[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for halo0:AAG19982.1

[Show Plain Result]


## Summary of Sequence Search
    1::536
   33::504     2e-54  31%  517 aa  CRTJ_MYXXA RecName: Full=Phytoene dehydrogenase;       
   33::512     2e-50  29%  595 aa  CRTI_NEUCR RecName: Full=Phytoene dehydrogenase;       
   29::489     4e-46  30%  502 aa  CRTP_STAHJ RecName: Full=4,4'-diaponeurosporene oxidase;       
   26::497     7e-46  28%  502 aa  CRTN_STAAW RecName: Full=Dehydrosqualene desaturase;       
   26::497     7e-46  28%  502 aa  CRTN_STAAS RecName: Full=Dehydrosqualene desaturase;       
   26::497     7e-46  28%  502 aa  CRTN_STAAR RecName: Full=Dehydrosqualene desaturase;       
   26::497     7e-46  28%  502 aa  CRTN_STAAN RecName: Full=Dehydrosqualene desaturase;       
   26::497     7e-46  28%  502 aa  CRTN_STAAM RecName: Full=Dehydrosqualene desaturase;       
   26::497     7e-46  28%  502 aa  CRTN_STAAE RecName: Full=Dehydrosqualene desaturase;       
   26::497     7e-46  28%  502 aa  CRTN_STAA8 RecName: Full=Dehydrosqualene desaturase;       
   26::497     7e-46  28%  502 aa  CRTN_STAA3 RecName: Full=Dehydrosqualene desaturase;       
   26::497     4e-45  27%  502 aa  CRTN_STAAB RecName: Full=Dehydrosqualene desaturase;       
   26::497     6e-45  27%  502 aa  CRTN_STAAC RecName: Full=Dehydrosqualene desaturase;       
   33::563     6e-45  30%  621 aa  CRTI_CERNC RecName: Full=Phytoene dehydrogenase;       
   27::488     3e-44  31%  497 aa  CRTP_STAAE RecName: Full=4,4'-diaponeurosporene oxidase;       
   27::488     3e-44  31%  497 aa  CRTP_STAAC RecName: Full=4,4'-diaponeurosporene oxidase;       
   27::488     3e-44  31%  497 aa  CRTP_STAA8 RecName: Full=4,4'-diaponeurosporene oxidase;       
   27::488     3e-44  31%  497 aa  CRTP_STAA3 RecName: Full=4,4'-diaponeurosporene oxidase;       
   27::488     5e-44  31%  497 aa  CRTP_STAAN RecName: Full=4,4'-diaponeurosporene oxidase;       
   27::488     5e-44  31%  497 aa  CRTP_STAAM RecName: Full=4,4'-diaponeurosporene oxidase;       
   27::488     9e-44  31%  497 aa  CRTP_STAAW RecName: Full=4,4'-diaponeurosporene oxidase;       
   27::488     9e-44  31%  497 aa  CRTP_STAAS RecName: Full=4,4'-diaponeurosporene oxidase;       
   27::488     4e-43  32%  497 aa  CRTP_STAAR RecName: Full=4,4'-diaponeurosporene oxidase;       
   30::501     4e-43  29%  583 aa  CRTI_PHYBL RecName: Full=Phytoene dehydrogenase;       
   27::488     6e-43  31%  497 aa  CRTP_STAAB RecName: Full=4,4'-diaponeurosporene oxidase;       
   26::496     7e-39  26%  501 aa  CRTN_STAHJ RecName: Full=Dehydrosqualene desaturase;       
   29::490     3e-36  26%  492 aa  CRTI_ESCVU RecName: Full=Phytoene dehydrogenase;       
   27::490     5e-36  25%  492 aa  CRTI_PANAN RecName: Full=Phytoene dehydrogenase;       
   34::501     3e-35  25%  524 aa  CRTI_RHOCA RecName: Full=Phytoene dehydrogenase;       
   33::497     1e-31  25%  501 aa  CRTI_PARSN RecName: Full=Phytoene dehydrogenase;       
   35::452     1e-26  26%  507 aa  CRTI_STRGR RecName: Full=Phytoene dehydrogenase;       
   36::497     3e-25  25%  518 aa  CRTI_RHOS4 RecName: Full=Phytoene dehydrogenase;       
   34::486     7e-22  24%  529 aa  CRTI_MYXXA RecName: Full=Phytoene dehydrogenase;       
   30::493     6e-18  26%  494 aa  CRTD_RHOCA RecName: Full=Methoxyneurosporene dehydrogenase;        
  198::489     2e-10  25%  495 aa  CRTD_RHOS4 RecName: Full=Methoxyneurosporene dehydrogenase;        
  301::580     5e-09  29%  615 aa  CRTSO_SOLLC RecName: Full=Carotenoid isomerase, chloroplastic;     
  331::580     1e-06  33%  615 aa  CRTSO_DAUCA RecName: Full=Carotenoid isomerase, chloroplastic;     
  388::560     5e-05  30%  595 aa  CRTSO_ARATH RecName: Full=Carotenoid isomerase, chloroplastic;     
  380::552     5e-05  28%  587 aa  CRTS2_ONCHC RecName: Full=Carotenoid isomerase 2, chloroplastic;   
  380::552     5e-05  28%  587 aa  CRTS1_ONCHC RecName: Full=Carotenoid isomerase 1, chloroplastic;   
  254::561     2e-04  30%  580 aa  PYRD2_MOUSE RecName: Full=Pyridine nucleotide-disulfide
