29%  586 aa  CRY1_HUMAN RecName: Full=Cryptochrome-1;
  311::504     2e-23  32%  542 aa  CRY1_DROME RecName: Full=Cryptochrome-1;         Short=DmCRY1;     
  251::489     3e-23  29%  586 aa  CRY1_MACFA RecName: Full=Cryptochrome-1;
    6::92      3e-23  31%  587 aa  CRY1_SPAJD RecName: Full=Cryptochrome-1;
  261::447     4e-23  34%  499 aa  CRY1_CULQU RecName: Full=Cryptochrome-1;
  229::460     6e-23  35%  504 aa  CRY2_VIBCH RecName: Full=Cryptochrome-like protein cry2;
  269::507     6e-23  29%  594 aa  CRY2_RAT RecName: Full=Cryptochrome-2;
  269::507     6e-23  29%  592 aa  CRY2_MOUSE RecName: Full=Cryptochrome-2;
    9::98      7e-23  34%  546 aa  CRYD_OSTTA RecName: Full=Cryptochrome DASH,
  237::442     1e-22  34%  461 aa  CRYD_VIBCH RecName: Full=Cryptochrome DASH;
  311::504     1e-22  32%  540 aa  CRY1_DROPS RecName: Full=Cryptochrome-1;
  260::498     1e-22  29%  582 aa  CRY2_CHICK RecName: Full=Cryptochrome-2;
  270::508     3e-22  28%  593 aa  CRY2_HUMAN RecName: Full=Cryptochrome-2;
    5::143     1e-21  30%  545 aa  CRY1_ANOGA RecName: Full=Cryptochrome-1;         Short=agCRY1;
  237::435     2e-21  33%  445 aa  CRYD_VIBPA RecName: Full=Cryptochrome DASH;
    5::283     9e-16  33%  284 aa  YAT1_SYNP1 RecName: Full=Uncharacterized 31.6 kDa protein in atpI
  120::214     2e-10  44%  447 aa  PHR2_ARATH RecName: Full=Blue-light photoreceptor PHR2;
    1::462

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MHLYWHQRDLRVPDNRGLHAATDGDTVVPVYVFDDTVLSQVGRPKRAFLAAGVRALRAAYRERGSDLLVR
PHR_HALSA       MQLFWHRRDLRTTDNRGLAAAAPGVTAVDVFCFDDEVLAHAAPPRVAFMLDALAALRERYRDLGSDLIVR
PHR_SYNP6       --LFWHRRDLRLSDNIGLAAAAQSAQLIGLFCLDPQILQSADMPARAYLQGCLQELQQRYQQAGSRLLLL
PHR_SYNY3       --LLWHRRDLRLNDHLALAKARQKTAIVGVFCLDNKILQDMAPARVAYLLGCLQSLQDHYQRLGSELLVF
PHR_ECOLI       -HLVWFRQDLRLHDNLALAAACRNSSVLALYIATPRQWATHNMPRQAELIAQLNGLQIALAEKGIPLLFR
CRYD_NATPD      ----WFRDDLRVTDNPTLDAVAAAETVIPVYTFDPDTESEYGPPKTGFRRQAVADLRASLRDRGGDLLVR
PHR_BACPF       ----------------------------------------------------------------------
CRYD_GLOVI      --LVWYRNDLRVHDHEPLTSALHKNAVVALYCFDPRQFGKAGPFRARFLLESVADLRRSLRQLGSDLLVR
PHR_SALTY       ----------------------------------------------------------------------
PHR_BUCAI       ----------------------------------------------------------------------
PHR_BUCBP       ----------------------------------------------------------------------
PHR_VIBCH       ----------------------------------------------------------------------
PHR_STRGR       ----------------------------------------------------------------------
PHR_NEUCR       ----------------------------------------------------------------------
CRYD_SYNY3      --LVWFRNDLRLHDHEPLHRALSGLAITAVYCYDPRQFAQTGPWRSNFLQQSVQNLAESLQKVGNKLLVT
CRYD_RHOBA      --LVWFRNDLRTIDHEPFLRASTADRCFAVHCIDELGFQRTGPFRARFLIENLTDXXXXXXXXXXELIVR
PHR_YEAST       ----------------------------------------------------------------------
CRYD_IDILO      --LFVFRNDLRVEDNLALYAAQRSETLICCFCFNPTQIPAMGKHRFTFLQQSLKQLRTELEMRGQKLIVL
PHR_THET8       --LVWHRGDLRLHDHPALLEALARGPVVGLVVLDPNNLKTTPR-RRAWFLENVRALREAYRARGGALWVL
PHR_THET2       --LVWHRGDLRLHDHPALLEALARGPVVGLVVLDPNNLKTTPR-RRAWFLENVRALREAYRARGGALWVL
CRYD_SOLLC      --IVWFRNDLRVLDNEALRAWVSSEAILPVYCVDPRLFGTTGMPKTGALRAQLNDLKRNLVKRGLDLLIQ
CRYD_DANRE      ------RNDLRLHDNEVFHAQRNAEHIIPLYCFDPRHYQKTGPFRLRFLLDSVKDLRALLKKHGSTLLVR
CRY2_ARATH      --IVWFRRDLRIEDNPALAAAAHEGSVFPVFIWCPEEEGQFGRASRWWMKQSLAHLSQSLKALGSDL---
CRYD_XENLA      ------RNDLRLHDNEVLHAHRNADQIVPLYCFDPRHFPKTGPHRLKFLLESVRDLRITLKKKGSNLLLR
CRY1_SINAL      --IVWFRRDLRIEDNPALAAAAHEGSVFPVFIWCPEEEGQFGRASRWWMKQSLAHLRQSLKALGSEL---
CRYD_ORYSJ      --IVWFRNDLRVLDNEAVRAWAASDAVLPVYCVDPRISAKTGALRAQFLIECLEDLKRNLTKQGLDLLIR
CRYD_GIBZE      ----------------------------------------------------------------------
CRY1_ARATH      --IVWFRRDLRVEDNPALAAAVRAGPVIALFVWEEEGHYHPGRVSRWWLKNSLAQLDSSLRSLGTCLITR
CRYD_ARATH      --ILWFRNDLRVLDNDALYKASSSDTILPVYCLDPRLFHKTGALRGGFLMECLVDLRKNLMKRGLNLLIR
CRYD_NEUCR      ----------------------------------------------------------------------
