[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for halo0:AAG19034.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1fg3A.bssp"
#ERROR : Can't open dsspfile "1vp4A.bssp"
#ERROR : Can't open dsspfile "1u08A.bssp"
#ERROR : Can't open dsspfile "1b5oA.bssp"
#ERROR : Can't open dsspfile "2gb3A1.bssp"
#ERROR : Can't open dsspfile "1d2fA.bssp"
#ERROR : Can't open dsspfile "1b8gA.bssp"
#ERROR : Can't open dsspfile "1lc5A.bssp"
#ERROR : Can't open dsspfile "1c7nA.bssp"
#ERROR : Can't open dsspfile "1h1cA.bssp"
#ERROR : Can't open dsspfile "1bw0A.bssp"
#ERROR : Can't open dsspfile "1dtyA.bssp"
#ERROR : Can't open dsspfile "1aamA.bssp"
#ERROR : Can't open dsspfile "1cl1A.bssp"
#ERROR : Can't open dsspfile "1c8nA.bssp"
#ERROR : Can't open dsspfile "1fc4A.bssp"
#ERROR : Can't open dsspfile "1iugA.bssp"
#ERROR : Can't open dsspfile "1ecxA.bssp"
#ERROR : Can't open dsspfile "1h0cA.bssp"
#ERROR : Can't open dsspfile "1pmmA.bssp"
#ERROR : Can't open dsspfile "1xl7A1.bssp"
#ERROR : Can't open dsspfile "2govA1.bssp"
#ERROR : Can't open dsspfile "2bwnA1.bssp"
#ERROR : Can't open dsspfile "1qz9A.bssp"
#ERROR : Can't open dsspfile "1agxA.bssp"
#ERROR : Can't open dsspfile "1v72A1.bssp"
#ERROR : Can't open dsspfile "1vefA1.bssp"
#ERROR : Can't open dsspfile "1s2bA.bssp"
#ERROR : Can't open dsspfile "1b9hA.bssp"
#ERROR : Can't open dsspfile "2fn6A1.bssp"
#ERROR : Can't open dsspfile "3bc8A1.bssp"
#ERROR : Can't open dsspfile "1v8dA.bssp"
#ERROR : Can't open dsspfile "1c0nA.bssp"
#ERROR : Can't open dsspfile "1cs1A.bssp"
#ERROR : Can't open dsspfile "1mdoA.bssp"
#ERROR : Can't open dsspfile "1gbnA.bssp"
#ERROR : Can't open dsspfile "1ohvA.bssp"
#ERROR : Can't open dsspfile "1wytB1.bssp"
#ERROR : Can't open dsspfile "1m32A.bssp"
#ERROR : Can't open dsspfile "1ei7A.bssp"
#ERROR : Can't open dsspfile "1gpcA.bssp"
#ERROR : Can't open dsspfile "2hevF1.bssp"
#ERROR : Can't open dsspfile "2cfbA1.bssp"
#ERROR : Can't open dsspfile "2igsA1.bssp"
#ERROR : Can't open dsspfile "2e7iA1.bssp"
#ERROR : Can't open dsspfile "1jg8A.bssp"
#ERROR : Can't open dsspfile "1w9gA1.bssp"
#ERROR : Can't open dsspfile "1nc7A.bssp"
#ERROR : Can't open dsspfile "1fhlA.bssp"
#ERROR : Can't open dsspfile "1qz8A.bssp"
#ERROR : Can't open dsspfile "1gr0A2.bssp"
#ERROR : Can't open dsspfile "1svvA.bssp"
#ERROR : Can't open dsspfile "1ynfA1.bssp"
#ERROR : Can't open dsspfile "1ax4A.bssp"
#ERROR : Can't open dsspfile "1lk9A.bssp"
#ERROR : Can't open dsspfile "1o61A.bssp"
#ERROR : Can't open dsspfile "1vk9A.bssp"
#ERROR : Can't open dsspfile "1c4kA2.bssp"
#ERROR : Can't open dsspfile "1elqA.bssp"
#ERROR : Can't open dsspfile "2aeuA1.bssp"
#ERROR : Can't open dsspfile "2bkwA1.bssp"
#ERROR : Can't open dsspfile "1tzzA1.bssp"
#ERROR : Can't open dsspfile "1sf2A.bssp"
#ERROR : Can't open dsspfile "1bj4A.bssp"
#ERROR : Can't open dsspfile "1d7rA.bssp"
#ERROR : Can't open dsspfile "1wytA1.bssp"
#ERROR : Can't open dsspfile "2z67A1.bssp"

## Summary of PDB Search
:373
    2e-43  23%  1fg3A  [c.67.1.1] HISTIDINOL PHOSPHATE AMINOTRANSFERASE
    1e-42  22%  1vp4A  [c.67.1.1] AMINOTRANSFERASE, PUTATIVE
    4e-40  26%  1u08A  [c.67.1.1] HYPOTHETICAL AMINOTRANSFERASE YBDL
    1e-39  37%  1b5oA  [c.67.1.1] PROTEIN (ASPARTATE AMINOTRANSFERASE)
    1e-39  29%  2gb3A1 [c.67.1.1] ASPARTATE AMINOTRANSFERASE A:4 -- 392
    3e-36  14%  1d2fA  [c.67.1.3] MALY PROTEIN
    9e-36  18%  1b8gA  [c.67.1.4] PROTEIN (1-AMINOCYCLOPROPANE-1-CARBOXYLATE
    5e-35  15%  1lc5A  [c.67.1.1] L-THREONINE-O-3-PHOSPHATE DECARBOXYLASE
    4e-34  16%  1c7nA  [c.67.1.3] CYSTALYSIN
    6e-34  17%  1h1cA  [c.67.1.1] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    2e-33  23%  1bw0A  [c.67.1.1] PROTEIN (TYROSINE AMINOTRANSFERASE)
    1e-32   9%  1dtyA  [c.67.1.4] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE
    9e-31  13%  1aamA  [c.67.1.1] ASPARTATE AMINOTRANSFERASE
    2e-30  12%  1cl1A  [c.67.1.3] CYSTATHIONINE BETA-LYASE
    3e-29   5%  1c8nA  [b.121.4.7] COAT PROTEIN
    2e-28  14%  1fc4A  [c.67.1.4] 2-AMINO-3-KETOBUTYRATE CONENZYME A LIGASE
    6e-28  17%  1iugA  [c.67.1.3] PUTATIVE ASPARTATE AMINOTRANSFERASE
    2e-27  12%  1ecxA  [c.67.1.3] AMINOTRANSFERASE
    5e-26  13%  1h0cA  [c.67.1.3] ALANINE--GLYOXYLATE AMINOTRANSFERASE
    1e-25  12%  1pmmA  [c.67.1.6] GLUTAMATE DECARBOXYLASE BETA
    3e-25   8%  1xl7A1 [c.43.1.3] PEROXISOMAL CARNITINE O-OCTANOYLTRANSFERASE A:11