    1::536

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxSVTLLEQHDTVGGRAGVLER
CRTJ_MYXXA      ---------------------------------------------------VQVFEKTQGPGGRCNRLQV
CRTI_NEUCR      ---------------------------------------------------VTVLEKNDFTGGRCSLIHK
CRTP_STAHJ      ---------------------------------------------------VSLYDKNNHIGGKVNRLET
CRTN_STAAW      ---------------------------------------------------VTIFEKNNNVGGRMNQLKK
CRTN_STAAS      ---------------------------------------------------VTIFEKNNNVGGRMNQLKK
CRTN_STAAR      ---------------------------------------------------VTIFEKNNNVGGRMNQLKK
CRTN_STAAN      ---------------------------------------------------VTIFEKNNNVGGRMNQLKK
CRTN_STAAM      ---------------------------------------------------VTIFEKNNNVGGRMNQLKK
CRTN_STAAE      ---------------------------------------------------VTIFEKNNNVGGRMNQLKK
CRTN_STAA8      ---------------------------------------------------VTIFEKNNNVGGRMNQLKK
CRTN_STAA3      ---------------------------------------------------VTIFEKNNNVGGRMNQLKK
CRTN_STAAB      ---------------------------------------------------VTIFEKNTNVGGRMNQLKK
CRTN_STAAC      ---------------------------------------------------VTIFEKNNNVGGCMNQLKK
CRTI_CERNC      ---------------------------------------------------VTVLEKNNFTGGRCSLIHH
CRTP_STAAE      --------------------------------------------------SVSLYEQNNHIGGKVNRHES
CRTP_STAAC      --------------------------------------------------SVSLYEQNNHIGGKVNRHES
CRTP_STAA8      --------------------------------------------------SVSLYEQNNHIGGKVNRHES
CRTP_STAA3      --------------------------------------------------SVSLYEQNNHIGGKVNRHES
CRTP_STAAN      --------------------------------------------------SVSLYEQNTHIGGKVNRHES
CRTP_STAAM      --------------------------------------------------SVSLYEQNTHIGGKVNRHES
CRTP_STAAW      --------------------------------------------------SVSLYEQNNHIGGKVNRHES
CRTP_STAAS      --------------------------------------------------SVSLYEQNNHIGGKVNRHES
CRTP_STAAR      --------------------------------------------------SVSLYEQNNHIGGKVNRHES
CRTI_PHYBL      ---------------------------------------------------VTVVEKNNFGGGRCSLINH
CRTP_STAAB      --------------------------------------------------SVSLYEQNNHIGGKVNRHES
CRTN_STAHJ      ---------------------------------------------------VTIFEKNEQVGGRMSQFKK
CRTI_ESCVU      -----------------------------------------------------LLEQRDKPGGRAYVWHD
CRTI_PANAN      ---------------------------------------------------VLLLEQRDKPGGRAYVYED
CRTI_RHOCA      ---------------------------------------------------VTVVDRLDRPGGRGSSITK
CRTI_PARSN      --------------------------------------------------ATTLVEARDKPGGRAYVWHD
CRTI_STRGR      ----------------------------------------------------TVVEREDVPGGRAGLLES
CRTI_RHOS4      ---------------------------------------------------VTVIDKLDVPGGRGSSITQ
CRTI_MYXXA      ---------------------------------------------------VTVVEKDAVPGGRMKGLTL
CRTD_RHOCA      ---------------------------------------------------VTVVEAGDAPGGKARAVXX
CRTD_RHOS4      ----------------------------------------------------------------------
CRTSO_SOLLC     ----------------------------------------------------------------------
CRTSO_DAUCA     ----------------------------------------------------------------------
CRTSO_ARATH     ----------------------------------------------------------------------
CRTS2_ONCHC     ----------------------------------------------------------------------
CRTS1_ONCHC     ----------------------------------------------------------------------
PYRD2_MOUSE     ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           DGFRFDTGPSWYLMPDVFERXXXXXXXXXXXXYELTRLDPQYRVFWTDGDSATIEPNRRNAHELFESYEE
CRTJ_MYXXA      DGFTWDLGPTIVLMPEVFEETFRAVGRRIEDYLTLLRCDPNYRVHFRDRSDVTFTSELCAMGRELERVEP
CRTI_NEUCR      AGYRFDQGPSLLLLPGLFETFEDLGTTLEQEDVELLQCFPNYNIWFSDGKR--FSPTTDNATMKVEIEKW
CRTP_STAHJ      EGFGFDLGPSILTMPYIFENLFNYSDKQMKDYVTIERLPLQWRSFFTNG-------------EVIDLYED
CRTN_STAAW      DGFTFDMGPTIVMMPDVYKDVFTACGKNYEDYIELRQLRYIYDVYFDHDDRITVPTDLAELQQMLESIEP