CRY1_AEDAE      ----------------------------------------------------------------------
CRY1_SYLBO      ----------------------------------------------------------------------
CRY1_ERIRU      ----------------------------------------------------------------------
CRY1_CHICK      ----------------------------------------------------------------------
CRY1_RAT        ----------------------------------------------------------------------
CRY1_MOUSE      ----------------------------------------------------------------------
CRY1_HUMAN      ----------------------------------------------------------------------
CRY1_DROME      ----------------------------------------------------------------------
CRY1_MACFA      ----------------------------------------------------------------------
CRY1_SPAJD      --VHWFRKGLRLHDNPALKECIQGDTIRCVYILDPWFASNVGINRWRFLLQCLEDLDANLRKLNSRLLVI
CRY1_CULQU      ----------------------------------------------------------------------
CRY2_VIBCH      ----------------------------------------------------------------------
CRY2_RAT        ----------------------------------------------------------------------
CRY2_MOUSE      ----------------------------------------------------------------------
CRYD_OSTTA      ----WFRNDLRLLDNRAATLASESSDVVPVYVFDETYLARFGAGRGKFTLECVGDLKTSLRALGSDLLVR
CRYD_VIBCH      ----------------------------------------------------------------------
CRY1_DROPS      ----------------------------------------------------------------------
CRY2_CHICK      ----------------------------------------------------------------------
CRY2_HUMAN      ----------------------------------------------------------------------
CRY1_ANOGA      -NILWFRHGLRLHDNPSLLEALKSDCVFPIFIFDGESAGTVGYNRMKFLLESLADLDRQFRDLGGQLLVF
CRYD_VIBPA      ----------------------------------------------------------------------
YAT1_SYNP1      LHLFWHRRDLRLADNLGLYAARQTPTVVGVFCFDPALLQDVAAVRVAYLLGCLQALKEAYQQRGGCLLMV
PHR2_ARATH      ----WFRNDLRVHDNECLNSANDEVSVLPVYCFDSSGFDKTGPFRAQFLIESVSELRKNLQARGSNLVVR


                         .         .         *         .         .         .         .:140
query           EGDAESVLPALADEFDADTVFHAAHYDAARRNRXXXXXXXXXXXXXXXXXHVDHTLVDPATLDDAYPSHS
PHR_HALSA       HGDPAAVLPAVANDLDATRVVWNHDYSGLATDRDAGVRDALDAAGVAHAQFHDAVHHRPGEIGDPYSVYT
PHR_SYNP6       QGDPQHLIPQLAQQLQAEAVYWNQDIEPYGRDRDGQVAAALKTAGIRAVQLWDQLLHSPDQIGNPYSVYG
PHR_SYNY3       QADPVQLLPKLANTLGAHGVTWTLDTEPYAQKRDLAVAQALRERGLAIATEWDQLMHHPGEVGSPYTVYT
PHR_ECOLI       EVDSVEIVKQVCAENSVTHLFYNYQYEVNERARDVEVERALRNVVCEGFD--DSVILPPGAVHEMYKVFT
CRYD_NATPD      SGRPATVVPELAQRAGADAVYAQTKPATEERRRAADVASALDDAGIALRQRWTHTLYHXXXXXXXXXXXX
PHR_BACPF       ----------------------------------------------------------------------
CRYD_GLOVI      RGHPEEVIPALVSELEIAAVHYHGEVTSEELVVERDLQAALAPLNVPVRSFWGTTLVHPDDLPFAIEAIP
PHR_SALTY       ----------------------------------------------------------------------
PHR_BUCAI       ----------------------------------------------------------------------
PHR_BUCBP       ----------------------------------------------------------------------
PHR_VIBCH       ----------------------------------------------------------------------
PHR_STRGR       ----------------------------------------------------------------------
PHR_NEUCR       ----------------------------------------------------------------------
CRYD_SYNY3      TGLPEQVIPQIAKQINAKTIYYHREVTQVERNLVKQLTILGIEAKGYWGSTLCHPEDLPFSIQDLPDLFT
CRYD_RHOBA      VGRPETVLQHLLPSLAIDAVHF--HHEPRTEEADTAESVQQLCDQHGIATHVAYTLIHPDELPFEIADTP
PHR_YEAST       ----------------------------------------------------------------------
CRYD_IDILO      TGTFDRILTELISERQVDAIFLSQHQGYYERLQLGLLQQRFPFLPFHETPN--NTLFSEQELPFELADLP
PHR_THET8       EGLPWEKVPEAARRLKAKAVY-------------------------------------------------
PHR_THET2       EGLPWEKVPEAARRLKAKAVYALTSYTPYGRYR-------------------------------------
CRYD_SOLLC      HGKPEDIVPSLAKAYKAHTVY-------------------------------------------------
CRYD_DANRE      QGKPEDVV--------------------------------------------------------------
CRY2_ARATH      ----------------------------------------------------------------------