    4e-25   8%  2govA1 [d.60.1.4] HEME-BINDING PROTEIN 1 A:7 -- 190
    4e-25  11%  2bwnA1 [c.67.1.4] 5-AMINOLEVULINATE SYNTHASE A:2 -- 397
    5e-25  17%  1qz9A  [c.67.1.3] KYNURENINASE
    6e-25   7%  1agxA  [c.88.1.1] GLUTAMINASE-ASPARAGINASE
    2e-24  13%  1v72A1 [c.67.1.1] ALDOLASE A:6 -- 350
    7e-24  13%  1vefA1 [c.67.1.4] ACETYLORNITHINE/ACETYL-LYSINE AMINOTRANSFERASE
    3e-22  14%  1s2bA  [b.29.1.20] SCYTALIDOPEPSIN B
    2e-21  22%  1b9hA  [c.67.1.4] PROTEIN (3-AMINO-5-HYDROXYBENZOIC ACID SYNTHASE)
    5e-21  15%  2fn6A1 [c.67.1.4] AMINOTRANSFERASE A:2 -- 372
    2e-20  11%  3bc8A1 [c.67.1.9] O-PHOSPHOSERYL-TRNA(SEC) SELENIUM TRANSFERASE
    2e-19  10%  1v8dA  [c.140.1.1] HYPOTHETICAL PROTEIN (TT1679)
    2e-19  14%  1c0nA  [c.67.1.3] PROTEIN (CSDB PROTEIN)
    3e-19  16%  1cs1A  [c.67.1.3] PROTEIN (CYSTATHIONINE GAMMA-SYNTHASE)
    5e-19  20%  1mdoA  [c.67.1.4] ARNB AMINOTRANSFERASE
    7e-18  14%  1gbnA  [c.67.1.4] ORNITHINE AMINOTRANSFERASE
    4e-17  12%  1ohvA  [c.67.1.4] 4-AMINOBUTYRATE AMINOTRANSFERASE
    3e-16  17%  1wytB1 [c.67.1.7] GLYCINE DEHYDROGENASE SUBUNIT 2 (P-PROTEIN) B:2
    4e-16  12%  1m32A  [c.67.1.3] 2-AMINOETHYLPHOSPHONATE-PYRUVATE
    6e-16  12%  1ei7A  [a.24.5.1] COAT PROTEIN
    3e-15   9%  1gpcA  [b.40.4.7] PROTEIN (CORE GP32)
    5e-15   7%  2hevF1 [b.22.1.1] TUMOR NECROSIS FACTOR LIGAND SUPERFAMILY MEMBER
    5e-15  11%  2cfbA1 [c.67.1.4] GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE A:19 --
    8e-15  10%  2igsA1 [d.2.1.11] HYPOTHETICAL PROTEIN A:4 -- 215
    1e-14  23%  2e7iA1 [c.67.1.9] SEP-TRNA:CYS-TRNA SYNTHASE A:8 -- 371
    2e-13  19%  1jg8A  [c.67.1.1] L-ALLO-THREONINE ALDOLASE
    2e-13   8%  1w9gA1 [d.330.1.1] ENHANCER OF RUDIMENTARY HOMOLOG A:1 -- 103
    3e-13  11%  1nc7A  [b.123.1.1] HYPOTHETICAL PROTEIN TM1070
    3e-13   5%  1fhlA  [c.1.8.3] BETA-1,4-GALACTANASE
    1e-12  11%  1qz8A  [b.140.1.1] POLYPROTEIN 1AB
    2e-12  21%  1gr0A2 [d.81.1.3] MYO-INOSITOL-1-PHOSPHATE SYNTHASE A:201 -- 311
    7e-12  14%  1svvA  [c.67.1.1] THREONINE ALDOLASE
    2e-11  17%  1ynfA1 [d.126.1.7] SUCCINYLARGININE DIHYDROLASE A:2 -- 441
    5e-11  17%  1ax4A  [c.67.1.2] TRYPTOPHANASE
    6e-11  13%  1lk9A  [c.67.1.1] ALLIIN LYASE
    9e-11  22%  1o61A  [c.67.1.4] AMINOTRANSFERASE
    1e-10   7%  1vk9A  [c.97.1.3] CONSERVED HYPOTHETICAL PROTEIN TM1506
    2e-08  20%  1c4kA2 [c.67.1.5] PROTEIN (ORNITHINE DECARBOXYLASE) A:108 -- 569
    9e-08  19%  1elqA  [c.67.1.3] L-CYSTEINE/L-CYSTINE C-S LYASE
    2e-07  14%  2aeuA1 [c.67.1.8] HYPOTHETICAL PROTEIN MJ0158 A:9 -- 374
    2e-07  13%  2bkwA1 [c.67.1.3] ALANINE-GLYOXYLATE AMINOTRANSFERASE 1 A:3 -- 384
    2e-07   8%  1tzzA1 [c.1.11.2] HYPOTHETICAL PROTEIN L1841 A:1146 -- 1392
    6e-07  19%  1sf2A  [c.67.1.4] 4-AMINOBUTYRATE AMINOTRANSFERASE
    2e-06  17%  1bj4A  [c.67.1.4] PROTEIN (SERINE HYDROXYMETHYLTRANSFERASE)
    1e-05  24%  1d7rA  [c.67.1.4] PROTEIN (2,2-DIALKYLGLYCINE DECARBOXYLASE
    2e-05  22%  1wytA1 [c.67.1.7] GLYCINE DEHYDROGENASE (DECARBOXYLATING) SUBUNIT
    7e-04  20%  2z67A1 [c.67.1.9] O-PHOSPHOSERYL-TRNA(SEC) SELENIUM TRANSFERASE A:1
:373

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MTEFSDRVAQVSISGIRAVFEAAGEDAINLGLGQPDFPTPDHARQAAVDAIESGAADGYTSNRGTAALVD
1fg3A           ------------------------------------------------------QLTQQTLNRYPECQPK
1vp4A           ---ISKIGQNXKSSIIREILKFADKDAISFGGGVPDPETFPRKELAEIEIIEKEYHYQYSTTEGDPVLKQ
1u08A           ---PQSKLPQLGTTIFTQMSAAQQHQAINLSQGFPDFDGPRYLQERLAHHVAQGAN-QYAPMTGVQALRE
1b5oA           MRGLSRRVQAMKPSATVAVNAKAGVDLVALTAGEPDFDTPEHVKEAARRALAQGK-TKYAPPAGIPELRE
2gb3A1          ---FSDRVLLTEESPIRKLVPFAGVRIHHLNIGQPDLKTPEVFFERIYENKPEVVYYSHSAG--IWELRE
1d2fA           ---------------------------LPFTISDMDFATAPCIIEALNQRLMHGV--FGYSRWKNDEFLA
1b8gA           ---LSRNATSSYFLGWQEYEKNPTNGIIQMGLAENQLCFEAAAFKKNGESIFAELA-LFQDYHGLPAFKK
1lc5A           -----------------TVLGISPDQLLDFSANINPLGMPVSVKRALIDNLDCI---ERYPDADYFHLHQ
1c7nA           MIYDFTTKISRKNLGSLKWDLMYGNEVVPLSVADMEFKNPPELIEGLKKYLDET---VLGYTGPTEEYKK
1h1cA           ------------IAKRAYPYETEKRDKTYLALNENPFPFPEDLVDEVFRRLNSDAL-RIYYDSPDEELIE
1bw0A           ---SMSNHAGLVFNPIRTVSDNAKPSPIKLSVGDPTLDKNLLTSAAQIKKLDSQECNGYFPTVGSPEARE
1dtyA           ---------------MKSQIDAMSHVMFGEITHAPAIELCRKLVAMTPQPLE----CVFLADSGSVAVEV
1aamA           -----ENITAAPADPILGLADLFRPGKINLGDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGR
1cl1A           ---------------VNAGRSKYTLGAVNSVIQRASSLVFDSVEAKKHATRNRANG-ELFYGRRGTLTHF
1c8nA           ----------------------------------------------------------------------
1fc4A           ------------------ITVADGSHVINFCANNYLGLANHPDLIAAAKAGXDSHGASVRFICGTQDSHK
1iugA           -----------------------------------LTPGPVRLHPKALEALARPQL--HHRTEAAREVFL
1ecxA           ----------------------------NNATTRVDDRVLEEMIVFYREKYGNPNS-AHGMGIEANLHME
1h0cA           ---------------------------------KLLVTPPKALLKPLMAAG--GLQMIGSMSKDMYQIMD
1pmmA           -----SKRFPLHEMRDDVAFQIIGNARQNLATFCQTWDDEN-VHKLMDLSINKNWID-KEEYPQSAAIDL
1xl7A1          --------------------LRQLTYIHKKCSNEPVGPSIAALTSEERTRWAKAREYLISLDPENLTLLE
2govA1          --------------------ETWPWQVLSTGGKEDVSYEERACEGGKFATVEVTDKPVEALREAMPKIMK
2bwnA1          ----------AFPKAQWNRPDGGKQDITVWCGNDYGMGQHPVVLAAMHEALEAVGAGGTRNISGTTAYHR
1qz9A           RNDCLALDAQDSLAPLRQQFALP-EGVIYLGNSLGARPVAALARAQAVIAEEWGNLIRSWNSAGWRDLSE
1agxA           --------------------VHTDKPIVLVGSMRPSTALSADGPLNLYSAVALASSNEAKNKGVMVLMND
1v72A1          -------------------------PALGFSSDNIAGASP-EVAQALVKHSSGQAG-PYGTDELTAQVKR
1vefA1          -------------------------DCVGGYGVANLGHGNPEVVEAVKRQAETL---MAMPQTLPTPMRG
1s2bA           ----------------------------------------------------------VESNWGGAIL--
1b9hA           ----------------------------------PEFPAWPQYDDAERNGLVRALEQGRMGGDEVNSFER
2fn6A1          ----------------------------EFAYSEPCLD--KEDKKAVLEVLNSKQ---LTQGKRSLLFEE
3bc8A1          ----------------------------NCGVGEREGRVASALVARRHYRFIHGRQPKAAGSSLLNKITN
1v8dA           ------------AEEFLQAFPMAPGSLFVLGGSTSEVLGTRPSLEAAHAVLEGLERGVHVAVQACEHLNR
1c0nA           ------------------SREVNGLPLAYLDSAASAQKPSQVIDAEAEFYRHAVHAGAHTLSAQATEKME
1cs1A           ----------------IAVRSGLNDDEQYGCVVPPIHLSSTYNFTGFNEPRAHDYSRRG--NPTRDVVQR
1mdoA           -----------------------------LPFSRPAXG--AEELAAVKTVLDSG---WITTGPKNQELEA
1gbnA           ------------------LWDVEGRKYFDFLSSVNQGHCHPKIVNALKSQVDKL---TLTSRAFYNNVLG
1ohvA           --------------------------------KGMSQLITMACGSCSNENAFKTIMWYRSKERGQSAFSK
1wytB1          -------------TLVRHYTGLSRRQVGVDTTFYPLGSCTMKYNPKLHEEAARLFADLPRTAQGALRLMW
1m32A           -----------------------------LLLTPGPLTTSRTVKEAXLFDSCTWDDDYNIG------VVE
1ei7A           ----------------------------------------------------------------------
1gpcA           --------------------------------------------------FSSEDKGEWKLKLDNAGNGQ
2hevF1          ------------------------KVQFTEYKKEKGFILTSQKEDEIMKVQDNSVIINCDGFYLISLKGY
2cfbA1          ------------------IWDVDGNQYIDYVGSWGPAIVG-HAHPEVIDALHAALEKGTSFGAPCLLENI
2igsA1          ----------------------------------------------------------------------
2e7iA1          -------------------------DFINIDPLQTGGKLTEEARQALL---------------EWPPIHD
1jg8A           ---------------------------------------PTEEMRKAMAQAEVGD-DVYGEDPTINELER
1w9gA1          ----------------------------------------------------------------------
1nc7A           ----------------------------------------------------------------------
1fhlA           ----------------------------------------------------------------------
1qz8A           ----------------------------------------------------------------------
1gr0A2          ---------------------------------------------------------------GATITHR
1svvA           ------------------------------------------------------DNXTQHAGYGQDSHCA
1ynfA1          ----------------------SELKVFDLRESXANGGGPACLRLRVVLTEEERRAV-NPAVXXNDTLFN
1ax4A           --------------------KEAGYNPFLLPSSAVYIDLTDSGTNAMSDHQWAAMIEAYAGSRNYYDLKD
1lk9A           ----------------------------------------------------------------------
1o61A           --------------------------------------------KYIEEVFKSNAPLGEFVNRFEQSVKD
1vk9A           ----------------------------------------------------------------------
1c4kA2          ----------------------------------------------------------------------
1elqA           -------------------------------------ILPTVALEAITAMYGYLQENGPFSIAANQHIQQ
2aeuA1          ---------------------------------------------------------------------S
2bkwA1          -------------------------------------ILSGAVQKALDVPSLGHTSPEFV--SIFQRVLK
1tzzA1          -------------------------PRVFVYA-AGGYYGLSMLRGEMRGYLDRGYVVKMKIGGAPIEEDR
1sf2A           ----------------------------------------------------------------------
