[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for halo0:AAG19981.1

[Show Plain Result]


## Summary of Sequence Search
    1::462
    2::233     6e-44  46%  252 aa  PF03441 FAD_binding_7 "FAD binding domain of DNA photolyase"
    2::133     7e-16  43%  168 aa  PF00875 DNA_photolyase "DNA photolyase"
    1::462

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxLYWHQRDLRVPDNRGLHAATDGDTVVPVYVFDDTVLSQVGRPKRAFLAAGVRALRAAYRERGSDLLVR
PF03441         ----------------------------------------------------------------------
PF00875         --LVWFRRDLRLHDNPALLAALQGDPVLPVYVLDPRQLSRVGPRRARFLLESLEDLDASLRKLGSPLLVR


                         .         .         *         .         .         .         .:140
query           EGDAESVLPALADEFDADTVFHAAHYDAARRNRXXXXXXXXXXXXXXXXXHVDHTLVDPxxxxxxxxxxx
PF03441         ----------------------------------------------------------------------
PF00875         RGDPEEVLPELAKELGATAVFANREYEPEERQRDAAVKKALKEAGIEVHSFDDHTLVPP-----------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxGHAAATDRLAAFLDDGIASYNDTRXX
PF03441         --------------------------------------------GETAALARLDDFLSERLARYGETRDA
PF00875         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           XXXXXXXXXXXXXRLSPYLAAGNIGVREVWXXXXXXXXXXTGNAARNIGKYRYELSWREQNYHLLYHTPR
PF03441         PAEDATS------RLSPYLAFGCLSPREVYHAALAAYRAG-GKHAESVEGFLRELGWREFYRHLLYHNPN
PF00875         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           LQTENYVSFDAPIAWQNSDDHFEAWTRGETGYPLVDAGMRQLRAEGYVHNRPRQVVASFLTKHLLVDWRR
PF03441         YDNMPGNPILDQIPWAREDEELEAWEEGRTGYPLVDAAMRQLLATGWMHNRARMIVASFLTKDLLIDWRE
PF00875         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           GERHFADRLVDYDPANNAANWQWTASTGTDTVAVRIFDPVSQMAKYDSDAAFVTEYVPELRGVDPETIVD
PF03441         GAEWFEELLIDYDPASNNGNWQWVAGTGTDAAPFRIFNPVKQGEKFDPDGEYIRRWVPELAGL-PDKYIH
PF00875         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           WPxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF03441         EP----------------------------------------
PF00875         ------------------------------------------