CRTN_STAAS      DGFTFDMGPTIVMMPDVYKDVFTACGKNYEDYIELRQLRYIYDVYFDHDDRITVPTDLAELQQMLESIEP
CRTN_STAAR      DGFTFDMGPAIVMMPDVYKDVFTMCGKNYEDYIELRQLRYIYDVYFDRDDCITVPTDLAELQHMLESIEP
CRTN_STAAN      DGFTFDMGPTIVMMPDVYKDVFTACGKNYEDYIELRQLRYIYDVYFDHDDRITVPTDLAELQQMLESIEP
CRTN_STAAM      DGFTFDMGPTIVMMPDVYKDVFTACGKNYEDYIELRQLRYIYDVYFDHDDRITVPTDLAELQQMLESIEP
CRTN_STAAE      DGFTFDMGPTIVMMPDVYKDVFTACGKNYEDYIELRQLRYIYDVYFDHDDRITVPTDLAELQQMLESIEP
CRTN_STAA8      DGFTFDMGPTIVMMPDVYKDVFTACGKNYEDYIELRQLRYIYDVYFDHDDRITVPTDLAELQQMLESIEP
CRTN_STAA3      DGFTFDMGPTIVMMPDVYKDVFTACGKNYEDYIELRQLRYIYDVYFDHDDRITVPTDLAELQQMLESIEP
CRTN_STAAB      DGFTFDMGPTIVMMPDVYKDVFTMCGKNYEDYIELRQLRYIYDVYFDRDDRITVPTDLAELQHMLESIEP
CRTN_STAAC      DGFTFDMGPTIVMMPDVYKDVFTACGKNYEDYIELRQLRYIYDVYFDHDDRITVPTDLAELQQMLESIEP
CRTI_CERNC      EGYRFDQGPSLLLLPGLFHRTFAELGTSLEQEVKLLKCEPNYMIHFSDGEKFTLSSDLSVMKTEVEKWEG
CRTP_STAAE      DGFGFDLGPSILTMPYIFEKLFEYSKKQMSDYVTIKRLPHQWRSFFPDGTTI----------DLYEGIKE
CRTP_STAAC      DGFGFDLGPSILTMPYIFEKLFEYSKKQMSDYVTIKRLPHQWRSFFPDGTTI----------DLYEGIKE
CRTP_STAA8      DGFGFDLGPSILTMPYIFEKLFEYSKKQMSDYVTIKRLPHQWRSFFPDGTTI----------DLYEGIKE
CRTP_STAA3      DGFGFDLGPSILTMPYIFEKLFEYSKKQMSDYVTIKRLPHQWRSFFPDGTTI----------DLYEGIKE
CRTP_STAAN      DGFGFDLGPSILTMPYIFEKLFEYSKKQMSDYVTIKRLPHQWRSFFPDGTTI----------DLYEGIKE
CRTP_STAAM      DGFGFDLGPSILTMPYIFEKLFEYSKKQMSDYVTIKRLPHQWRSFFPDGTTI----------DLYEGIKE
CRTP_STAAW      DGFGFDLGPSILTMPYIFEKLFEYSKKQMSDYVTIKRLPHQWRSFFPDGTTI----------DLYEGIKE
CRTP_STAAS      DGFGFDLGPSILTMPYIFEKLFEYSKKQMSDYVTIKRLPHQWRSFFPDGTTI----------DLYEGIKE
CRTP_STAAR      DDFGFDLGPSILTMPYIFEKLFEYSKKQMSDYVTIKRLPHQWRSFFPDGTTI----------DLYEGIKE
CRTI_PHYBL      NGHRFDQGPSLYLMPKLFEEAFEALDEKIEDHVELLRCHNNYKVHFDDGDKIQLSSDLSRMKPEMERIE-
CRTP_STAAB      DGFGFDLGPSILTMPYIFEKLFEYSKKQMSDYVTIKRLPHQWRSFFPDGTTI----------DLYEGIKE
CRTN_STAHJ      DGFTFDMGPTIVMVPDVYKAVFEESGKRFEDYVDMKPLTHIFDIYFSDKDKVSVSTDLAQLSQTLEATEP
CRTI_ESCVU      QGFTFDAGPTVITDPTALEALFTLAGRRMEDYVRLLPVKPFYRLCWESGKTLDYANDSAELEAQITQFNP
CRTI_PANAN      QGFTFDAGPTVITDPSAIEELFALAGKQLKEYVELLPVTPFYRLCWESGKVFNYDNDQTRLEAQIQQFNP
CRTI_RHOCA      GGHRFDLGPTIVTVPDRLRELWADCGRDFDKDVSLVPMEPFYTIDFPDGEKYTAYGDDAKVKAEVARISP
CRTI_PARSN      QGHLFDAGPTVITDPDALKELWALTGQDMARDVTLMPVSPFYRLMWPGGK---VFDYVNEADQLERQIAQ
CRTI_STRGR      GGFRIDTGPTVLTMPDLVEDAFAAVGERMADRLELIRLAPAYRARFADGSQLDVHTDMEAAVEEFAGARQ
CRTI_RHOS4      EGHRFDLGPTIVTVPQSLRDLWKTCGRDFDADVELKPIDPFYEVRWPDGSHFTVRQSTEAMKAEVARLSP
CRTI_MYXXA      GAYAVDTGPSILQLPGVLEQIFRRAARRLEDYVKLLPLDVNTRVHFWDGTHLDTTRHLDRMEAELAKFGP
CRTD_RHOCA      XXXXXXXXXXVLTMRHVLDALFAACGTRAEEHLTLIPLPRLARHFWPDGSSLDLFTDTEANIEAIRAFAG
CRTD_RHOS4      ----------------------------------------------------------------------
CRTSO_SOLLC     ----------------------------------------------------------------------
CRTSO_DAUCA     ----------------------------------------------------------------------
CRTSO_ARATH     ----------------------------------------------------------------------
CRTS2_ONCHC     ----------------------------------------------------------------------
CRTS1_ONCHC     ----------------------------------------------------------------------
PYRD2_MOUSE     ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           GAGDALATYLDRAATNYDLAMNRVVYPDRTAFRDYASTDMLPLASRLRLFGNMDDYVSRFFDHPKLRQLL
CRTJ_MYXXA      GSYARYLAFLAQGRVQYRTSLDHLVGRNYAGLRDYLSPRVLARIFQVRAHRRMYADVSRFFQDERLRAAM
CRTI_NEUCR      EGPDGFRRYLSWLAEHYETSLRHVLHRNFKSILELADPRLVTLLMALHPFESIWHRAGRYFKTDRMQRVF
CRTP_STAHJ      LSQMLNATYLTNQFLNYAEKIHRFTEKGYFALGLDKVSEIIKYQGLLRYFSTMQQAINRYIEKQKLRDML
CRTN_STAAW      GSTHGFMSFLTDVYKKYEIA--RRYFLERTYRKDFYNMTSLVQGAKLKTLNHADQLIEHYIDNEKIQKLL
CRTN_STAAS      GSTHGFMSFLTDVYKKYEIA--RRYFLERTYRKDFYNMTSLVQGAKLKTLNHADQLIEHYIDNEKIQKLL
CRTN_STAAR      GSTHGFMSFLTDVYKKYEIA--RRYFLERTYRKDFYNMTSLVQGAKLKTLNHADQLIEHYIDNEKIQKLL
CRTN_STAAN      GSTHGFMSFLTDVYKKYEIA--RRYFLERTYRKDFYNMTSLVQGAKLKTLNHADQLIEHYIDNEKIQKLL
CRTN_STAAM      GSTHGFMSFLTDVYKKYEIA--RRYFLERTYRKDFYNMTSLVQGAKLKTLNHADQLIEHYIDNEKIQKLL
CRTN_STAAE      GSTHGFMSFLTDVYKKYEIA--RRYFLERTYRKDFYNMTSLVQGAKLKTLNHADQLIEHYIDNEKIQKLL