CRYD_XENLA      RGKPEEVIEDLVKQ--------------------------------------------------------
CRY1_SINAL      ----------------------------------------------------------------------
CRYD_ORYSJ      HGKPEDILPSIAKAVTAHTVY-------------------------------------------------
CRYD_GIBZE      ----------------------------------------------------------------------
CRY1_ARATH      STDSVASLLDVVKSTGASQIFFNHLYD-------------------------------------------
CRYD_ARATH      SGKPEEILPSLAKDFGARTVF-------------------------------------------------
CRYD_NEUCR      ----------------------------------------------------------------------
CRY1_AEDAE      ----------------------------------------------------------------------
CRY1_SYLBO      ----------------------------------------------------------------------
CRY1_ERIRU      ----------------------------------------------------------------------
CRY1_CHICK      ----------------------------------------------------------------------
CRY1_RAT        ----------------------------------------------------------------------
CRY1_MOUSE      ----------------------------------------------------------------------
CRY1_HUMAN      ----------------------------------------------------------------------
CRY1_DROME      ----------------------------------------------------------------------
CRY1_MACFA      ----------------------------------------------------------------------
CRY1_SPAJD      RGQPADVFPRLFKEWN------------------------------------------------------
CRY1_CULQU      ----------------------------------------------------------------------
CRY2_VIBCH      ----------------------------------------------------------------------
CRY2_RAT        ----------------------------------------------------------------------
CRY2_MOUSE      ----------------------------------------------------------------------
CRYD_OSTTA      CGKSRDVIAEL-----------------------------------------------------------
CRYD_VIBCH      ----------------------------------------------------------------------
CRY1_DROPS      ----------------------------------------------------------------------
CRY2_CHICK      ----------------------------------------------------------------------
CRY2_HUMAN      ----------------------------------------------------------------------
CRY1_ANOGA      RGDSVTVLRRLFEELNIKKLCYEQDCEPIWKERDDAVAKLCRTMDVRCVENVSHTLWNP-----------
CRYD_VIBPA      ----------------------------------------------------------------------
YAT1_SYNP1      QGDPRQVIPEVATTLKATAVHWHEDVEPYARERDRVVAATLNDLGIAVHRQWDQLLHPPSAVQQPYTVYT
PHR2_ARATH      VGKPEAVLVELAKEIGADAVY-------------------------------------------------


                         +         .         .         .         .         *         .:210
query           QFYDDWQQXXXXXXXXXXXXXXXXXXXXXXTLSVPAPEPPLPDAGHAAATDRLAAFLDDGIASYNDTRXX
PHR_HALSA       YFWRKWQDREKNXXXXXXXXXXXXXXXXXXXLGFAEPEAAVPDAGTAAARSLLDAFRESGIYRYEDRRDY
PHR_SYNP6       PFWKNWQAQPKPTPVATPTELVDLSPEQLTAIA-PLLLSELPEPGETAAIARLQEFCDRAIADYDPQRNF
PHR_SYNY3       PFWKNWSQLPKTSPVPTPKDLQGLTPAEKEKLAPLEPDQPLPTPGEEAAEQRLDWFVAHGLEEYQQNR--
PHR_ECOLI       PFKNAWLKRLREGMPECVAAPKVRSSGSIE----PSPSITLNDTAHKAAIAQLRQFCQNGAGEYEQQRDF
CRYD_NATPD      XXXXXWRKETEAAATVRDPRSAPETVPTPDGLTPPVPEPPTDDGGESAGKRRVESYIWEGLREYKTTRNG
PHR_BACPF       ----------------------------------------------------------------------
CRYD_GLOVI      ELFTDFRKQVERSAAINXXXXXXXXXXXXXXVD-PGEIPQLADLGESPVTDERAVLQFKGLKSYKQTRNG
PHR_SALTY       ----------------------------------------------------------------------
PHR_BUCAI       ----------------------------------------------------------------------
PHR_BUCBP       ----------------------------------------------------------------------
PHR_VIBCH       ----------------------------------------------------------------------
PHR_STRGR       --------------------------------------PGLARGGEEAGRKLVTSWLNGPMADYEDGHDD
PHR_NEUCR       -------------------------------------------AGEHEALKRLEKFCDEAIGKYAERRNI
CRYD_SYNY3      KFRKDIEKKKISIRPCFFAPSQLLPSPNIKLLTAPPPEPQINQGGETAGLARLQDYFGDRLKDYKETRNG
CRYD_RHOBA      ELFTDFRKEIEKQCEARSPLEEPIRIHGTLPEEVNAGDPPLDDGGQNAAQQRMEEYIEDRLRVYKETRNG