1bj4A           ------------------------------------------VLEALGSCLNNKYSEGYPGQRYYGELET
1d7rA           ----------------------------------------------------------------------
1wytA1          -----------------------------LGGGVRSHHVPPVVQALAARG------EFLTASQGVLQATF
2z67A1          -----------------------------------------------------------------YALTN


                         .         .         *         .         .         .         .:140
query           AIVEKHARDQGVDVAPAGVIATAGGSEALHLAMEAHVDPGDEVLFPDPGFVSYDALTRMAGGNPVGLPLR
1fg3A           AVIENYAQYAGVK--PEQVLVSRGADEGIELLIRAFCEPGDAILYCPPTYGXYSVSAETIGVECRTVPTL
1vp4A           QILKLLERXYGITGLDEDLIFTVGSQQALDLIGKLFLDDESYCVLDDPAYLGAINAFRQYLANFVVVPLE
1u08A           AIAQKTERLYGYQPDADSITVTAGATEALYAAITALVRNGDEVICFDPSYDSYAPAIALSGGIVKRMALP
1b5oA           ALAEKFRRENGLSVTPEETIVTVGGSQALFNLFQAILDPGDEVIVLSPYWVSYPEMVRFAGGVVVEVETL
2gb3A1          AFASYYKRRQRVDVKPENVLVTNGGSEAILFSFAVIANPGDEILVLEPFYANYNAFAKIAGVKLIPVTRR
1d2fA           AIAHWFSTQHYTAIDSQTVVYGPSVIYMVSELIRQWSETGEGVVIHTPAYDAFYKAIEGNQRTVMPVALE
1b8gA           AMVDFMAEGNKVTFDPNHLVLTAGATSANETFIFCLADPGEAVLIPTPYYPGFDRDLKWRTGVEIGFQIT
1lc5A           ALARHHQVP------ASWILAGNGETESIFTVA--SGLKPRRAMIVTPGFAEYGRALAQSGCEIRRWSLR
1c7nA           TVKKWMKDRHQWDIQTDWIINTAGVVPAVFNAVREFTKPGDGVIIITPVYYPFFMAIKNQERKIILLEKD
1h1cA           KILSYLDTDF-------LSKNNVSVGNGADEIIYVXXLXFDRSVFFPPTYSCYRIFAKAVGAKFLEVPLT
1bw0A           AVATWWRNSFVHKEELKSVVLCSGGSHGILMAITAICDAGDYALVPQPGFPHYETVCKAYGIGMHFYNCR
1dtyA           AMKMALQYWDAKGEARDRFLTFRNGYHGDTFGAMSVCDPDNSMHSLWKGYLPENLFAPAPQSRMDGEW-D
1aamA           CTQELLFGKGSALINDKRTAQTPGGTGALRVAADAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYY
1cl1A           SLQQAMCELEGGAGC----VLFPCGAAAVANSILAFIEQGDHVLMTNTAYEPSQDFCSKILSKLGVTT-S
1c8nA           ----------STVVSNLNLTPIALAYTVQSLPLIA--TQPAWLGTIADNYSKWRWVSLRIIYSPKPTTTS
1fc4A           ELEQKLAAFLGXED----AILYSSCFDANGGLFETLLGAEDAIISDALNHASIIDGVRLCKAKRYRYANN
1iugA           KARGLLREAFRTE--GEVLILTGSGTLAMEALVKNLFAPGERVLVPVYGKFSERFYEIALEAGLVVERLD
1ecxA           KAREKVAKVLGVS--PSEIFFTSCATESINWILETFEKRKRTIITTPIEHKAVLETMKYLSMKGFKVPVD
1h0cA           EIKEGIQYVFQTR-NPLTLVISGSGHCALEAALVNVLEPGDSFLVGANGIWGQRAVDIGERIGVHPMTKP
1pmmA           RCVNMVADLWHAPAPKNGLGGMAMKWRWRKRMEAAGKPTDKPNLVCGPVQICWHKFARYWDVELREIPMR
1xl7A1          KIQTSLFVYSIE------DSSPHATPEEYSQVFEXLLGGDPSVRWGDKSYNLISFANGIFGCCCDHAPYD
2govA1          YVGGTNDKGVGMGMTVPVFAVFPNEDGSLQKKLKVWFRIPNQFQGSPPAP--SDESVKIEEREGITVYST
2bwnA1          RLEAEIAGLHQKEA----ALVFSSAYNANDATLSTLRVLFPGLIIYSDSLNHASMIEGIKRNAGPKRIFR
1qz9A           RLGNRLATLIGAR--DGEVVVTDTTSINLFKVLQATRSPERRVIVTETSNFPTDLYIAEGLADMLQQGYT
1agxA           SIFAARDVTKGI----NIHTHAFVSQWGALGTLVEGKPYWFRSSVKKHTNNSEFNIEKIQGDALPGVQIY
1v72A1          KFCEIFE-------RDVEVFLVPTGTAANALCLSAMTPPWGNIYCHPASHINNDECGAPEFFSNGAKLMI
1vefA1          EFYRTLTAILPPE--LNRVFPVNSGTEANEAALKRAHTGRKKFVAAMRGFSGRTMGSLSVTWEPKVEPVE
1s2bA           -IGSDFDTVSATANVPASGGSSAAGTAWVDTCQTAILQTGFDWYGDGTYDAWYEWEVSIT------ISEG
1b9hA           EFAAHHG--------AAHALAVTNGTHALELALQMGVGPGTEVIVPAFTFISSSQAAQRLGA--VTVPVD
2fn6A1          ALCEFLGVKH--------ALVFNSATSALLTLYRNFSEFSAEIITTPISFVATANMLLESGYTPVFAGIK
3bc8A1          SLVLNVIKLAGVHSVAS-CFVVPMATGMSLTLCFLKRPKAKYIIWPRIDQKSCFKSMVTAGFEPVVVLEG
1v8dA           AL--VVERETARAFGKEEVAVFPHPKAGGAKATAAFLRFRDPVMVESLKAQAHGGMDIGGVLIGMHLRPL
1c0nA           NVRKRASLFINARSAEFVRGTTEGINLVANSWGNSNVRAGDNIIISQMEHHANIVPWQMLCARLRVIPLN
1cs1A           ALAELEGG--------AGAVLTNTGMSAIHLVTTVFLKPGDLLVAPHDCYGGSYRLFDSLAKRGCYRVLF
1mdoA           AFCRLTGNQ-------YAVAVSSATAGXHIALXALGIGEGDEVITPSXTWVSTLNXIVLLGANPVXVDVR
1gbnA           EYEEYITKLFNYHKV----LPMNTGVEAGETACKLARKWGYTVKGIQKYKAKIVFAAGNFWGRPFMPGFD
1ohvA           EELETCMINQAPGCPDYSILSFMGAFHCLATTHSKAIHKIDIPSFDWPIAPFPRLKYPLEEFVKENQQEE
1wytB1          ELGEYLKALTG---MDAITLEPAAGAHGELTGILIEGRTRRVVLVPDSAHGSNPATASMAGYQVREIPSG
1m32A           QIRQQLTALATASEGYTSVLLQGSGSYAVEAVLGSALGPQDKVLIVSNGAYGARXVEGLXGIAHHAYDCG
1ei7A           -------------------------------------------------WKPSPQVTVRFPDSDFKVYRY
1gpcA           AVIRFLPSKNDEQAPFAILVNHGFKKNG------------------KWYIETCSSTHGDYDSCPVCQYIS
2hevF1          FSQEVDISLHYQKDE----EPLFQLKKVRSVNMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQN
2cfbA1          LAEMVIAAVPSVEMV----RFVNSGTEACMAVLRRAYTQREKVIKFEGCYHGHAATLTAPYNDLEAV---
