[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for halo0:AAG19981.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1dnpA.bssp"
#ERROR : Can't open dsspfile "2e0iB.bssp"
#ERROR : Can't open dsspfile "2e0iA.bssp"
#ERROR : Can't open dsspfile "2e0iD.bssp"
#ERROR : Can't open dsspfile "3cvwA.bssp"
#ERROR : Can't open dsspfile "3cvxA.bssp"
#ERROR : Can't open dsspfile "3cvvA.bssp"
#ERROR : Can't open dsspfile "3cvuA.bssp"
#ERROR : Can't open dsspfile "1bpjA.bssp"
#ERROR : Can't open dsspfile "3bp9V.bssp"
#ERROR : Can't open dsspfile "1bp0A.bssp"
#ERROR : Can't open dsspfile "3ebhA.bssp"
#ERROR : Can't open dsspfile "3dloA.bssp"
#ERROR : Can't open dsspfile "2dumA.bssp"

## Summary of PDB Search
:462
    1e-75  29%  1dnpA  [c.28.1 - a.99.1] DNA PHOTOLYASE
    5e-74  32%  2e0iB  [x.x.x] 432AA LONG HYPOTHETICAL DEOXYRIBODIPYRIMIDINE
    7e-74  32%  2e0iA  [x.x.x] 432AA LONG HYPOTHETICAL DEOXYRIBODIPYRIMIDINE
    4e-73  32%  2e0iD  [x.x.x] 432AA LONG HYPOTHETICAL DEOXYRIBODIPYRIMIDINE
    2e-70  25%  3cvwA  [x.x.x] RE11660P
    3e-63  25%  3cvxA  [x.x.x] RE11660P
    7e-40  32%  3cvvA  [x.x.x] RE11660P
    1e-31  31%  3cvuA  [x.x.x] RE11660P
    1e-21   8%  1bpjA  [d.117.1] PROTEIN (THYMIDYLATE SYNTHASE)
    6e-17  13%  3bp9V  [x.x.x] GAG PROTEIN
    6e-16   8%  1bp0A  [d.117.1] PROTEIN (THYMIDYLATE SYNTHASE)
    2e-10  10%  3ebhA  [x.x.x] M1 FAMILY AMINOPEPTIDASE
    3e-05  22%  3dloA  [x.x.x] UNIVERSAL STRESS PROTEIN
    3e-04  16%  2dumA  [x.x.x] HYPOTHETICAL PROTEIN PH0823
:462

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xHLYWHQRDLRVPDNRGLHAATDGDTVVPVYVFDDTVLSQVGRPKRAFLAAGVRALRAAYRERGSDLLVR
1dnpA           -HLVWFRQDLRLHDNLALAAACRSARVLALYIATPRQWHNMSPRQAELINAQLNGLQIALAEKGIPLLFR
2e0iB           -CIFIFRRDLRLEDNTGLYALSECDRVIPVFIADPRQLPYKSEFAVSFMINSLLELDDELRKKGSRLNVF
2e0iA           --IFIFRRDLRLEDNTGLYALSECDRVIPVFIADPRQLPYKSEFAVSFMINSLLELDDELRKKGSRLNVF
2e0iD           -CIFIFRRDLRLEDNTGLYALSECDRVIPVFIADPRQLPYKSEFAVSFMINSLLELDDELRKKGSRLNVF
3cvwA           --VHWFRKGLRLHDNPALSHIFTRYFVRPIFILDPGILDWMGANRWRFLQQTLEDLDNQLRKLNSRLFVV
3cvxA           -LVHWFRKGLRLHDNPALSHIFTRYFVRPIFILDPGILDWMGANRWRFLQQTLEDLDNQLRKLNSRLFVV
3cvvA           --VHWFRKGLRLHDNPALSHIFTAYFVRPIFILDP-----------------------------------
3cvuA           -LVHWFRKGLRLHDNPALSHIFTAYFVRPIFILDPGILMQVGANRWRFLQQTLEDLDNQLRKLNSRLFVV
1bpjA           ----------------------------------------------------------------------
3bp9V           ----------------------------------------------------------------------
1bp0A           ----------------------------------------------------------------------