CRTN_STAA8      GSTHGFMSFLTDVYKKYEIA--RRYFLERTYRKDFYNMTSLVQGAKLKTLNHADQLIEHYIDNEKIQKLL
CRTN_STAA3      GSTHGFMSFLTDVYKKYEIA--RRYFLERTYRKDFYNMTSLVQGAKLKTLNHADQLIEHYIDNEKIQKLL
CRTN_STAAB      GSTHGFMSFLTDVYKKYEIA--RRYFLERTYRKDFYNMTSLVQGAKLKTLNHADQLIEHYIDNEKIQKLL
CRTN_STAAC      GSTHGFMSFLTDVYKKYEIA--RRYFLERTYRKDFYNMTSLVQGAKLKTLNHADQLIEHYIDNEKIQKLL
CRTI_CERNC      KEGTRYLEFLKESHGHYELSVREVLLRNFEGLTAMLRPEFLRHLLQLHPFESIWTRAGKYFWTERLRRVF
CRTP_STAAE      GQHNAILSKQDIEELQNYLNYTRRI--DRITEKGYFNYGLDTLSQIIKFHGPLNDYVDKRISNPYLRQML
CRTP_STAAC      GQHNAILSKQDIEELQNYLNYTRRI--DRITEKGYFNYGLDTLSQIIKFHGPLNDYVDKRISNPYLRQML
CRTP_STAA8      GQHNAILSKQDIEELQNYLNYTRRI--DRITEKGYFNYGLDTLSQIIKFHGPLNDYVDKRISNPYLRQML
CRTP_STAA3      GQHNAILSKQDIEELQNYLNYTRRI--DRITEKGYFNYGLDTLSQIIKFHGPLNDYVDKRISNPYLRQML
CRTP_STAAN      GQHNAILSKQDIEELQNYLNYTRRI--DRITEKGYFNYGLDTLSQIIKFHGPLNDYVDKRISNPYLRQML
CRTP_STAAM      GQHNAILSKQDIEELQNYLNYTRRI--DRITEKGYFNYGLDTLSQIIKFHGPLNDYVDKRISNPYLRQML
CRTP_STAAW      GQHNAILSKQDIEELQNYLNYTRRI--DRITEKGYFNYGLDTLSQIIKFHGPLNDYVDKRISNPYLRQML
CRTP_STAAS      GQHNAILSKQDIEELQNYLNYTRRI--DRITEKGYFNYGLDTLSQIIKFHGPLNDYVDKRISNPYLRQML
CRTP_STAAR      GQHNAILSKQDIEELQNYLNYTRRI--DRITEKGYFNYGLDTLSQIIKFHGPLNDYVDKRISNPYLRQML
CRTI_PHYBL      -GPDGFLRFLDESHTHYEGGVEMAIKQNFETIWKLIRLQYVPALFRLHIFDFVYSRAAKYFKTKKMRMAF
CRTP_STAAB      GQHNAILSKKDIEELQNYLNYTRRI--DRITEKGYFNYGLDTLSQIIKFHGPLNDYVDKRISNPYLRQML
CRTN_STAHJ      GSTQGFMQFLTDVYKRYEVA--RKYFLERT-FREFYNPLTLYRGLKLKTFNNANQLIDNYVSNEKIRKLL
CRTI_ESCVU      RDVEGYRRFLAYSQAVFQEGYLRLGSVPFLSFRDMLRAG--PQLLKLQAWQSVYQSVSRFIEDEHLRQAF
CRTI_PANAN      RDVEGYRQFLDYSRAVFKEGYLKLGTVPFLSFRDMLRA--APQLAKLQAWRSVYSKVASYIEDEHLRQAF
CRTI_RHOCA      GDVEGFRHFMWDAKARYEFGYENLGRKPMSKLWDLIK--VLPTFGWLRADRSVYGHAKKMVKDDHLRFAL
CRTI_PARSN      FNPDDLEGY--RRFRDYAEEVYQEGYVKLGTVPFLKLGQMLPALMKLEAYKSVHAKVATFIKDPYLRQAF
CRTI_STRGR      AVGRRLRIWLERL---YRVQMRRFIDTNFDSPLQLAHPDLARLAA-LGGFGRLDARIGHFVSDERLRRVF
CRTI_RHOS4      GDVAGYEKFLKDSEKRYWFG-----YEDRSMHKLWDLIKVLPTFGMMRADRSVYQHAALRVKDERLRMAL
CRTI_MYXXA      RQASALRQWMEDGREKYGIAYQKFICTSADNLGYYAPWRLAPTL-RFKPWQTLYRQLDGFFHDDRVTYAL
CRTD_RHOCA      DKEAAAFRRFDHLTTGLWEAFHRSVIPKPDLWRIAAATVTRPLWPALRPGLTMRDLLAHHFKDPRLAQLF
CRTD_RHOS4      ----------------------------------------------------------------------
CRTSO_SOLLC     ----------------------------------------------------------------------
CRTSO_DAUCA     ----------------------------------------------------------------------
CRTSO_ARATH     ----------------------------------------------------------------------
CRTS2_ONCHC     ----------------------------------------------------------------------
CRTS1_ONCHC     ----------------------------------------------------------------------
PYRD2_MOUSE     ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           EYTLVFLGGAPHNTPALYSIMSHVDLNGNVFYPEGGIAGVVDALAELAVEQGATIETGVGVNAISGRRGE
CRTJ_MYXXA      TFQTMYLGVSPYASPAVYGLLPFTELGVGIWFPKGGLYAIPQALERLAREEGVRFHYGAPVERIDGGRTR
CRTI_NEUCR      TFATMYMGMSPFDAPATYSLLQYSELAEGIWYPRGGFHKVLDALVKIGERMGVKYRLNTGVSQVGGKNGK
CRTP_STAHJ      GYFIKYVGSSSYDAPAVLTLLIHMQYEQGLWYVKGGIHKLAQALEQLAIEEGVAIHTGMDVCSIDTYFNH
CRTN_STAAW      AFQTLYIGIDPKRGPSLYSIIPMIEMMFGVHFIKGGMYGMAQGLAQLNKDLGVNIELNAEIEQIKFKRAD
CRTN_STAAS      AFQTLYIGIDPKRGPSLYSIIPMIEMMFGVHFIKGGMYGMAQGLAQLNKDLGVNIELNAEIEQIKFKRAD
CRTN_STAAR      AFQTLYIGIDPKRGPSLYSIIPMIEMMFGVHFIKGGMYGMAQGLAQLNKDLGVNIELNAEIEQIKFKRAD
CRTN_STAAN      AFQTLYIGIDPKRGPSLYSIIPMIEMMFGVHFIKGGMYGMAQGLAQLNKDLGVNIELNAEIEQIKFKRAD
CRTN_STAAM      AFQTLYIGIDPKRGPSLYSIIPMIEMMFGVHFIKGGMYGMAQGLAQLNKDLGVNIELNAEIEQIKFKRAD
CRTN_STAAE      AFQTLYIGIDPKRGPSLYSIIPMIEMMFGVHFIKGGMYGMAQGLAQLNKDLGVNIELNAEIEQIKFKRAD
CRTN_STAA8      AFQTLYIGIDPKRGPSLYSIIPMIEMMFGVHFIKGGMYGMAQGLAQLNKDLGVNIELNAEIEQIKFKRAD
CRTN_STAA3      AFQTLYIGIDPKRGPSLYSIIPMIEMMFGVHFIKGGMYGMAQGLAQLNKDLGVNIELNAEIEQIKFKRAD
CRTN_STAAB      AFQTLYIGIDPKRGPSLYSIIPMIEMMFGVHFIKGGMYGMAQGLAQLNKDLGVNIELNAEIEQIKFKRAD
CRTN_STAAC      AFQTLYIGIDPKRGPSLYSIIPMIEMMFGVHFIKGGMYGMAQGLAQLNKDLGVNIELNAEIEQIKFKRAD
CRTI_CERNC      TFGSMYMGMSPFDAPGTYSLLQYTELAEGIWYPVGGFHRVVEALVKIGEREGVDMETAVKKILLSEDGGV