2igsA1          ----------------------------------------------------------------------
2e7iA1          FIHNQLPKFLGCDVA----RVTNGAREAKFAVMHSLAKKDAWVVMDENCHYSSAAERAGLNIALVPKTDY
1jg8A           LAAETFGKEAAL--------FVPSGTMGNQVSIMAHTQRGDEVILEADSHIFWYAMAVLSGVMPHPVPGK
1w9gA1          -----------------------------------------------HTILLVQPTKRPEGRTYADYE--
1nc7A           ----------------------------------------------------------------------
1fhlA           ----------------------------------------------------------LLLLEDEGYSYK
1qz8A           -------------VALRQMSCAAGTTQTACTDDYYNNSKGGRFVLALLSDHQDLKWARFPGTGTIYTELE
1gr0A2          VLAKLF-EDRGVQLDRTMQLNVGGNMDFLNMLEDVHIGPSDHVGWLDDRKWAY---VRLEGRAFGDVPLN
1svvA           KAARLIGELLERP--DADVHFISGGTQTNLIACSLALRPWEAVIATQLGHISTHETGAIEAGHKVVTAPC
1ynfA1          ALNDWVDRYYRDRLTAADLADLREGREALDVLSQLLN-LGSVY---------------------------
1ax4A           KAKELF----NYDY----IIPAHQGRGAENILFPVLLKAKNPVFISNFHFDTTAAHVELNGCKAINIDWK
1lk9A           ----------------------------------------------------------------------
1o61A           YSKSENA------------LALNSATAALHLALRVGVKQDDIVLASSFTFIASVAPICYLKAKPVFIDCD
1vk9A           ----------------------------------------------------------------------
1c4kA2          --------------ADKTYFVLGGSSNANNTVTSALVSNGDLVLFDRNNHKSYNSALAMAGGRPVYLTNR
1elqA           LIAQRQALAETFNVDPNTITITDNVTTGCDIVLWGDWHQGDEILLTDCEHAIVQAIAARFGITYRFFPVA
2aeuA1          SYFAEKVNEYGLGGDENDKCVGFNRTSSAILATILALKPKKVIHYELPGHPSIERSCKIVNAKYFE----
2bkwA1          NTRAVFKSAAASK--SQPFVLAGSGTLGWDIFASNFILPNKNVLVVSTGTFSDRFCLRSYGAQVDVVPLK
1tzzA1          MRIEAVLEEIGKDAQLAVDANGRFNLETGIAYAKMLRDYPLFWYEEVGDPLDYALQAALAEFYPGPMATG
1sf2A           -----------------------------------------------------------------GISED
1bj4A           LCQKRALQAYKLDPQCWGVNVQPSGSPANFAVYTALVEPHGRIMGLDLPDGGHLTHGFMTDKKKISATSI
1d7rA           ----------------------------------------------------------------------
1wytA1          EYQTMIAELAGLEIANAS--MYDGATALAEGVLLALRETGRMGVLVSPEYRAVRAYLEAVGAKLLTLPLE
2z67A1          KILESFFKQLGLNVH---AIATPISTGXISLCLSARKKYGSNVIYPYASHKSPIKAVSFVGXNXRLVETG


                         +         .         .         .         .         *         .:210
query           DDLTLAPETVEDHITDDTAAFVVNSPANPTGAVQSPADMRAFARIADEHDVLCISDEVYEHIVFEGEHRS
1fg3A           DNWQLDLQGISDKL-DGVKVVYVCSPNNPTGQLINPQDFRTLLELTRGKAIV-VADEAYIEFCPQASLAG
1vp4A           DDGXDLNVLKNGKIKQVKFIYVVSNFHNPAGVTTSLEKRKALVEIAEKYDLFIVEDDPYGALRYEGETVD
1u08A           PHFRVDWQEFAALLSERTRLVILNTPHNPSATVWQQADFAALWQAIAGHEIFVISDEVYEHINFSQQGHA
1b5oA           PEFVPDPERVRRAITPRTKALVVNSPNNPTGAVYPKEVLEALARLAVEHDFYLVSDEIYEHLLYEGEHFS
2gb3A1          EEGFAIPQNLESFINERTKGIVLSNPCNPTGVVYGKDEXRYLVEIAERHGLFLIVDEVYSEIVFRGEFAS
1d2fA           KQADGWFCDMGKLAKPECKIMLLCSPQNPTGKVWTCDELEIMADLCERHGVRVISDEIHMDMVWGEQPHI
1b8gA           ETALEEAYQEAEKRNLRVKGVLVTNPSNPLGTTMTRNELYLLLSFVEDKGIHLISDEIYSGTAFSSSFIS
1lc5A           EAGWQLTDAILEALTPDLDCLFLCTPNNPTGLLPERPLLQAIADRCKSLNINLILDEAFIDFIPHETGF-
1c7nA           GYYTIDFQKLEKLSKDKNNKLLFCSPHNPVGRVWKKDELQKIKDIVLKSDLMLWSDEIHFDLIMPGYEHT
1h1cA           KDLRI-----PEVNVGEGDVVFIPNPNNPTGHVFEREEI----ERILKTGAFVALDEAYYEFHGESYVDF
1bw0A           PDWEADLDEIRRLKDDKTKLLIVTNPSNPCGSNFSRKHVEDIVRLAEELRLPLFSDEIYAGMVFKGTFTS
1dtyA           ERDMVGFARLMAAHRHEIAAVIIEPIVQGAGGMRHPEWLKRIRKICDREGILLIADEIATGFGRTGKLFA
1aamA           DAENHTLDFDANEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDA
1cl1A           WFDPLIGADIVKHLQPNTKIVFLESPGSITMEVHDVPAIVAAVRSVVPDAIIMIDNTWAAGVLFKA----
1c8nA           GTVAMCLSYDRNDVAPGSRVQLSQTYKAINFPPYAGYDGAAILNTDVTPTSAIYVDVDVTRFDKAWYSTI
1fc4A           DXQELEARLKEAREAGAHVLIATDGVFSXDGVIA---NLKGVCDLADKYDALVXVDDSHAVGFVGENGRG
1iugA           YPYGD-TPRPEDVAKEGYAGLLLVHSETSTGALADLPALAR-AFKEKNPEGLVGADMVTSLLVGEVAL--
1ecxA           SRGVVKLEELEKLVDEDTFLVSIMAANNEVGTIQPVEDV---TRIVKKKNKETLVHVDAVQTIGKI----
1h0cA           GGHYTLQEVEEGLAQHKPVLLFLTHGESSTG---VLQPLDGFGELCHRYKCLLLVDSVASLGGTPLYMDR
1pmmA           GQLFMDPKRMIEACDENTIGVVPTFGVTYTGNYEFPQPLHDALDKDTGIDIDMHIDAASGGFLAPVAPDI
1xl7A1          AXVXVNIAHYVDERVLETEGRWKGSEKVRDIPLPEELV------FTVDEKILNDVSQAKAQHLKA-----
2govA1          QFGGYAKEADYVAHATQLRTTLEGTPATYQGDVYYCAGYDPPMKPYGRRNEVWLVK--------------
2bwnA1          NDVAHLRELIAADDPAAPKLIAFESVYSMDGDFG---PIKEICDIAEEFGALTYIDEVHAVGMYGPRGAA
1qz9A           LRLVDSPEELPQAIDQDTAVVMLTHVNYKT---GYMHDMQALTALSHECGALAIWDLAHSAGAVPVDL--