3ebhA           ----------------------------------------------------------------------
3dloA           ------------------EARLRGVPVYVVHSLPGGTKDEDIIEAKETLSWAVSIIRKEGAEGEEHLLVR
2dumA           ------------------RNKMEVGEVILLHVIDEGTLEELMELKSRKLQEKAEEVKRAFRAKNVRTIIR


                         .         .         *         .         .         .         .:140
query           EGDAESVLPALADEFDADTVFHAAHYDAARRNRXXXXXXXXXXXXXXXXXHVDHTLVDPATLDDAYPSHS
1dnpA           EVDSVEIVKQVCAENSVTHLFYNYQYEVNERAR--DVEVERALRNVVCEGFDDSVILPPGAVMTMYKVFT
2e0iB           FGEAEKVVSRFFNKVDAIYVNE--DYTPFSISRDEKIRKVCEENGIEFKAYEDYLLTPKSLFH--HRNFT
2e0iA           FGEAEKVVSRFFNKVDAIYVNE--DYTPFSISRDEKIRKVCEENGIEFKAYEDYLLTPKSLFH--HRNFT
2e0iD           FGEAEKVVSRFFNKVDAIYVNE--DYTPFSISRDEKIRKVCEENGIEFKAYEDYLLTPKSLFH--HRNFT
3cvwA           RGKPAEVFPRIFKSWRVEMLTFETDIEPYSVTRDAAVQKLAKAEGVRVETHCSHTIYNPELVIAAPITYQ
3cvxA           RGKPAEVFPRIFKSWRVEMLTFETDIEPYSVTRDAAVQKLAKAEGVRVETHCSHTIYNPELVIKAPITYQ
3cvvA           ----------------------------------------------------------------------
3cvuA           RGKPAEVFPRIFKSWRVEMLTFETDI--------------------------------------------
1bpjA           ----------------------------------------------------------------------
3bp9V           ----------------------------------------------------------------------
1bp0A           ----------------------------------------------------------------------
3ebhA           ----------------------------------------------------------------------
3dloA           GKEPPDDIVDFADEVDAIAIVIGIR---------------------------------------------
2dumA           FGIPWDEIVKVAEEENVSLIILPSR---------------------------------------------


                         +         .         .         .         .         *         .:210
query           QFYDDWQQXXXXXXXXXXXXXXXXXXXXXXTLSVPAPEPPLPDAGHAAATDRLAAFLDDGIASYNDTRXX
1dnpA           PFKNAWLKRLREGMPECVAAPKVRSSGSIEPSPRQSFDTAHFPVEEKAAIAQLRQFCQNGAGEYEQQR--
2e0iB           SFYNEVSKVKVREPETMEGSFDVTDSSMNVLLTFKKIESPLFRGGRREGLYLLHRNV------DFRRRDY
2e0iA           SFYNEVSKVKVREPETMEGSFDVTDSSMNVLLTFKKIESPLFRGGRREGLYLLHRNV------DFRRRDY
2e0iD           SFYNEVSKVREPETMEGSFDVTDSSMNVDFLLTFKKIESPLFRGGRREGLYLLHRNV------DFRRRDY
3cvwA           KFLGIVEQLKVPKVLGVPEKLKNMPTPPKDAYDCPTMKQLVKRPEETEALRRMEESLKDEIWVARFEKPN
3cvxA           KFLGIVEGVPEKLKNMPTPPKDEVEQKDSAAYDCPTMKQLVKRPGETEALRRMEESLKDEIWVARFEKPN
3cvvA           ----------------------------------------------------------------------
3cvuA           ----------------------------------------------------------------------