CRTP_STAAE      GYFIKYVGSSSYDAPAVLSMLFHMQQEQGLWYVEGGIHHLANALEKLAREEGVTIHTGARVDNIKTYQRR
CRTP_STAAC      GYFIKYVGSSSYDAPAVLSMLFHMQQEQGLWYVEGGIHHLANALEKLAREEGVTIHTGARVDNIKTYQRR
CRTP_STAA8      GYFIKYVGSSSYDAPAVLSMLFHMQQEQGLWYVEGGIHHLANALEKLAREEGVTIHTGARVDNIKTYQRR
CRTP_STAA3      GYFIKYVGSSSYDAPAVLSMLFHMQQEQGLWYVEGGIHHLANALEKLAREEGVTIHTGARVDNIKTYQRR
CRTP_STAAN      GYFIKYVGSSSYDAPAVLSMLFHMQQEQGLWYVEGGIHHLANALEKLAREEGVTIHTGARVDNIKTYQRR
CRTP_STAAM      GYFIKYVGSSSYDAPAVLSMLFHMQQEQGLWYVEGGIHHLANALEKLAREEGVTIHTGARVDNIKTYQRR
CRTP_STAAW      GYFIKYVGSSSYDAPAVLSMLFHMQQEQGLWYVEGGIHHLANALEKLAREEGVTIHTGARVDNIKTYQRR
CRTP_STAAS      GYFIKYVGSSSYDAPAVLSMLFHMQQEQGLWYVEGGIHHLANALEKLAREEGVTIHTGARVDNIKTYQRR
CRTP_STAAR      GYFIKYVGSSSYDAPAVLSMLFHMQQEQGLWYVEGGIHHLANALEKLAREEGVTIHTGTRVDCVTGVRGE
CRTI_PHYBL      TFQSMYMGMSPYDSPAVYNLLQYTEFAEGIWYPKGGFNTVIQKLENIATEKGATDDKGKKVTGVTLQSGE
CRTP_STAAB      GYFIKYVGSSSYDAPAVLSMLFHMQQEQGLWYVEGGIHHLANALEKLAREEGVTIHTGTRVDNIKIYQRH
CRTN_STAHJ      AFQTLYIGIDPKQGPSIYSIIPMIEMVHGVHYIKXXXXXXXXXXXXXXXXXXVKVELNADVQEIKFKRAD
CRTI_ESCVU      SFHSLLVGGNPFTTSSIYTLIHALEREWGVWFPEGGTGALVNGMVKLFTDLGGEIELNARVEVVADNRVS
CRTI_PANAN      SFHSLLVGGNPFATSSIYTLIHALEREWGVWFPRGGTGALVQGMIKLFQDLGGEVVLNARVSHMTGNKIE
CRTI_RHOCA      SFHPLFIGGDPFHVTSMYILVSQLEKKFGVHYAIGGVQAIADAMAKVITDQGGEMRLNTEVDEIVSRDGK
CRTI_PARSN      SYHTLLVGGNPFSTSSIYALIHALERRGGVWFAKGGTNQLVAGMVALFERLGGQMLLNAKVARIDGPRAT
CRTI_STRGR      SFQALXXXXXXXXXXXXXXXXXXMDTVAGVYFPRGGMHXXXXXXXXXXXXXXXVLRYGQRVTRLERSGDR
CRTI_RHOS4      SFHPLFIGGDPFNVTSMYILVSQLEKEFXXXXXXXXXXXXXXXXXXXXEGQGGSFRMNTEVDEILVEKGT
CRTI_MYXXA      AYPSKYLGLHPTTCSSVFSVIPFLELAFGVWHVEGGFRELSRGMMRCARDLGATFRMGTPVEKVAGRAVG
CRTD_RHOCA      GRYATYVGGRPGATPAVLSLIWQAEVQG-VWAIREGMHGVXXXXXXXXXXKGVRFHYGAKAKRIVRKEGR
CRTD_RHOS4      -----YVGGTPYGAPGVLALIWAAEARG-VWAIEGGMHXXXXXXXXXXDDQGVRLRYGAPVARIQGGRAT
CRTSO_SOLLC     -------------TPMINASMVLCDRHGGINYPVGGVGEIAKSLAKGLDDHGSQILYRANVTSIILDNGK
CRTSO_DAUCA     ------------------------------------------SLAKGLVDQGSEIQYKANVKSIIVENGK
CRTSO_ARATH     ----------------------------------------------------------------------
CRTS2_ONCHC     ----------------------------------------------------------------------
CRTS1_ONCHC     ----------------------------------------------------------------------
PYRD2_MOUSE     ---------SPHTPGSGYVLLHHVGTQGAWSYVQGGMGALSDAIASSAATRGASIFTKVQVNS-EGRVQG


                         .         *         .         .         .         .         +:350
query           FTLATDDGTRTTDLVVNNANPAYAERELLDTGGRDHAPDYWDDQTYAPSALMFYLGVEGDVEPLAHHSLV
CRTJ_MYXXA      GVRLEGGEVVEADAVLCNADLPYAYEKLLDP--KATTLKRKEKLRYTSSGYMLYLGMKRRYPELLHHNVV
CRTI_NEUCR      KPKATNGEVLNADLVVVNADLVYTYNNLLEIGGIKKYANKLNNRKASCSSISFYWSLSGMAKELETHNIF
CRTP_STAHJ      ITVRLDDGSHSADYIVSNREVIPTYRDLLHFSNKKIAQ---LEKVYEPAAYVMHLGVDKEYAQLAHHNFL
CRTN_STAAW      AIKVNGDIRKFDKILCTADFPSVAESLMPDFAPKKYPPHKIADLDYSCSAFLMYIGIDIDVDQVRLHNVI
CRTN_STAAS      AIKVNGDIRKFDKILCTADFPSVAESLMPDFAPKKYPPHKIADLDYSCSAFLMYIGIDIDVDQVRLHNVI
CRTN_STAAR      AIKVNGDIRKFDKILCTADFPSVAESLMPDFAPKKYPPHKIADLDYSCSAFLMYIGIDIDVDQVRLHNVI
CRTN_STAAN      AIKVNGDIRKFDKILCTADFPSVAESLMPDFAPKKYPPHKIADLDYSCSAFLMYIGIDIDVDQVRLHNVI
CRTN_STAAM      AIKVNGDIRKFDKILCTADFPSVAESLMPDFAPKKYPPHKIADLDYSCSAFLMYIGIDIDVDQVRLHNVI
CRTN_STAAE      AIKVNGDIRKFDKILCTADFPSVAESLMPDFAPKKYPPHKIADLDYSCSAFLMYIGIDIDVDQVRLHNVI
CRTN_STAA8      AIKVNGDIRKFDKILCTADFPSVAESLMPDFAPKKYPPHKIADLDYSCSAFLMYIGIDIDVDQVRLHNVI
CRTN_STAA3      AIKVNGDIRKFDKILCTADFPSVAESLMPDFAPKKYPPHKIADLDYSCSAFLMYIGIDIDVDQVRLHNVI
CRTN_STAAB      AIKVNGDIRKFDKILCTADFPSVAESLMPDFAPKKYPPHKIADLDYSCSAFLMYIGIDIDVDQVRLHNVI
CRTN_STAAC      AIKVNGDIRKFDKILCTADFPSVAESLMPDFAPKKYPPHKIADLDYSCSAFLMYIGIDIDVDQVRLHNVI
CRTI_CERNC      AKVELEDGRRLADVVVNNSDLVYAYEKLLPI--KTPYAESLKGRPGSCSSISFYWALDRQVPELEAHNIF
CRTP_STAAE      VTVRLDTGEFVADYIISNMEPTYKYLIHLDTQRLNKLEREFEP---ASSGYVMHLGVACQYPQLAHHNFF
CRTP_STAAC      VTVRLDTGEFVADYIISNMEPTYKYLIHLDTQRLNKLEREFEP---ASSGYVMHLGVACQYPQLAHHNFF
CRTP_STAA8      VTVRLDTGEFVADYIISNMEPTYKYLIHLDTQRLNKLEREFEP---ASSGYVMHLGVACQYPQLAHHNFF
CRTP_STAA3      VTVRLDTGEFVADYIISNMEPTYKYLIHLDTQRLNKLEREFEP---ASSGYVMHLGVACQYPQLAHHNFF