PHR_YEAST       ---------------------------------IPKSKWCLPDVSEEAALSRLKDFLGTKSSKYNNEKDM
CRYD_IDILO      ETFSQFRKKVEPLSRNFSVQPVNALPSLPKNISYPGASDDFEGGERAALTHLTSYFSGESAGTYKQTRNA
PHR_THET8       ----------------------------------------------------------------------
PHR_THET2       ----------------------------------------------------------------------
CRYD_SOLLC      ----------------------------------------------------------------------
CRYD_DANRE      --------------------------------------------GETEALARLKHYFWDAVATYKETRNG
CRY2_ARATH      ----------------------------------------------------------------------
CRYD_XENLA      --------------------------------------------GESQALQRLEHYFWETVASYKDTRNG
CRY1_SINAL      ----------------------------------------------------------------------
CRYD_ORYSJ      --------------------------------------------GESAALGRVHEYFKDQLKVYKETRNG
CRYD_GIBZE      --------------------------------------------GETPAWDRLYHLIKSGMTTYQETRNG
CRY1_ARATH      ----------------------------------------------------------------------
CRYD_ARATH      ----------------------------------------------------------------------
CRYD_NEUCR      --------------------------------------------------------LSGGMKSYKDSRNG
CRY1_AEDAE      ----------------------------------------------------------------------
CRY1_SYLBO      ----------------------------------------------------------------------
CRY1_ERIRU      ----------------------------------------------------------------------
CRY1_CHICK      ----------------------------------------------------------------------
CRY1_RAT        ----------------------------------------------------------------------
CRY1_MOUSE      ----------------------------------------------------------------------
CRY1_HUMAN      ----------------------------------------------------------------------
CRY1_DROME      ----------------------------------------------------------------------
CRY1_MACFA      ----------------------------------------------------------------------
CRY1_SPAJD      ----------------------------------------------------------------------
CRY1_CULQU      ----------------------------------------------------------------------
CRY2_VIBCH      ----------------------------------------------------------------------
CRY2_RAT        ----------------------------------------------------------------------
CRY2_MOUSE      ----------------------------------------------------------------------
CRYD_OSTTA      --------------------------------------------GESNALARVKYYLSDRLATYFETRNG
CRYD_VIBCH      ----------------------------------------------------------------------
CRY1_DROPS      ----------------------------------------------------------------------
CRY2_CHICK      ----------------------------------------------------------------------
CRY2_HUMAN      ----------------------------------------------------------------------
CRY1_ANOGA      ----------------------------------------------------------------------
CRYD_VIBPA      ----------------------------------------------------------------------
YAT1_SYNP1      PFWRNWSXXXXXXXXXXXXXXXXXXXTEIASIPLPSTHXXXXXXXXXXXXXXXXHFSQHAIYEYGEQRNY
PHR2_ARATH      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           XXXXXXXXXXXXXRLSPYLAAGNIGVREVWXXXXXXXXXXTGNAARNIGKYRYELSWREQNYHLLYHTPR
PHR_HALSA       PHEEPTS------RLSPHLKFGTIGIRTVYEAARAAKSDATDDERENVAAFIGQLAWREFYAQVLYFNQN
PHR_SYNP6       PAEAGTSG------LSPALKFGAIGIXXXXXXXXXXXXXXXXDEARNIRVWQQELAWREFYQHALYHFPS
PHR_SYNY3       ----NFPALDGTSQLSAALKFGVISPRTLWQTTLEAWEQSRSEEARSIETWQQELAWREFYQHCLYSFPA
PHR_ECOLI       PAVEGTS------RLSASLATGGLSPRQCLHRLLAEQPQALDGGAGSV--WLNELIWREFYRHLIYHPSL
CRYD_NATPD      LLGADYSS-----KFSPWLAAGCLSPR--WLHREVERYEDERVANEDTYWLVFELAWRDEKYGATFFKPG
PHR_BACPF       -------------RLSPYIKTGAVSSRSIYYHILNAEAD-----SYSAETFLKELAWRDFYRMVHFYEPD
CRYD_GLOVI      MLGADYSS-----KFSAWLALGCLSARYIHEQVQTYET----KRIKNDSTYWFELLWRDYRFIAAKHGDR
PHR_SALTY       -------------RLSASLATGGLSPRQCLHRLLAEQPQALDGGPGSV--WLNELIWREFYRHLMTWYPA
PHR_BUCAI       --------------LSPYLSAGIISSRYCLKVLLKTKNSLPLNVLLT-SPWFDQILWREFYYHLLIGFPK
