[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for halo0:AAG19034.1

[Show Plain Result]


## Summary of Sequence Search
    1::373
    2::341     1e-35  34%  341 aa  PF00155 Aminotran_1_2 "Aminotransferase class I and II"
   43::145     3e-08  39%  358 aa  PF01041 DegT_DnrJ_EryC1 "DegT/DnrJ/EryC1/StrS aminotransferase
   38::173     3e-07  34%  359 aa  PF00266 Aminotran_5 "Aminotransferase class-V"
   34::158     1e-04  32%  285 aa  PF01212 Beta_elim_lyase "Beta-eliminating lyase"
    1::373

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxPDFPTPDHARQAAVDAIESGAADGYTSNRGTAALVD
PF00155         ----------------------------------PALAPPPAVVEAAIEAAGGGLL-GYGPPQGLPELRE
PF01041         ----------------------------------------------------------------------
PF00266         --------------------------------------------------------------REATELVE
PF01212         --------------------------------------------------------------------VN


                         .         .         *         .         .         .         .:140
query           AIVEKHARDQGVDVAPAGVIATAGGSEALHLAMEAHVDPGDEVLFPDPGFVSYDALTRMAGGNPVGLPLR
PF00155         AIADFLGRRRGVPVDPEEILVTSGAQAALALLLQLLLDPGDEVLVPEPTYPSYIAAARLAGAEVVPVPLE
PF01041         -------------------VAVNSGTAALHLALRAGIGPGDEVITPAFTFVATANAILYVGATPVFVDIP
PF00266         EAREKLARLLGAD--PDEVVFTSGGTEALNLVLARPLKPGDEILVSHSNLLPWRELAERLGAEVTVIPVD
PF01212         ALEEKVAELFGKEAA----LFVPSGTQANLIALRAHCQRGEEVICGQPAHIYFDAIAELGGAKVLPVPGA


                         +         .         .         .         .         *         .:210
query           DDLTLAPETVEDHITDDTAAFVVNSPANPTGAVQSPADMRAFARIADEHDVLCISDEVYEHIVFEGEHRS
PF00155         DDFGLDLEALEAALTEKTKLIVLPNPNNPTGAVLSLEELEELAELARKYDLLIIEDEAYGELVYGGEFVS
PF01041         DTLNIDPEALEAAITPRTKAII------PVHLFGQPADMDAIMAIAKKHGLPVIED--------------
PF00266         EDGLVDLEDLEAALTPDTALVSLTHVSNETGVIQPIAEI---AALAHEHGALVVVD--------------
PF01212         EDGKLDLEKLEAAIKPDGDHFALVSLENTTGTVYSLEELRAISELAREH---------------------


                         .         .         .         +         .         .         .:280
query           PMEFADTDNVVVVNACSKTYSMTGWRLGWVAASERRAERMLRVHQYVQXXXXXXXXXXXXXXLSGPQGVV
PF00155         ALASLDGDNVIVLGSFSKAFGLPGLRLGYIVAPPELIEALRKLARPLTSPSTPLQAAAAAALSDG--GLL
PF01041         ----------------------------------------------------------------------
PF00266         ----------------------------------------------------------------------
PF01212         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           DEMVAAFEARRDVLLDGLEAMGLDVPTPGGAFYAMPTVPDGWIDEXXXXXXXXXPGSAFGDHGAGTARIS
PF00155         DELRARLRERRDLLREALEELGLEVIPPEGGFFLWLDLPELDAEELLEEGVLVVPGSGFGVPGPGYLRIS
PF01041         ----------------------------------------------------------------------
PF00266         ----------------------------------------------------------------------
PF01212         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           YATDMATLRDAIDVMxxxxxxxx
PF00155         FALTEEELEEALELL--------
PF01041         -----------------------
PF00266         -----------------------
PF01212         -----------------------