1bpjA           ----------------------------------------------------------------------
3bp9V           ----------------------------------------------------------------------
1bp0A           ----------------------------------------------------------------------
3ebhA           ----------------------------------------------------------------------
3dloA           ----------------------------------------------------------------------
2dumA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           XXXXXXXXXXXXXRLSPYLAAGNIGVREVWXXXXXXXXXXTGNAARNIGKYRYELSWREQNYHLLYHTPR
1dnpA           ----DFPAVEGTSRLSASLATGGLSPRQCLHRLLAEQPQALDGGAGS--VWLNELIWREFYRHLITYHPS
2e0iB           PAENNNY------RLSPHLKFGTISMREAY------------YTQKGKEEFVRELYWRDFFTLLAYYNPH
2e0iA           PAENNNY------RLSPHLKFGTISMREAY------------YTQKGKEEFVRELYWRDFFTLLAYYNPH
2e0iD           PAENNNY------RLSPHLKFGTISMREAY------------YTQKGKEEFVRELYWRDFFTLLAYYNPH
3cvwA           TAPNSLEPSTT--VLSPYLKFGCLSARLFNQKLKEIIKRQPKHSQ-PPVSLIGQLMWREFYYTVAAAEPN
3cvxA           TAPNSLEPSTT--VLSPYLKFGCLSARLFNQKLKEIIKRQPKHSQ-PPVSLIGQLMWREFYYTVAAAEPN
3cvvA           ---------------SPYLKFGCLSARLFNQKLKEIIKRQPKHSQ-PPVSLIGQLMWREFYYTVAAAEPN
3cvuA           -------------------------------------------------SLIGQLMWREFYYTVAAAEPN
1bpjA           -----------------------------------------------------KVPFGLIKSELLWFLHG
3bp9V           -------------GGNGQLQYWPFSSSDLY------------NWKNNNPSFSEGKLTALIESVLTTHQPT
1bp0A           -----------------------------------------------------KVPFGLIKSELLWFLHG
3ebhA           --------------------------------------------------------TSLSVSAYFDKYFE
3dloA           ----------------------------------------------------------------------
2dumA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           LQTENYVSFDAPIAWQNSDDHFEAWTRGETGYPLVDAGMRQLRAEGYVHNRPRQVVASFLTKHLLVDWRR
1dnpA           LCKHRPFIAWTDVQWQSNPAHLQAWQEGKTGYPIVDAAMRQLNSTGWMHNRLRMITASFLVKDLLIDWRE
2e0iB           VFGHCYRREYDNISWENNESYFEAWKEGRTGYPIIDAGMRMLNSTGYINGRVRMLVAFFLVKVLFVDWRW
2e0iA           VFGHCYRREYDNISWENNESYFEAWKEGRTGYPIIDAGMRMLNSTGYINGRVRMLVAFFLVKVLFVDWRW
2e0iD           VFGHCYRREYDNISWENNESYFEAWKEGRTGYPIIDAGMRMLNSTGYINGRVRMLVAFFLVKVLFVDWRW
3cvwA           FDRMLGNVYCMQIPWQEHPDHLEAWTHGRTGYPFIDAIMRQLRQEGWIHNLARHAVACFLTRDLWISWEE
3cvxA           FDRMLGNVYCMQIPWQEHPDHLEAWTHGRTGYPFIDAIMRQLRQEGWIHHLARMAVACFLTRDLWISWEE
3cvvA           FDRMLGNVYCMQIPWQEHPDHLEAWTHGRTGYPFIDAIMRQLRQEGWIHHLARHAVACFLTRGLWISWEE
3cvuA           FDRMLGNVYCMQIPWQEHPDHLEAWTHGRTGYPFIDAIMRQLRQEGWIHHLARHAVACFLTRGDWISWEE
1bpjA           DTNIRFLLQHRNHIWDEWAFEKWVKSDEYHGPDMTDFGHRSQKDPEFAAVYHEEMAKFDDRVLHDDAFA-