PHR_BUCBP       -------------------------------------------------KWINELLWREFYQHLLYFYPN
PHR_VIBCH       --------------LSPYLAIGVLSARQC--VARLYHESSMGELSEGAQVWLSELIWREFYQHLVAIEPN
PHR_STRGR       LAGDATS------RLSPHLHFGTVSAAEL--VHRAREKGGLGGEA-----FVRQLAWRDFHHQVLADRPD
PHR_NEUCR       PAMQGTS------NLSVHFASGTLSARTAIRTARDRNNTKKLNGGNEIQRWISEVAWRDFYKHVLVHWP-
CRYD_SYNY3      MVGADYSS-----KFSPWLALGCLSPRFIYQEVKRYEQERVSNDSTHW--LIFELLWRDQKYNKLFNRGG
CRYD_RHOBA      MLHPNDSS-----KFSPWLAQGCLSPRMIADHVRRYEEERVKN--KSTYWMIFELLWRDKHGATLFRAGG
PHR_YEAST       LYLGGTSG------LSVYITTGRISTRLIVNQAFQSCNGQIMSKASSTQNFIKEVAWRDFYRHCMCNWP-
CRYD_IDILO      LDDFSSST-----KFSPWLAQGCLSVRQIMAALRAYETEFGENESSYW--ISFELLWREYFFYALKHGKR
PHR_THET8       -------------RLSPYFALGVLSPRAAWEAERRG-----GEGAR---KWVAELLWRDFSYHLLYHFPW
PHR_THET2       -------------RLSPYFALGVLSPRAAWEAERRG-----GEGAR---KWVAELLWRDFSYHLLYHFPW
CRYD_SOLLC      -------------KFSPWLASGSLSPRFIYEEVKRYEKERLSNDSTYW--VLFELIWRDYFRFLSIKLAN
CRYD_DANRE      MIGVDFST-----KFSPWLALGCISPRYIYEQIKKYEVERTAN--QSTYWVIFELLWRDYKFVALKYGNR
CRY2_ARATH      --------------LSPYLHFGEISVRHVFQCARMKQIIWASEGEESADLFLRGIGLREYSRYICFNFPF
CRYD_XENLA      LIGLDYST-----KFAPWLALGCVSPRYIY---------------EQIGKYEKERTANQSTYWVIFE---
CRY1_SINAL      --------------LSPYLHFGEISVRRVFQCARMKQIIWAGEGEESADLFLRGIGLRDYSRIICFNFPF
CRYD_ORYSJ      MLGPDYST-----KFSPWLASGSLSPRYICEEVKRYEKQRIANDSTYW--VLFELIWRDYFRFIIFHLPR
CRYD_GIBZE      LLGTEYST-----KLSAFLAMGTITARSIHAELVKFEDGSEESYSRGFGAVRFELLWRDYNYTKKWLTDR
CRY1_ARATH      --------------LSPHLHFGEVSVRKVFHLVRIKQVAWXXXXXXSVNLFLKSIGLREYSRYISFNHPY
CRYD_ARATH      -------------KFSPWLAFGCISPRFIYEEVQRYEKERVAN--NSTYWVLFELIWRDYFRFLLFHLPR
CRYD_NEUCR      LLGPDFST-----KLSAYLAQGCVTARQI-HHALVAYEDGTGTKYKGADGFRMELLWRDRLCHQKYGDKL
CRY1_AEDAE      --------------MSAALRFGCLSVRMFWCVHDLYEKVQANNQYRNPGGQHIQLIWREYFYTMSVHNPH
CRY1_SYLBO      --------------LSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYG-QLLWREFFYTAATNNPR
CRY1_ERIRU      --------------LSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYG-QLLWREFFYTAATNNPR
CRY1_CHICK      --------------LSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYG-QLLWREFFYTAATNNPR
CRY1_RAT        --------------LSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYG-QLLWREFFYTAATNNPR
CRY1_MOUSE      --------------LSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYG-QLLWREFFYTAATNNPR
CRY1_HUMAN      --------------LSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYG-QLLWREFFYTAATNNPR
CRY1_DROME      -----------------------------------------------------QLIWREYFYTMSVNNPN
CRY1_MACFA      --------------LSPYLRFGCLSCRLFYFKLTDLYKKVKRNSSPPLSLYG-QLLWREFFYTAATNNPR
CRY1_SPAJD      --------------LSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYG-QLLWREFFYTAATNNPR
CRY1_CULQU      -----------------------------------------------------QLIWREYFYTMSVHNPH
CRY2_VIBCH      -------------RMSPYLAWGNISLREMYQTLLKHW---------SVAGFRRSLIALSSRLHWHCHIQK
CRY2_RAT        --------------LSPYLRFGCLSCRLFYYRLWDLYRKVKRNSTPPLSLFG-QLLWREFFYTAATNNPR
CRY2_MOUSE      --------------LSPYLRFGCLSCRLFYYRLWDLYKKVKRNSTPPLSLFG-QLLWREFFYTAATNNPR
CRYD_OSTTA      MLGGDYST-----KLAPWLALGCVSPRHVVSEIRRYESERVEN--KSTYWVIFELIWRDFKFFALKHGNK
CRYD_VIBCH      -------------KFSPWLALGAVSPKTIYAMLQRYEAVHGANDSTYW--IFFELLWREYFYYARRYGAK
CRY1_DROPS      -----------------------------------------------------QLIWREYFYTMSVNNPN
CRY2_CHICK      --------------LSPYLRFGCLSCRLFYYRLWELYKKVKRNSTPPLSLYG-QLLWREFFYTAATNNPK
CRY2_HUMAN      --------------LSPYLRFGCLSCRLFYYRLWDLYKKVKRNSTPPLSLFG-QLLWREFFYTAATNNPR
CRY1_ANOGA      -----------------------------------------------------QLIWREYFYTMSVQNPH
CRYD_VIBPA      -------------KFSPWLALGCVSPRMI--HAMLKQYEQTQGANDSTYWIYFELLWREYFYYARCYQQR
YAT1_SYNP1      PGRPGTAL------LSPALKFGVIGIRTVWAASEAALEHARSDEARSIRTWQQELAWRE-----------
PHR2_ARATH      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           LQTENYVSFDAPIAWQNSDDHFEAWTRGETGYPLVDAGMRQLRAEGYVHNRPRQVVASFLTKHLLVDWRR
PHR_HALSA       VVSENFKAYEHPIEWRDDPAALQAWKDGETGYPIVDAGMRQLRAEAYMHNRVRMIVAAFLTKDLLVDWRA
PHR_SYNP6       LADGPYRSLWQQFPWENREALFTAWTQAQTGYPIVDAAMRQLTETGWMHNRCWMIVASFLTKDLIIDWRR