CRTP_STAAN      VTVRLDTGEFVADYIISNMEPTYKYLIHLDTQRLNKLEREFEP---ASSGYVMHLGVACQYPQLAHHNFF
CRTP_STAAM      VTVRLDTGEFVADYIISNMEPTYKYLIHLDTQRLNKLEREFEP---ASSGYVMHLGVACQYPQLAHHNFF
CRTP_STAAW      VTVRLDTGEFVADYIISNMEPTYKYLIHLDTQRLNKLEREFEP---ASSGYVMHLGVACQYPQLAHHNFF
CRTP_STAAS      VTVRLDTGEFVADYIISNMEPTYKYLIHLDTQRLNKLEREFEP---ASSGYVMHLGVACQYPQLAHHNFF
CRTP_STAAR      FVKA--------DYIISNMEPTYKYLLHLDTQRLNKLEREFEP---ASSGYVMHLGVACQYPQLAHHNFF
CRTI_PHYBL      VIEA--------DAVVCNADLVYAYHNLL-------PPCRWTTNTLASSSISFYWSLKRVVPELDVHNIF
CRTP_STAAB      VTVRLDTGEFVADYIISNMEVIPTYKYLLHLGEREFEP--------ASSGYVMHLGVACQYPQLEHHNFF
CRTN_STAHJ      -GLRVNGDIRRFDKVLCTADFPYVAQNLMPVHSKNYSPEKVDNMDYSCSAFLIYAGINRQLRDKLHHNVV
CRTI_ESCVU      QVRLADGRIFDTDAVASNADVVNTYKKLLHPVGQKRAAAL-ERKSMSNSLFVLYFGLNQPHSQLAHHTIC
CRTI_PANAN      AVHLEDGRRFLTQAVASNADVVHTYRDLLSQPAAVKQSNKLQTKRMSNSLFVLYFGLNHHHDQLAHHTVC
CRTI_RHOCA      ATIRLMDGTEPAQVVVSNADAGHTYKRLLRNRDRWRWTDKLDKKRWSMGLFVWYFGTKGTAKDVGHHTVV
CRTI_PARSN      GVTLADGRALTADMVASNGDVMHNYRDLLGHTARGQSAKSLNAKRWSMSLFVLHFGLREAPKDVAHHTIL
CRTI_STRGR      VTVVTDQEHIPCDAVVLTPDLPVSYRLL---GRTPHRP---LPLRHSPSAVILHTGTDRTWPDLAHHTIS
CRTI_RHOS4      ATLASGEVLRA-GLVVSNADAGHTYMRLL----RNHPRRRWTDRRWSMGLFVWYFGTKGTKPDVGHHTIV
CRTI_MYXXA      VKLVGGEXXXXXXXXXXXXXXXXX-RSLIPAEAREGSDAALERAKYSCSTFMAYYGLDTVYADLPHHLIY
CRTD_RHOCA      VT-AVEIETGVSGACIFNGDPGALRDGLLGDAARASMEK---SPRPAPSAWVWAFGATPIGVDLAHHNVF
CRTD_RHOS4      GVQLADGRTLPADHIVFNGDPAALLAGCLGDGPQDAVPE---DRIHSLSAWVWSYAARASGPPLVHHNVF
CRTSO_SOLLC     AVVKLSDGRKYAKTIVSNATRWDTFGKLLKAENPKEEENFQKAYVKAPSFLSIHMGVKAD---------V
CRTSO_DAUCA     AV-----GVRLA-----NGNEIFAKNIISDTFGKDELPKEEENYIKAPSFLSIHLGVKSD---------V
CRTSO_ARATH     ----------------------------------------------APSFLSIHMGVKAEV---------
CRTS2_ONCHC     ----------------------------------------------APSFLSIHMGVK---------AFV
CRTS1_ONCHC     ----------------------------------------------APSFLSIHMGVK---------AFV
PYRD2_MOUSE     VTLQDGEEVRSR-VVLSCASPQVTFLELLDTQSPNVAVDRLPNFQAAPNA-------PGD-QPQGHHQCS


                         .         .         .         .         *         .         .:420
query           LPPDWDGHFAQLFDDPGWPDDPAFYLSVASKTDDTVAPDGHEAVVILLPIAPGLDDTPEIRAQYRDRLLG
CRTJ_MYXXA      FGRDYKGSFDDIFEF-RVPEDPSFYVNAPTRTDASLAPEGKDALYVLVPVPPDLDEGPKVRAKFFARMLG
CRTI_NEUCR      LAEEYKESFDAIFERQALPDDPSFYIHVPSRVDPSAAPPDRDAVIALVPVGHLLQDWPTLVSKARAGVLA
CRTP_STAHJ      FSNDSKRNYREVFHDKVLPQDPTIYLVNSNKSDPTQAPEGHENLKV-LPHIPYIQNQPFTEEQYRERVLD
CRTN_STAAW      FSDDFRGNIEEIFEG-RLSYDPSIYVYVPAVADKSLAPEGKTGIYVLMPTGSGIDWSDEALTQQIKEIIY
CRTN_STAAS      FSDDFRGNIEEIFEG-RLSYDPSIYVYVPAVADKSLAPEGKTGIYVLMPTGSGIDWSDEALTQQIKEIIY
CRTN_STAAR      FADDFRGNIEEIFEG-RLSHDPSIYVYVPAVADKSLAPQGQTGIYVLMPTGSGIDWSDELTDQIKDVIYR
CRTN_STAAN      FSDDFRGNIEEIFEG-RLSYDPSIYVYVPAVADKSLAPEGKTGIYVLMPTGSGIDWSDEALTQQIKEIIY
CRTN_STAAM      FSDDFRGNIEEIFEG-RLSYDPSIYVYVPAVADKSLAPEGKTGIYVLMPTGSGIDWSDEALTQQIKEIIY
CRTN_STAAE      FSDDFRGNIEEIFEG-RLSYDPSIYVYVPAVADKSLAPEGKTGIYVLMPTGSGIDWSDEALTQQIKEIIY
CRTN_STAA8      FSDDFRGNIEEIFEG-RLSYDPSIYVYVPAVADKSLAPEGKTGIYVLMPTGSGIDWSDEALTQQIKEIIY
CRTN_STAA3      FSDDFRGNIEEIFEG-RLSYDPSIYVYVPAVADKSLAPEGKTGIYVLMPTGSGIDWSDEALTQQIKEIIY
CRTN_STAAB      FSDDFRGNIEEIFEG-RLSYDPSIYVYVPAVADKSLAPEGKTGIYVLMPTGSGIDWSDEALTQQIKEIIY
CRTN_STAAC      FSDDFRGNIEEIFEG-RLSYDPSIYVYVPAVADKSLAPEGKTGIYVLMPTGSGIDWSDEALTQQIKEIIY
CRTI_CERNC      LADEYRESFDSIFKKHLIPDEPSFYVNVPSRVDSTAAPEGKDSVVVLVPVGPGLQDWPAMISLARKTILS
CRTP_STAAE      FTENAYLNYQQVFHEKVLPDDPTIYLVNTNKTDHTQAPVGYENIKV-LPHIPYIQDQPEDYAKFRDKILD
CRTP_STAAC      FTENAYLNYQQVFHEKVLPDDPTIYLVNTNKTDHTQAPVGYENIKV-LPHIPYIQDQPEDYAKFRDKILD
CRTP_STAA8      FTENAYLNYQQVFHEKVLPDDPTIYLVNTNKTDHTQAPVGYENIKV-LPHIPYIQDQPEDYAKFRDKILD
CRTP_STAA3      FTENAYLNYQQVFHEKVLPDDPTIYLVNTNKTDHTQAPVGYENIKV-LPHIPYIQDQPEDYAKFRDKILD
CRTP_STAAN      FTENAYLNYQQVFHEKVLPDDPTIYLVNTNKTDHTQAPVGYENIKV-LPHIPYIQDQPEDYAKFRDKILD
CRTP_STAAM      FTENAYLNYQQVFHEKVLPDDPTIYLVNTNKTDHTQAPVGYENIKV-LPHIPYIQDQPEDYAKFRDKILD
CRTP_STAAW      FTENAYLNYQQVFHEKVLPDDPTIYLVNTNKTDHTQAPVGYENIKV-LPHIPYIQDQPEDYAKFRDKILD
CRTP_STAAS      FTENAYLNYQQVFHEKVLPDDPTIYLVNTNKTDHTQAPVGYENIKV-LPHIPYIQDQPEDYAKFRDKILD
