[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for halo0:AAG19982.1

[Show Plain Result]


## Summary of Sequence Search
    1::536
  131::196     2e-05  45%  354 aa  PF01266 DAO "FAD dependent oxidoreductase"
   17::44      7e-05  57%  426 aa  PF01593 Amino_oxidase "Flavin containing amine oxidoreductase"
    1::536

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxVTLLEQHDTVGGRAGVLER
PF01266         ----------------------------------------------------------------------
PF01593         ---------------------------------------------------VTVLEARDRVGGRIRTFRF


                         .         .         *         .         .         .         .:140
query           DGFRFDTGPxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01266         ----------------------------------------------------------------------
PF01593         DGFTFDLGP-------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01266         ----------------------------------------------------------------------
PF01593         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxDLNGNVFYPEGGIAGVVDALAELAVEQGATIETGVGVNAISGRRGE
PF01266         ------------------------DLLGGLYYPDGGTARLVRALARAAEEAGVEIRTGTEVTGIEREGGG
PF01593         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           FTLATDDGTRTTDLVVxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01266         VTVRTEDGEIRADVVV------------------------------------------------------
PF01593         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01266         ----------------------------------------------------------------------
PF01593         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01266         ----------------------------------------------------------------------
PF01593         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01266         ----------------------------------------------
PF01593         ----------------------------------------------