PHR_SYNY3       LAQGPYRSPFQEFPWEENQDHFQAWCEGRTGYPIIDAAMAQLNQTGWMHNRCRMIVASFLIKDLILNWQW
PHR_ECOLI       CKHRPFIAWTDRVQWQSNPAHLQAWQEGKTGYPIVDAAMRQLNSTGWMHNRLRMITASFLVKDLLIDWRE
CRYD_NATPD      GIRERNIDWDRDRAL------FERWADGETGVPFVDANMRELNRTGYMSNRGRQNVASFLAGVLGIDWRW
PHR_BACPF       CKDREIMEGYRELNWSHDQDDLTSWKRGETGFPIVDAGMRQLLNEGWMHNRLRMITASFLTKDLLIDWRL
CRYD_GLOVI      LYTAGLRGLDIP--WKEDWERFELWRTGQTGFPLVDANMRELAATGFMSNRGRQNVASFLTKNLGIHWHM
PHR_SALTY       LKHQPFIRWTKRVAWQENPHYFQAWQKGETGYPIVDAAMRQLNATGWMHNRLRMITASFLVKDLLIDWRL
PHR_BUCAI       IRSESLVTWEKEIHWINNIKHFNAWKEGNTGFPIIDAGMRQLNELGWMHNRLRMITSSFLVKNLLINWRE
PHR_BUCBP       IQNQSLYHWENRIKWDNNLYYLNLWKQGNTGYPIIDAGMRQLKQLGWISNRLRMITASFLVKNLLIDWRK
PHR_VIBCH       LKSRDFVEWGARLEWWNDNEKFQLWCEGKTGYPIVDAAMRQLNQTGWMHNRLRMIVASFLTKDLHIDWRW
PHR_STRGR       ASWSDYRPRHD--RWRSDADEMHAWKSGLTGYPLVDAAMRQLAHEGWMHNRARMLAASFLTKTLYVDWRE
PHR_NEUCR       -----YVCMNKPIEWSYNVDHFHAWTQGRTGFPIIDAAMRQVLSTGYMHNRLRMIVASFLAKDLLVDWRM
CRYD_SYNY3      LLNKNF-------PWQEDQVRFELWRSGQTGYPLVDANMRELNLTGFMSNRGRQNVASFLCKNLGIDWRW
CRYD_RHOBA      LRGVN-------VDWKSDRELFRRWQDGTTGYPLVDANMRELRTTGYMSNRGRQNVASFLTKNLGIDWRW
PHR_YEAST       -----YTSMGMPIKWENNPVAFEKWCTGNTGIPIVDAIMRKLLYTGYINNRSRMITASFLSKNLLIDWRW
CRYD_IDILO      LFAFSGLSGKSPKTSFYSE-RFQKWCSGNTPYPIVNACMKQLNATGYMSNRGRQLVASCFVHELSLDWRY
PHR_THET8       MAERPLDPRFQAFPWQEDEALFQAWYEGKTGVPLVDAAMRELHATGFLSNRARMNAAQFAVKHLLLPWKR
PHR_THET2       MAERPLDPRFQALPWQEDEALFRAWYEGRTGVPLVDAAMRELHATGFLSNRARMNAAQFAVKHLLLPWKR
CRYD_SOLLC      LLFQAGGPQKVNINWSQDQTMFDAWRRGQTGYPLIDANMKELAATGYMSNRGRQIVCSFLVRDMGIDWRM
CRYD_DANRE      IFYMNGLQ-DKHVPWNTDMKMFDAWKEGRTGVPFVDANMRELALTGFMSNRGRQNVASFLTKDLGLDWRL
CRY2_ARATH      THEQSLLSHLRFFPWDADVDKFKAWRQGRTGYPLVDAGMRELWATGWMHNRIRVIVSSFAVKFLLLPWKW
CRYD_XENLA      LLWRDYFRFDKDIPWKRDPKLFDAWKEGRTGVPFVDANMRELAMTGFMSNRGRQNVASFLTKDLGIDWRM
CRY1_SINAL      THEQSLLSHLRFFPWDADVDKFKAWRQGRTGYPLVDAGMRELWATGWMHNRIRVIVSSFAVKFLLLPWKW
CRYD_ORYSJ      ---------NVESKWSQDQALFESWRDGRTGYPLIDANMKELLATGFMSNRGRQIVCSFLVRDMGIDWRM
CRYD_GIBZE      EEDAEPDQNPTPAQVK---DMIDRWIRGTTGMGLVDASQRELQLTGYTSNRARQNVASYLTKSLGIDWRL
CRY1_ARATH      SHERPLLGHLKFFPWAVDENYFKAWRQGRTGYPLVDAGMRELWATGWLHDRIRVVVSSFFVKVLQLPWRW
CRYD_ARATH      ---------NVQGKWSQDQKLFESWRDAKTGYPLIDANMKELSTTGFMSNRGRQIVCSFLVRDMGLDWRM
CRYD_NEUCR      FRVEDYEGEDKKYGWRTANEILARFNAGTTGMGLIDASQRELIHTGYTSNRTRQNVASFLAKHLEIDWRY
CRY1_AEDAE      YAEMEANPICLNIPWEPKDDSLDRWKEGRTGFPMIDAAMRQLLAEGWLHHILRNITATFLTRGALISWEA
CRY1_SYLBO      FDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRDLWISWEE
CRY1_ERIRU      FDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRDLWISWEE
CRY1_CHICK      FDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRDLWISWEE
CRY1_RAT        FDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRDLWISWEE
CRY1_MOUSE      FDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRDLWISWEE
CRY1_HUMAN      FDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRDLWISWEE
CRY1_DROME      YDRMEGNDICLSIPWAKPNENLQSWRLGQTGFPLIDGAMRQLLAEGWLHHTLRNTVATFLTRGLWQSWEH
CRY1_MACFA      FDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRDLWISWEE
CRY1_SPAJD      FDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTSDLWISWEE
CRY1_CULQU      YAVMELNPICLNIPWYEADDSLDRWKEGRTGFPLIDAAMRQLMAEGWLHHILRNITATFLTRGLWISWEA
CRY2_VIBCH      FESECEMEFRCSLLQQSSDAQLAAWQTGHTGIPLVDACMRCLIQTGYLNFRMRAMLVSVLTHHMNVDWRA
CRY2_RAT        FDRMEGNPICIQIPWDRNPEALAKWAEGKTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRDLWVSWES
CRY2_MOUSE      FDRMEGNPICIQIPWDRNPEALAKWAEGKTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRDLWVSWES
CRYD_OSTTA      IFHLDGTA-GRRASWKRDEKILKAWKTGTTGYPLIDANMRELAATGFMSNRGRQNVASWLALDAGIDWRH
CRYD_VIBCH      LFRFSGIGEKKPLTSFYAQ-RFLQWKHGETPFPIVNACMRQLNQTGYMSNRGRQLVASCLVHELGLDWRY
CRY1_DROPS      YDRMEGNEICLTIPWAKPDENLQRWRLGQTGFPLIDGAMRQLLAEGWLHHTLRNTVATFLTRGLWQSWEP
CRY2_CHICK      FDRMEGNPICIQIPWDKNPEALAKWAEGKTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRDLWISWES
CRY2_HUMAN      FDRMEGNPICIQIPWDRNPEALAKWAEGKTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRDLWVSWES
CRY1_ANOGA      YGEMERNPICLNIPWYKEDDSLTRWKEGRTGFPMIDAAMRQLLAEGWLHHILRNITATFLTRGLWLSWEE