CRTP_STAAR      FTENAYLNYQQVFHEKVLPDDPTIYLVNTNKTDHTQAPVGYENIKV-LPHIPYIQDQPEDYAKFRDKILD
CRTI_PHYBL      LAEAFKESFDEIFTDHKMPSELSFYVNLPSRIDPTAAPPGKDSMIVLVPIGHMKSKTNEIVKRARKMVLE
CRTP_STAAB      FTENAYLNYQQVFHEKVLPDDPTIYLVNTNKTDHTQAPVGYENIKV-LPHIPYIQDQPEDYAKFRDKILD
CRTN_STAHJ      FARDFRGNIDDIFSGK-MPDDPSLYLYFPSVEDEALAPKDQTGMYVLMPV-PELKNDPNMVEKAKDVIYN
CRTI_ESCVU      FGPRYRELIDEIFTGSALADDFSLYLHSPCVTDPSLAPPGCASFYVLAPV-PHLGNAPLDWAQLRDRIFD
CRTI_PANAN      FGPRYRELIDEIFNHDGLAEDFSLYLHAPCVTDSSLAPEGCGSYYVLAPVTANLDWTVE-GPKLRDRIFA
CRTI_RHOCA      VGPRYKEHVQDIFIKGELAEDMSLYVHRPSVTDPTAAPKGDDTFYVLSPVPNGVDWSVEAE-KYKAKVLK
CRTI_PARSN      FGPRYKELVNEIFKGPKLAEDFSLYLHSPCTTDPEMAPPGMSTHYVLAPV-PHLGDWAVEGPRYADRILA
CRTI_STRGR      FGAAWKNTFHELTRTGRLMSDPSLLITRPTATDPSLAPPGKHLHYVLAPVGPGVREWRELGPXXXXXXXX
CRTI_RHOS4      NAPRYKGLVEDIFLKGKLAKDMSLYIHRPSITDPTVAPEGDDTFYALSPV-PHLKDWQAVAEPYRESVLE
CRTI_MYXXA      LSESARRTDRDALEDRHVDEDPPFYVCNPGVTDPSGAPAGHSTLYVLVP-TPNTGDWVKTEQALRERIPA
CRTD_RHOCA      FTADPELEFGPIGAGE-MPEEPTLYICAQDREMQAPVPE-IERFEIIMNGPAGHQPFPQEEAQCRARTFP
CRTD_RHOS4      FADDPRREFGPIAAGQ-MPEDATLYICAEDRSGGQL-PDGPERFEIIMNGPPGRPAKPEDFAQCRSRTFD
CRTSO_SOLLC     LPPDTDCHHFVLEDDWTNLEKPSIFLSIPTVLDSSLAPEGHHILHIFTTSSEGLSDYEAKKEVVAERIIS
CRTSO_DAUCA     LPPDTDCHHFVLEDDWSNLEVPSIFLSIPTVLDSSLAPEGNHILHIFTTSSQGMSDYEKKKELVADEIIS
CRTSO_ARATH     LPPDTDCHHFVLEDDWKNLEEPSIFLSIPTILDSSLAPDGRHILHIF--TTSSIEDWEGLPPKEYEAKKE
CRTS2_ONCHC     LPPDTDCHHFILEDNWGRLELPSIFLSIPTVLDPSLAPEGHHIFHIFTTSSEGLSEYEEKKELVADEIIT
CRTS1_ONCHC     LPPDTDCHHFILEDNWGRLELPSIFLSIPTVLDPSLAPEGHHIFHIFTTSSEGLSEYEEKKELVADEIIT
PYRD2_MOUSE     IHLNCEDTLLQAFEDAGLPSQPMIELCIPSSLDPTLAPPGCHVVSLFTQYTPGKVWNEQEKNTYADKVFD


                         .         .         +         .         .         .         .:490
query           TLAAQTGVDLRDRIVVEESACVSEFSEQFGDPGGTALGLAHTLFQTGPLRPGKRDGPDGHYYVGAYTNPG
CRTJ_MYXXA      FPSLESDIEVERR-----SSTPDDWAGTFNLARGSGFGLSQNFTQIGPFRPSNQDAVKNLFFVGASTQPG
CRTI_NEUCR      TIQARTGLSLSPLITEEIVNTPYTWETKFNLSKGAILGLAHDFFNVLAFRPTKAQGMDNAYFVGASTHPG
CRTP_STAHJ      KLEKMGLTDLRQHIIYEDIWTPHDIERTYGSNKGAIYGVADXXXXXXXXXXXQSEYFDNLFFVGGSVNPG
CRTN_STAAW      RKLATIEVDIKSHIVSETIFTPNDFEQTYHAKFGSAFGLMPTLAQSNYYRPQSRDYKD-LYFAGASTHPG
CRTN_STAAS      RKLATIEVDIKSHIVSETIFTPNDFEQTYHAKFGSAFGLMPTLAQSNYYRPQSRDYKD-LYFAGASTHPG
CRTN_STAAR      KLATEVFEDIKSHIVSETIFTPNDFEQTYHAKFGSAFGLMPTLAQSNYYRPQSRDYKD-LYFAGASTHPG
CRTN_STAAN      RKLATIEVDIKSHIVSETIFTPNDFEQTYHAKFGSAFGLMPTLAQSNYYRPQSRDYKD-LYFAGASTHPG
CRTN_STAAM      RKLATIEVDIKSHIVSETIFTPNDFEQTYHAKFGSAFGLMPTLAQSNYYRPQSRDYKD-LYFAGASTHPG
CRTN_STAAE      RKLATIEVDIKSHIVSETIFTPNDFEQTYHAKFGSAFGLMPTLAQSNYYRPQSRDYKD-LYFAGASTHPG
CRTN_STAA8      RKLATIEVDIKSHIVSETIFTPNDFEQTYHAKFGSAFGLMPTLAQSNYYRPQSRDYKD-LYFAGASTHPG
CRTN_STAA3      RKLATIEVDIKSHIVSETIFTPNDFEQTYHAKFGSAFGLMPTLAQSNYYRPQSRDYKD-LYFAGASTHPG
CRTN_STAAB      RKLATIEVDIKSHIVSETIFTPNDFEQTYHAKFGSAFGLMPTLAQSNYYRPQSRDYKD-LYFAGASTHPG
CRTN_STAAC      RKLATIEVDIKSHIVSETIFTPNDFEQTYHAKFGSAFGLMPTLAQSNYYRPQSRDYKD-LYFAGASTHPG
CRTI_CERNC      TIQSRTNVDLTPLIIHESTNSPLSWKQTFNLDRGAILGLSHSFFNTRARKPGAFDGKDGLYMVGASAHPG
CRTP_STAAE      KLEKMGLTDLRKHIIYEDVWTPEDIEKNYRSNRGAIYGVADXXXXXXXXXXXESQYFENLYFVGGSVNPG
CRTP_STAAC      KLEKMGLTDLRKHIIYEDVWTPEDIEKNYRSNRGAIYGVADXXXXXXXXXXXESQYFENLYFVGGSVNPG
CRTP_STAA8      KLEKMGLTDLRKHIIYEDVWTPEDIEKNYRSNRGAIYGVADXXXXXXXXXXXESQYFENLYFVGGSVNPG
CRTP_STAA3      KLEKMGLTDLRKHIIYEDVWTPEDIEKNYRSNRGAIYGVADXXXXXXXXXXXESQYFENLYFVGGSVNPG
CRTP_STAAN      KLEKMGLTDLRKHIIYEDVWTPEDIEKNYRSNRGAIYGVADXXXXXXXXXXXESQYFENLYFVGGSVNPG
CRTP_STAAM      KLEKMGLTDLRKHIIYEDVWTPEDIEKNYRSNRGAIYGVADXXXXXXXXXXXESQYFENLYFVGGSVNPG
CRTP_STAAW      KLEKMGLTDLRKHIIYEDVWTPEDIEKNYRSNRGAIYGVADXXXXXXXXXXXESQYFENLYFVGGSVNPG
CRTP_STAAS      KLEKMGLTDLRKHIIYEDVWTPEDIEKNYRSNRGAIYGVADXXXXXXXXXXXESQYFENLYFVGGSVNPG
CRTP_STAAR      KLEKMGLTDLRKHIIYEDVWTPEDIEKNYRSNRGAIYGVADXXXXXXXXXXXESQYFENLYFVGGSVNPG
CRTI_PHYBL      VLERRLGLNFIDLVEHEEVNDPSIWQKKFNLWRGSILGLSHDVLQVLWFRPSTQDSTGRYFFVGASTHPG
CRTP_STAAB      KLEKMGLTDLRKHIIYEDVWTPEDIEKNYRSNRGAIYGVADXXXXXXXXXXXESQYFENLYFVGGSVNPG
CRTN_STAHJ      KLETIEALDIRQDVVSETVFTPLDFESRYNAKFGSAFGLMPTLTQSNYYRPPSRDYKD-LYFAGASTHPG