1agxA           GSDNMMPDAYQAFAKAGVKAIIHAGTGNGSM---ANYLVPEVRKLHDEQGLQIVRSSRVAQGFV-LRNAE
1v72A1          VRLRERTREKVGDVHTTQPACVSITQATEVGSIYTLDEIEAIGDVCKSSSLGLHMDGSRFANALSLGCSP
1vefA1          FIPYNDVEALKRAVDEETAAVILEPVQGEGGVRPATPEFRAAREITQEKGALLILDEIQTGMGRTG----
1s2bA           DSI----QMSVTATSDTSGSATLEN--LTTGQKVSKSSNESSGSLCRTNAEFIIEDFEECNSNGSDCEFV
1b9hA           VDAATYNLDPEAVAAAVTPRTKVIMPVHMAGLM---ADMDALAKISADTGVPLLQDAAHAHGARWQGK--
2fn6A1          NDGNIDELALEKLINERTKAIVSVDYAGK------SVEVESVQKLCKKHSLSFLSDSSHALGSEYQ-NKK
3bc8A1          DELRTDLKAVEAKIQELGPEHICLHSTTACFAPRVPDRLEELAVICANYDIPHVVNNAYGLQSSKCMHLI
1v8dA           RLSVRKIGEAVLLAAKRPKLVGGARAVYTRE-----EMLKKLEEF-------------------------
1c0nA           PDGTLQLETLPTLFDAATRLLAITHVSNVLGTEN---PLAEMITLAHQHGAKVLVDGAQAVMHHPVDVQ-
1cs1A           VDQ-GDEQALRAALAEKPKLVLVESPSNPL---LRVVDIAKICHLAREVGAVSVVDNTFLSPALQNPLAL
1mdoA           DTLXVTPEHIEAAITPQ---TKAIIPVHYAG---APADLDAIYALGERYGIPVIEDAAHATGTSYK----
1gbnA           IIPYNDLPALERALQDPNAAFMVEPIQGEAGVVVDPGYLMGVRELCTRHQVLFIADEIQTGLARTGRWLA
1ohvA           ARCLEEVEDLIRKKKKTVAGIIVEPIQSEGGDNHSDDFFRKLRDISRKHGCAFLVDEVQTGGGSTGKFW-
1wytB1          PEGEVDLEALKRELGPHVAALMLTNPNTLGLF---ERRILEISRLCKEAGVQLYYDGANLNAIM-GWARP
1m32A           EVARPDVQAIDAILNADPTISHIAXVHSETTTG-XLNPIDEVGALAHRYGKTYIVDAXSSFGGIPXDI--
1ei7A           NALDPLVTALLGAFDTRNRIIEVENQANPTTAETLDATRRVATVAIRSAINNLIVELIRGTGSYNRS---
1gpcA           KNDLTDNKEYSLVKRKWANILVVKDPPENEGKVFKYRFGKKKINAMIAVDVEMGETPVDVTCPWEGAN--
2hevF1          ----------------------------------------------------------------------
2cfbA1          -------SRLFEQYPNDIAGVILEPVVGNAGFIPDAGFLEGLRELTKQYGALLVFDEVMTGFRIAYGGA-
2igsA1          ---------------------RQCNPGFVFPEAQTIEAWDIPLRLHPEFGDISKADQQYSTLLAQEIANG
2e7iA1          PDYAITPENFAQTIEETKKRVVLALITYPDGNYGNLPDVKKIAKVCSEYDVPLLVNGAY------AIGRM
1jg8A           NG-AMDPDDVRKAIRPRNIHFIENTHNRSGGRVVPLENIKEICTIAKEHGINVHIDGARIFNASIASGVP
1w9gA1          -SVNECMEGVCKMYEEHL---KRMNPNSPSITYDISQLFDFIDDLA--DLSCLVYRADTQTYQPYN----
1nc7A           ------------HXNGARKWFFPDGPNGKRGYLVSHESLCIXNTGDETAKTFLFEDSKPVVHEVEISPXK
1fhlA           NLNGQTQALETILADAGINSIRQRVWVNPSDGSYDLDYNLELAKRVKAAGMSLYLDLHLSDTWADPSDQT
1qz8A           PPVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ------------------------------
1gr0A2          LEYKLEVW--------------------------------------------------------------
1svvA           PDGKLRVADIESALHENRSKLVYISNTTEVGTQYTKQELEDISASCKEHGLYLFLDRLASALSSPVNDLT
1ynfA1          ----------------------------------------------------------------------
1ax4A           GDFDIKKENIAQHGADNIVAIVSTVTCNSAGGQPSMSNLKEVYEIAKQHGIFVVMDSFCENAYFIKARDP
1lk9A           ----------------------------------------------------------------------
1o61A           ETYNIDVDLLKLAIKEKPKALILTHLYG------NAAKMDEIVEICKENDIVLIED--------------
1vk9A           ------LRSALKIFEKKDLSLLAYSGRSIFESKDSLKPVVELFKRFDNLEGSLVIDKXVGKAAASFLLKX
1c4kA2          NPYGFIGGIYDSDFKVDPERAKWKRPFRLAVIQLGIYNAHEVVKRIGHLCDYIEFDSGYEQFIPMMRNSS
1elqA           ATLNQAAAVLANHLGPKTRLVILSHLLWNTGQVLPLAEIMAVCRHQGNYPVRVLVDGA------------
2aeuA1          ---SDKVGEILNKIDKDTLVII--TGSTMDLKVIELENFKKVINTAKNKEAIVFVDDAGARVRLLFNQPP
2bkwA1          IGESVPLELITEKLSQNSYGAVTVTHVDTSTAVL--SDLKAISQAIKQTETFFVVDAVC------SIGCE
1tzzA1          ENLFS-HQDARNLLRYGGMRPDRDWLQFDCALSYGLCEYQRTLEVLKTHGWSPSR---------------
1sf2A           DAIASIHRIFKNDAAPEDIAAIVIEPVQGEGGASSPAFMQRLRALCDEHGIMLIADEVQSGAGRTGTLFA
1bj4A           DTGYINYDQLEENARLFHPKLIIAGTSCYSR----NLEYARLRKIADENGAYLMADMAISGLVAAGVVPS
1d7rA           AELDYAFDLIDRQSSGNLAAFIAEPILSSGGIIELPDGMAALKRKCEARGMLLILDEA------------
1wytA1          G-----GRTPLPEVGEEVGAVVVQNP-NFLGALE---DLGPFAEAAHGAGALFVAV--------------
2z67A1          DRVYVPVEDIENAIKGNRPCVLSTLTFFPPR---NSDDIVEIAKICENYDIPHIINGAYQNNYYLEKLKK


                         .         .         .         +         .         .         .:280
query           PMEFADTDNVVVVNACSKTYSMTGWRLGWVAASERRAERMLRVHQYVQXXXXXXXXXXXXXXLSGPQGVV
1fg3A           WL--AEYPHLAILRTLSKAFALAGLRCGFTLANEEVINLLXKVIAPYPLSTPVADIAAQAL---SPQGIV
1vp4A           PIFKIGGPERVVLLNTFSKVLAPGLRIGXVAGSKEFIRKIVQAKQSADLCSPAITHRLAARYLERYDLLL
1u08A           SVLAHLRERAVAVSSFGKTYHMTGWKVGYCVAPAPISAEIRKVHQYLTFSVNTPAQLALADMLRAEPEHY
1b5oA           PGRV-APEHTLTVNGAAKAFAMTGWRIGYACGPKEVIKAMASVSSQSTTSPDTIAQWATLEALTNQEAFV
2gb3A1          ALSI-ESDKVVVIDSVSXKFSACGARVGCLITRNEELISHAXKLAQGRLAPPLLEQIGSVGLLNLDDSFF