CRYD_VIBPA      LFRFGGIRNQPPLTSFYAH-RFQQWKNGTTPYPIVNACMHQLNHTGYMSNRGRQLVASCLVHELGLDWRY
YAT1_SYNP1      ----------------------------------------------------------------------
PHR2_ARATH      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           GERHFADRLVDYDPANNAANWQWTASTGTDTVAVRIFDPVSQMAKYDSDAAFVTEYVPELRGVDPETIVD
PHR_HALSA       GYDWFREKLADHDTANDNGGWQWAASTGTDAQPFRVFNPMTQGERYDPDADYITEFVPELRDVPADAIHS
PHR_SYNP6       GEQFFMQHLVDGDLAANNGGWQWSASSGMDPKPLRIFNPASQAKKFDATATYIKRWLPELRHVHPKDLIS
PHR_SYNY3       GELYFMQTLYDGDLAANNGGWQWSASSGMDPKPLRIFNPHTQAQKFDPEGEYIRTWLPQLARFDTGDLL-
PHR_ECOLI       GERYFMSQLIDGDLAANNGGWQWAASTGTDAAPFRIFNPTTQGEKFDHEGEFIRQWLPELRDV-PGKVVH
CRYD_NATPD      GAAYFEARLIDYDVASNWGNWAYQAGVGNDS-RDRYFDVRSQAERYDSDAEYITTWLPELAAL-PATIAP
PHR_BACPF       GERYFERMLIDYDPSSNIGGWQWAASVGTDAVPFRIFNPVTQSKRFDENGTYIRTYIPELNHVPDHYIHE
CRYD_GLOVI      GAEWFESRLIDYDVASNWGNWNYTAGVGNDARGFRFFNILKQARDYDPDGAYVKHWLPELAGLPPARVHE
PHR_SALTY       GERYFMSQLIDGDLAANNGGWQWAASTGTDAAPFRIFNPTTQGERFDRDGEFIRQWLPALRDIPGKAIHE
PHR_BUCAI       GEEHFISNLIDGDLALNNGGWQWSASVGCDSVPIRIFNPLHQSKTFDESGNFIKKFIPELKNV-PNHHIH
PHR_BUCBP       GEEYFMSQLIDGDFASNNGNWQWIASVGTDSMPFRIFNPMLQSKKFDINAKFIRKYIPELSNVSTYNIHN
PHR_VIBCH       GERYFMSRLIDGDYAANNGGWQWCASTGCDQPYFRIFNPVSQGEKFDPNGDFIRRWVPELRSV-------
PHR_STRGR       GARHFLDLLVDGDVANNQLNWQWVAGTGTDTRPNRVLNPVIQGKRFDARGDYVRGWVPELAEVEGSAIHE
PHR_NEUCR       GERYFMEHLIDGDFASNNGGWGFAASVGVDPQPFRVFNPLLQSEKFDPDGDYIRKWVPELKGGKGGEIHD
CRYD_SYNY3      GAEWFESCLIDYDVCSNWGNWNYTAGIGNDARDFRYFNIPKQSQQYDPQGTYLRHWLPELKNLPGDKIQP
CRYD_RHOBA      GARWFESQLVDYDVASNYGNWNYAAGVGNDARGFRFFNITKQSRDYDSQGEYAKHWLPELRDLDVTEIHE
PHR_YEAST       GERWFMKHLIDGDSSSNVGGWGFCSSTGIDAQPFRVFNMDIQAKKYDPQMIFVKQWVPEL----------
CRYD_IDILO      GAAYFEQQLIDYDVSSNWGNWQYLAGVGADPRGHRQFNLEKQTERYDPDNEFIERWAGDLSGIDSVDAAD
PHR_THET8       CEEAFRHLLLDGDRAVNLQGWQWAGGLGVDAAPFRVFNPVLQGERHDPEGRWLKRWAPEYPSYAPK----
PHR_THET2       CEEAFRHLLLDGDRAVNLQGWQWAGGLGVDAAPFRVFNPVLQGERHDPEGRWLKRWAPEYPSYAPK----
CRYD_SOLLC      GAEWFETCLLDYDPCSNYGNWTYGAGVGNDPREDRYFSIPKQAQNYDPEGEFVAYWLPELRALPREK---
CRYD_DANRE      GAEWFEYLLVDHDVCSNYGNWLYSAGIGNDPRENRKFNMIKQGLDYDNNGDYVRQWVPELRGI-------
CRY2_ARATH      GMKYFWDTLLDADLECDILGWQYISGSIPDGHELRLDNPALQGAKYDPEGEYIRQWLPELARLPTEWIWD
CRYD_XENLA      GAEWFEYLLVDYDVCSNYGNWLYSAGIGNDPRENRKFNMIKQGLDYDSGGDYIRLWVPELQQI-------
CRY1_SINAL      GMKYFWDTLLDADLECDIIGWQYISGSLPDGHELRLDNPAIQGAKYDPEGEYIRQWLPELARLPTEWIWD
CRYD_ORYSJ      GAEWFETCLLDYDPASNYGNWTYGAGVGNDPREDRYFSIPKQAKTYDPDGEYVAYWLPELRSIAKE----
CRYD_GIBZE      GAEYYEQSLIDYDTHSNWGNWQYQASCGNDPRS-RSFNQVKQAFDYDQDGRFTRTWVNEVKSID------
CRY1_ARATH      GMKYFWDTLLDADLESDALGWQYITGTLPDSREFRIDNPQFEGYKFDPNGEYVRRWLPELSRLPTDWIHP
CRYD_ARATH      GAEWFETCLLDYDPCSNYGNWTYGAGVGNDPREDRYFSIPKQAQNYDPEGEYVAFWLQQLRRL-PKEKRH
CRYD_NEUCR      GAEWYEMLLVDYDVSSNWANWQYVAGVGNDRGAARIFNPVKQAFDYDKDGTYVRTWVPEV----------
CRY1_AEDAE      GVQHFLKYLLDADWSVCAGNWMWVSSSAFEKLSSSCTSPIALARRLDPKGEYVRRYLPELKNLPTLYVHE
CRY1_SYLBO      GMKVFEELLLDADWSVNAGSWMWLSCXXXXXXXXHCYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYD
CRY1_ERIRU      GMKVFEELLLDADWSVNAGSWMWLSCXXXXXXXXHCYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYD
CRY1_CHICK      GMKVFEELLLDADWSVNAGSWMWLSCXXXXXXXXHCYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYD
CRY1_RAT        GMKVFEELLLDADWSINAGSWMWLSCXXXXXXXXHCYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYD
CRY1_MOUSE      GMKVFEELLLDADWSINAGSWMWLSCXXXXXXXXHCYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYD
CRY1_HUMAN      GMKVFEELLLDADWSINAGSWMWLSCXXXXXXXXHCYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYD
CRY1_DROME      GLQHFLKYLLDADWSVCAGNWMWVSSSAFERLSSLVTCPVALAKRLDPDGTYIKQYVPELMNVPKEFVHE
CRY1_MACFA      GMKVFEELLLDADWSINAGSWMWLSCXXXXXXXXHCYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYD
CRY1_SPAJD      GMKVFEELLLDADWSINAGSWMWLSCXXXXXXXXHCYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYD
CRY1_CULQU      GVQHFLKYLLDADWSVCAGNWMWVSSSAFEKLSSSCTSPVALARRLDPKGEYVKRYLPELEKFPALYVHE
CRY2_VIBCH      GVTYLAQLFLDFEPGIHYPQFQMQAGTGTNT--IRIYNPTKQAQEHDSEGQFIHKWVPELAQVPPLLFEP