CRTI_ESCVU      YLEERYMPGLRSQLVTQRIFTPADFHDTLDAHLGSAFSIEPLLTQSAWFRPHNRDSDIANYLVGAGTHPG
CRTI_PANAN      YLEQHYMPGLRSQLVTHRMFTPFDFRDQLNAYHGSAFSVEPVLTQSAWFRPHNRDKTTNLYLVGAGTHPG
CRTI_RHOCA      VIEERLLPGVAEKITEEVVFTPETFRDRYLSPLGAGFSLEPRILQSAWFRPNASEEVDGLYLVGAGTHPG
CRTI_PARSN      SLEERLIPNLRANLTTTRIFTPSDFASELNAHHGSAFSVEPILTQSAWFRPHNRDKTIRNFYVGAGTHPG
CRTI_STRGR      XXXXXXMPGLGAAIEEEGLVTPVDWTAQ-GHAAGTPFSVAHTFPQTGPFRP-------------------
CRTI_RHOS4      VL-EQSMPGIGERIGPSLVFTPETFRDRYLSPWGAGFSIEPRILQSAWFRPHNSEEVANLFLVGAGTHPG
CRTI_MYXXA      MLEKVGLKGVREHIREERYFTAETWRDDFNVFRGAVFNLSHTWLQLGPLRPKKNRDIEGLYFVGGGTHPG
CRTD_RHOCA      MLAAMGSPDPETRALTTPALLSRRFPGSLGAIGGSPEGTLATF-----RRPLARTGLKGLYLAGGGTHPG
CRTD_RHOS4      RL-RQFGLTF-DPVPGETSTAPSGFASLFPASQGSIYGLSPHGALASLKRPLARTXXXXXXXXXXXXXXX
CRTSO_SOLLC     RLEKTLFPGLKSSILFKEVGTLARDSGTYGPPRGTPKGLLGMPFNTTAI--------DGLYCVGDSCFPG
CRTSO_DAUCA     RLEKKLFPGLQSSIVLKEVGTLARDSGTYGPPQGTPKGLLGMPFNTTAI--------DGLYCVGDSCFPG
CRTSO_ARATH     DVAARIIQRLEKKLFPGLSSSIT--FKEVGTPRTHRRFLARDKGTYGPMPRGTPKGIDGLYCVGDSCFPG
CRTS2_ONCHC     RLEKKLFPGLKDSVVLKEVGTPKTHRRFLARDSGTYGPMPRKVPKGLLGMPFNTTAINGLYCVGDSCFPG
CRTS1_ONCHC     RLEKKLFPGLKDSVVLKEVGTPKTHRRFLARDSGTYGPMPRKVPKGLLGMPFNTTAINGLYCVGDSCFPG
PYRD2_MOUSE     CIEAY-APGFKRSVLARDILTPPDLERIFRLPGGNIFHGAMSLDQLYFARPDYRCPVQGLYLCGSGAHPG


                         *         .         .         .         .         +         .:560
query           IGMPMCLISGEHVTKAVIDDDPAASGSTDPxxxxxxxxxxxxxxxx
CRTJ_MYXXA      TGLPTVLISARLVTERLMTWAHAQGVSLSP----------------
CRTI_NEUCR      TGVPIVLAGAKITAEQILEE--------------------------
CRTP_STAHJ      GGMPMVTLSGQQVADKI-----------------------------
CRTN_STAAW      AGVPIVLTSAKITVDEMIKD--------------------------
CRTN_STAAS      AGVPIVLTSAKITVDEMIKD--------------------------
CRTN_STAAR      AGVPIVLTSAKITVDEMIKD--------------------------
CRTN_STAAN      AGVPIVLTSAKITVDEMIKD--------------------------
CRTN_STAAM      AGVPIVLTSAKITVDEMIKD--------------------------
CRTN_STAAE      AGVPIVLTSAKITVDEMIKD--------------------------
CRTN_STAA8      AGVPIVLTSAKITVDEMIKD--------------------------
CRTN_STAA3      AGVPIVLTSAKITVDEMIKD--------------------------
CRTN_STAAB      AGVPIVLTSAKITVDEMVKD--------------------------
CRTN_STAAC      AGVPIVLTSAKITVDEMIKD--------------------------
CRTI_CERNC      TGVPICLAGGALVAEQICGD--------------------------
CRTP_STAAE      GGMPMVTLSGQQVADKI-----------------------------
CRTP_STAAC      GGMPMVTLSGQQVADKI-----------------------------
CRTP_STAA8      GGMPMVTLSGQQVADKI-----------------------------
CRTP_STAA3      GGMPMVTLSGQQVADKI-----------------------------
CRTP_STAAN      GGMPMVTLSGQQVADKI-----------------------------
CRTP_STAAM      GGMPMVTLSGQQVADKI-----------------------------
CRTP_STAAW      GGIPMVTLSGQQVADKI-----------------------------
CRTP_STAAS      GGIPMVTLSGQQVADKI-----------------------------
CRTP_STAAR      GGMPMVTLSGQQVADKI-----------------------------
CRTI_PHYBL      TGVPIVLAGSKLTSDQVCD---------------------------
CRTP_STAAB      GGMPMVTLSGQQVADKI-----------------------------
CRTN_STAHJ      AGVPIVLTSAKITAEAMLED--------------------------
CRTI_ESCVU      AGIPGVVASAKATASLMIED--------------------------
CRTI_PANAN      AGIPGVIGSAKATAGLMLED--------------------------
CRTI_RHOCA      AGVPSVIGSGELVAQMIPD---------------------------
CRTI_PARSN      AGIPGVVGSAKATAQVMLSD--------------------------
CRTI_STRGR      ----------------------------------------------
CRTI_RHOS4      AGVPGVIGSAEVMAK-------------------------------
CRTI_MYXXA      SGL-------------------------------------------
CRTD_RHOCA      AGVPMALTSGTHAARALLADRISAA---------------------
CRTD_RHOS4      XXXXXXXLSGRHAAEAILAD--------------------------
CRTSO_SOLLC     QGVIAVAFSG------------------------------------
CRTSO_DAUCA     QGVIAVAFSG------------------------------------
CRTSO_ARATH     QGVIAVAFSG------------------------------------
CRTS2_ONCHC     QGVIAVAFSG------------------------------------
CRTS1_ONCHC     QGVIAVAFSG------------------------------------
PYRD2_MOUSE     GGV-------------------------------------------