1d2fA           PWSNVARGDWALLTSGSKSFNIPALTGAYGIIENSSSRDAYLSALKGRDGLSSPSVLALTAHIAQGAPWL
1b8gA           VMEVLKWQRVHVVYSLSKDLGLPGFRVGAIYSNDDMVVAAATKMSSLVSSQTQHLLSAMLSDKKLTKNYI
1lc5A           IPALKDNPHIWVLRSLTKFYAIPGLRLGYLVNSDDAAMARMRRQQMPWSVNALAALAGEVALQDSAW--Q
1c7nA           VFQEQLADKTITFTAPSKTFNIAGMGMSNIIIKNPDIRERFTKSRDATSGMPFTTLGYKACEICYKECWL
1h1cA           LKKY---ENLAVIRTFSKAFSLAAQRVGYVVASEKFIDAYNRVRLP--FNVSYVSQXFAKVALDHREI-F
1bw0A           VADFETTVPRVILGGTAXNLVVPGWRLGWLLYVDPHGNGPSFLEGLKRVGMLVCGPCTVVQAALTPQEHL
1dtyA           CEHA---EIAPDILCLGKALTGGTMTLSATLTTREVAETISDGEAGCFMHGPTFMGNPLACAAANASLAI
1aamA           EGLAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIDANYSNPPAHGASVVATIL
1cl1A           ----LDFGIDVSIQAATXYLVGHDAMIGTAVCNARCWEQLRENAYLMGQMVDADTAYITSRGLRTLGVRL
1c8nA           GTAAFLTAFDQNQFCPCTVHIGSDGGPAVAVPPGDIFFKYVIELI-------------------------
1fc4A           SHEYCDVXGRVDIITGTLGKALGGASGGYTAARKEVVEWLRQSRPYLFSNSLAPAIVAASIKVLEXVEAG
1iugA           -----EAMGVDAAASGSQXGLMCPPGLGFVALSPRALERLKPRGYYLDLARELKAQKEGESAWTPAINLV
1ecxA           PFSLEKLEVDYASFSAHKFHGPKGVGITYIRKGVPIRPLIHGGGQERGLRSGTQNVPGIVGAARIAVEEL
1h0cA           QGIDILYLISFSDKAKKKMYSRKTKPFSFYLDIKWLANFWGCDDQPRMYHHTIPVISLYSLRESIAEQGL
1pmmA           VWDFRLPRVKSISASGHKFGLAPLGCGWVIWRDEEALPQELVFNVDYLGGQIGTFAINFSRPAGQVIAQY
1xl7A1          ----------------------------------------------------------------------
2govA1          ----------------------------------------------------------------------
2bwnA1          ERDGLMHRIDIFNGTLAXAYGVFGGYIAASARMVDAVRSYAPGFIFSTSLPPAIAAGAQASIAFLKTAEG
1qz9A           ----HQAGADYAIGCTYKYLNGGPGSQAFVWVSPQLCDLVPQPLSGWFGHSRQFAMEPRYEPSNGIARYM
1agxA           QPDDKYGWIAAHDLNPQKARLLMALALTKTNDAKEIQNMF------------------------------
1v72A1          AEMTWKAGVDALSFGATKNGVLAAEAIVLFNTSLATEMSYRRKRAGHLSSKMRFLSAQIDAYLTDDLWLR
1vefA1          KRFAFEHFGIVPDILTLAKALGGGVPLGVAVMREEVARSMPKGGHGTTFGGNPLAMAAGVAAIRYLE--R
1s2bA           PFSPAVEFTDCSVTSDGESVSLDDAQITQVIINNQDVTDCSVSGTTV-----------------------
1b9hA           ---RVGELDSIATFSFQNGKLMTAGEGGAVVFPDGETEKYETAFLR------------------------
2fn6A1          VGGFAL----ASVFSFHAIKPITTAEGGAVVTNDSELHEKMKLFRS------------------------
3bc8A1          QQGARVGRIDAFVQSLDXNFMVPVGGAIIAGFNEPFIQDISKMYPGPSLDVLITLLSLGCSGYRKLLKER
1v8dA           ----------------------------------------------------------------------
1c0nA           -----ALDCDFYVFSGHKLYGPTGIGILYVKEALLQEMPPWEGGGS------------------------
1cs1A           G------ADLVLHSCTXYLNGHSDVVAGVVIAKDPDVVTELAWWA-------------------------
1mdoA           --GRHIGARGTAIFSFHAIKNITCAEGGIVVTDNPQFADKLRSLKF------------------------
1gbnA           VDYE---NVRPDIVLLGKALSGGLYPVSAVLCDDDIMLTIKPGEHG---STYGGNPLGCRVAIAALEVLE
1ohvA           AHEHWGLDDPADVMTFSKKMMTGGFFHKEEFRPNAPYRIFNTWLGDPSKNLLLAEVI--------NIIKR
1wytB1          GDMGFD----VVHLNLHKTFTV------------------------------------------------
1m32A           -----AALHIDYLISSANKCIQGVPGFAFVIAREQKLAAC------------------------------
1ei7A           ----------------------------------------------------------------------
1gpcA           ---------------FVLKVKQVSGFSNYDESKFLNQSAIPNIDDES-FQKELFEQMVDLSEMTSKDKSF
2hevF1          ----------------------------------------------------------------------
2cfbA1          ----QEKFGVTPDLTTLGKVIGGGLPVGAYGGRAEIMKMVAPAGPTLSGNPLAMTAGIKTLEILSRPGSY
2igsA1          VTIGFVCNVEILPLLTSXAQNLDRIKARFGSGYLDRFKGSPNVYP-------------------------
2e7iA1          PVSLKEIGADFIVGSGHKSMAASG-PIGVMGMKEEWAEIVLRRSE-------------------------
1jg8A           VKEYAGYADSVMFCLSXGLCAPVG---SVVVGDRDFIERARKARK-------------------------
1w9gA1          ----KDWIKEKIYVLLRRQAQQ------------------------------------------------
1nc7A           SLHLRL----------------------------------------------------------------
1fhlA           TPSGWLGTLKWQLYNYTLEVC-------------------------------------------------
1qz8A           ----------------------------------------------------------------------
1gr0A2          ----------------------------------------------------------------------
1svvA           LADIA-----------------------------------------------------------------
1ynfA1          ----------------------------------------------------------------------
1ax4A           KYKNATIKEVIDMYKYADALTMSAKXDGLVAIRDNEEIFTLARQRCVPMEGFVTYGGLAGRDMAAEEGTE
1lk9A           ---------------MSKFTGHSGSRFGWALIDESVYNNLLNYMTKNTEGTPRETQLRSLKVLKEVVAMV