3bp9V           WDDCQQLLGTTGEEKQRVLLEARKAVEVDAAFPLERPDWDYTTTEGRNHL--VLYRQLLL----------
1bp0A           DTNIRFLLQHRNHIWDEWAFEKWVKSDEYHGPDMTDFGHRSQKDPEFAAVYHEEMAKFDDRVLHDDAFA-
3ebhA           LYDKTYKLSKDDELLLQEWLKTVSRSDRKDIYEILKKLENEVLKDSKNPNDIRAVYLPFTNNLRRFHDIS
3dloA           ----------------------------------------------------------------------
2dumA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           GERHFADRLVDYDPANNAANWQWTASTGTDTVAVRIFDPVSQMAKYDSDAAFVTEYVPELRGVDPETIVD
1dnpA           GERYFMSQLIDGDLAANNGGWQWAASTGTDAAYFRIFNPTTQGEKFDHEGEFIRQWLPELRDVPGKVVHE
2e0iB           GERYFATKLVDYDPAINNGNWQWIASTGVDY-MFRVFNPWKQQEKFDPEAKFIKEWVEELKDVPPSII--
2e0iA           GERYFATKLVDYDPAINNGNWQWIASTGVDYM-FRVFNPWKQQEKFDPEAKFIKEWVEELKDVPPSII--
2e0iD           GERYFATKLVDYDPAINNGNWQWIASTGVDYM-FRVFNPWKQQEKFDPEAKFIKEWVEELKDVPPSII--
3cvwA           GQRVFEQLLLDQDWALNAGNWMWLSASAFFHQYFRVYSPVAFGKKTDPQGHYIRKYVPELSKYPAGCIYE
3cvxA           GQRVFEQLLLDQDWALNAGNWMWLSASAFFHQYFRVYSPVAFGKKTDPQGHYIRKYVPELSKYPAGCIYE
3cvvA           GQRVFEQLLLDQDWALNAGNWMWLSASAFFHQYFRVYSPVAFGKKTDPQGHYIRKYVPELSKYPAGCIYE
3cvuA           GQRVFEQLLLDQDWALNAGNWMWLSASAFFHQYFRVYSPVAFGKKTDPQGHYIRKYVPELSKYPAGCIYE
1bpjA           ----AKYGDLGLVYGSQWRAWHTSKGDTIDQLG-------------------------------------
3bp9V           ----------------------------------------------------------------------
1bp0A           ----AKYGDLGLVYGSQWRAWHTSKGDTID----------------------------------------
3ebhA           GKGYK--LIAEVITKTDKFNPMVAT---------QLCEPFKLWNKLDTKR--QELMLNEMNTML------
3dloA           ----------------------------------------------------------------------
2dumA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           WPTLRHSQRERLAPDYHHPIVDRDHAYERAQRVFEAALxxxx
1dnpA           PWKWAQ--KAGVTLDYPQPIVEHKEARVQTLAAYEAA-----
2e0iB           -----HSIYKTKVPGYPSPIVNWLERVNYVKSEYKNV-----
2e0iA           -----HSIYKTKVPGYPSPIVNWLERVNYVKSEYKN------
2e0iD           -----HSIYKTKVPGYPSPIVNWLERVNYVKSEYKNV-----
3cvwA           PWKASLVDQRVLGTDYPHRIVKHEVVHKENIKRMGAA-----
3cvxA           PWKASLVDQRVLGTDYPHRIVKHEVVHKENIKRMGAA-----
3cvvA           PWKASLVDQRVLGTDYPHRIVKHEVVHKENIKRMGAA-----
3cvuA           PWKASLVDQRVLGTDYPHRIVKHEVVHKENIKRMGAAY----
1bpjA           ------------------------------------------
3bp9V           ------------------------------------------
1bp0A           ------------------------------------------
3ebhA           ------------------------------------------
3dloA           ------------------------------------------
2dumA           ------------------------------------------