CRY2_RAT        GVRVFDELLLDADFSVNAGSWMWLSCSAFFQQFFHCYCPVGFGRRTDPSGDYIRRYLPKLKGFPSRYIYE
CRY2_MOUSE      GVRVFDELLLDADFSVNAGSWMWLSCSAFFQQFFHCYCPVGFGRRTDPSGDYIRRYLPKLKGFPSRYIYE
CRYD_OSTTA      GADWFEHHLLDYDTASNWGN--WCAAAGMTGGRINRFNIAKQTKDYDPAGEYIKTWVKELAEVPAAYIAD
CRYD_VIBCH      GAAYFETQLVDYDVGSNWGNWQYLAGVGADPRGSRQFNLEKQAHTYDPKGEFVAKWALENLALDSVDMVD
CRY1_DROPS      GLKHFLKYLLDADWSVCAGNWMWVSSSAFERLSSLVTCPVALAKRLDPEGVYIRRYVPELKNLPKEYIHE
CRY2_CHICK      GVRVFDELLLDADFSVNAGSWMWLSCSAFFQQFFHCYCPVGFGRRTDPSGDYVKRYLPKLKGFPSRYIYE
CRY2_HUMAN      GVRVFDELLLDADFSVNAGSWMWLSCSAFFQQFFHCYCPVGFGRRTDPSGDYIRRYLPKLKAFPSRYIYE
CRY1_ANOGA      GLQHFLKYLLDADWSVCAGNWMWVSSSAFERLSSKCTCPIALARRLDPKGDYVKRYLPELANYPAQFVHE
CRYD_VIBPA      GAAYFETQLIDYDVGSNWGNWQYLAGVGADPRGSRQFNLEKQTQMYDPNHEFIERWQGRDSRAQQDVVVG
YAT1_SYNP1      ----------------------------------------------------------------------
PHR2_ARATH      ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           WPTLRHSQRERLAPDYHHPIVDRDHAYERAQRVFEAALDGDx
PHR_HALSA       WHELSLSERRRHAPEYPDPIVDHSQRREDAIAMFERA-----
PHR_SYNP6       GEITPIGRRGYPAPIVNH------------------------
PHR_SYNY3       --TGKLTPGSRRSVNYPEPIVDHNQQQREFKRRYQ-------
PHR_ECOLI       EP-WKWAQKAGVTLDYPQPIVEHKEARVQTLAAYEAARKG--
CRYD_NATPD      WQLSEAEQREELGVDYPEPVVDIDARYQ--------------
PHR_BACPF       WKMSEEEQKCRLDEDYPLPIVDHSKQRKKALSFFK-------
CRYD_GLOVI      WKLLPVEQKRRLGVDYPQPVVD--------------------
PHR_SALTY       W---RWAEKAGVVLDYPRPIVEHKQARIATLSAYEAARKG--
PHR_BUCAI       QPH-EWSKQKNFKIDYPNPIINYSESRKTSLSLFKQA-----
PHR_BUCBP       --PCDNNKTNKIHSKYPQPIINYYHSKKKTLLVFKHA-----
PHR_VIBCH       ------------------------------------------
PHR_STRGR       PWKLQGLDRAGL--DYPDPVVD--------------------
PHR_NEUCR       -PYGRGSEKVKKKLEYPRPIVEHSGARDRALDAYKRGLARD-
CRYD_SYNY3      WLLSATEQKQQLGVDYPRPCVNFHQSVEARRKI---------
CRYD_RHOBA      WKMSPERQQETLGKEYPHPIVD--------------------
PHR_YEAST       -----ISSENKRPENYPKPLVDLKHSRERALKVYKDAM----
CRYD_IDILO      WP----------------------------------------
PHR_THET8       ------------------------------------------
PHR_THET2       ------------------------------------------
CRYD_SOLLC      ----RHSP----GMMYLNPIVALKHGYTK-------------
CRYD_DANRE      ------------------------------------------
CRY2_ARATH      APTVLKASGVELGTNYAKPIVDIDTARE--------------
CRYD_XENLA      ------------------------------------------
CRY1_SINAL      APTVLKASGVELGTNYAKPIVVIDTARE--------------
CRYD_ORYSJ      ------------------------------------------
CRYD_GIBZE      ------------------------------------------
CRY1_ARATH      WESVLQAAGIELGSNYPLPIVGLDEAKAR-------------
CRYD_ARATH      WP----------------------------------------
CRYD_NEUCR      ------------------------------------------
CRY1_AEDAE      WKAPLDVQKEIVGRDYPAPMID--------------------
CRY1_SYLBO      WESIQKAAKCIIGVNYPKPMVNHAEAIERMKQIYQ-------
CRY1_ERIRU      WESIQKAAKCIIGVNYPKPMVNHAEAIERMKQIYQ-------
CRY1_CHICK      WNAPESVQKAAIGVNYPKPMVNHAEAIERMKQIYQ-------
CRY1_RAT        WNAPEGIQKVAIGVNYPKPMVNHAEAIERMKQIYQ-------
CRY1_MOUSE      WNAPEGIQKVAIGVNYPKPMVNHAEAIERMKQIYQ-------
CRY1_HUMAN      WNAPEGIQKVAIGVNYPKPMVNHAEAIERMKQIYQ-------
CRY1_DROME      PWRMSAEQQEQIGVHYPERIIDLSMAVKR-------------
CRY1_MACFA      WNAPEGIQKVAIGINYPKPMVNHAEAIERMKQIYQ-------
CRY1_SPAJD      WNAPEGIQKVAIGVNYPKPMVNHAEAIERMKQIYQ-------
CRY1_CULQU      WPELQEQYGCVIGKDYPAPMVN--------------------
CRY2_VIBCH      WPLEAQMYQVPLESPYLKPVMDLEASAKQAR-----------
CRY2_RAT        WNAPESVQKAAIGVDYPRPIVNHAETIERMKQIYQ-------
CRY2_MOUSE      WNAPESVQKAAIGVDYPRPIVNHAETIERMKQIYQ-------
CRYD_OSTTA      PNQAPRELRDRIGLNY--------------------------
CRYD_VIBCH      WP----------------------------------------
CRY1_DROPS      PWRLSAEQQVKIGVHYPERIIDLSKAVKR-------------
CRY2_CHICK      WNAPESVQKAAIGVDYPKPMVNHAETIERMKQIYQ-------
CRY2_HUMAN      WESIQKAAKCIIGVDYPRPIVNHAETIERMKQIYQ-------
CRY1_ANOGA      WKASREQQIEYIGEKYPAPMVD--------------------
CRYD_VIBPA      WP----------------------------------------
YAT1_SYNP1      ------------------------------------------
PHR2_ARATH      ------------------------------------------