1o61A           ----------------------------------------------------------------------
1vk9A           KP--DHIHAKVISKPALKLXNEYGQSFSYDEKIPFVLGKD------------------------------
1c4kA2          PLLGPEDPGIIVVQSVHKQTSQIHKKDSHIKGQLRYCDHK------------------------------
1elqA           ----------------------------------------------------------------------
2aeuA1          ALKLAD----LVVTSTDK--LMEGPRGGLLAGKKELVDKI------------------------------
2bkwA1          EFEFDEW-GVDFALTASQXAIGAPAGLSISLCSSRFXDYAL-----------------------------
1tzzA1          ----------------------------------------------------------------------
1sf2A           MEQM---GVAPDLTTFAKSIA-GGFPLAGVTGRAEVMDAVAPGGLG------------------------
1bj4A           PFEHC-----------------------------------------------------------------
1d7rA           ----------------------------------------------------------------------
1wytA1          ----------------------------------------------------------------------
2z67A1          AFKY------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           DEMVAAFEARRDVLLDGLEAMGLDVPTPGGAFYAMPTVPDGWIDEXXXXXXXXXPGSAFGDHGAGTARIS
1fg3A           AERVAQIIAEREYLIAALKEICVEQVFDSETNYILARFKAS-----------------------------
1vp4A           KPTIELYRRKRTVXLNALEEYFSDIPKSEGGLFIWLTLPEGEYAKRKKVFYVPGRVFKVYDEPSPSXRLS
1u08A           LALPDFYRQKRDILVNALNESRLELPCEGTYFLLVDYSVEFCQWLTQEHGVAAIPLSVFCADPFPHKRLC
1b5oA           EMAREAYRRRRDLLLEGLTALGLKAVRPSGAFYVLMDTSPIAPDRLLEAGVAVVPGTDFAAF--GHVRLS
2gb3A1          DFVRETYRERVETVLKKLEEHGKRFTKPSGAFYITAELPVEDAEEXDGETTXVAPLRGFYGLGKKEIRIA
1d2fA           DALRIYLKDNLTYIADKMNAAFLNWQIPQSTYLAWLDLRPLNIDDIEQEKVAIMPGYTYGEEGRGFVRLN
1b8gA           AENHKRLKQRQKKLVSGLQKSGISCLNGNAGLFCWVDMRHLLRSNVYEVHLNISPGSSCHCTEPGWFRVC
1lc5A           QATWHWLREEGARFYQALCQLPLLTVYPGRANYLLLRCEREDIDRLLTQRILIRSCANYPGLDSRYYRVA
1c7nA           DGCIKVIDKNQRIVKDFFEVNHPEIPLIEGTYLQWIDFRALKMDHIHKAQIFFDEGYIFGDGGIGFERIN
1h1cA           EERTKFIVEERERXKSALREXGYRITDSRGNFFXEKEEKERLLEHLRTKNVAVRSFREG-------VRIT
1bw0A           DQIVAKIEESAMYLYNHIGECILAPTMPRGAMYLMSRIDLEKYKLLEEENVQVLPGTIF--HAPGFTRLT
1dtyA           GDWQQQVADIEVQLREQLAPARDAEDVRVLGAIGVVETTHPVNMAALQKFFVEQGVWIRPFGKLIYLMPP
1aamA           TDMRQRIQRMRQLFVNTLQEKGANFIIKQNGMFSFSGLTKEQVLRREEFGVYAVASGRVNVAGMTPDNMA
1cl1A           RQHHESSLKVAEWALPGSKGHEFWKRDFTGSSGLFSFVLKKYLDNFSLFSMAYSWGGYESLILANQPEHI
1c8nA           ----------------------------------------------------------------------
1fc4A           SELRDRLWANARQFREQXSAAGFTLAGADHAIIPVXLGDQKFARELQKEGIYVTGFFYPVVPGQARIRTQ
1iugA           LAVAAVLEAWQNALLYGVGEEGGLRPVPKFSPAVAAFYYARVKEAFAQRGAVIAGGQGPLKGKVFRLSLM
1ecxA           SEAAKHMEKLRSKLVSGLMNLGHIITPLEISLPNTLSVGSTLQNLLSGYGIYVSTHVLDARIAQGAIRIS
1h0cA           ENSWRQHREAAAYLHGRLQALGLQLFVLRLPTVTTVAVPAGYDWRIDHFDIEIMGGLGPSTGVLRIGLLG
1pmmA           TKVQNASYQVAAYLADEIAKLGPYEFICTGIPAVCFKLKDGEDPGRLRGWQVPAFTLGGEATDIVVMRIM
1xl7A1          ----------------------------------------------------------------------
2govA1          ----------------------------------------------------------------------
2bwnA1          QKLRDAQQMHAKVLKMRLKALGMPIIDHGSHIVPVVIGDPVSDMLLSDYGVYVQPINFPTVPGTERLRFT
1qz9A           ASLRRKSLALTDLFIELVEQRELTLVTPREHAKRGSHVSFEHPEGYAVIQALIDRGVIGDYREPRIMRFG
1agxA           ----------------------------------------------------------------------
1v72A1          NARKANAAAQR--LAQGLEGLGEVLGGTEANILFCR-LDSAMIDALLKAGFGFYHDRWGPNV--VRFVTS
1vefA1          TRLWERAAELGPWFMEKLRAIPSPKIREVRGMGLMVGLELKEKAAPYIARLEKEHRVLALQAGPTVIRFL
1s2bA           ----------------------------------------------------------------------
1b9hA           ----------------------------------------------------------------------
2fn6A1          ----------------------------------------------------------------------
3bc8A1          KEMFVYLSTQLKKLAEAHNERLLQTPHNPISLAMTLKTIDGLGSMLFTRQVSGARAVPLGNVQSGHTFRG
1v8dA           ----------------------------------------------------------------------
1c0nA           ----------------------------------------------------------------------
1cs1A           ----------------------------------------------------------------------
1mdoA           ----------------------------------------------------------------------
1gbnA           EENLAENADKLIILRNELMKLPSDVVRGKGLLNAIVIKETKDWDAWKVCLRLRDNGLLAKPTHGDIIRFP
1ohvA           EDLLSNAAHAGKVLLTGLLDLQARYPQFISRVRGRGTFCSFDTPDNKLISIARNKGVMLGGCGDKSIRFT
1wytB1          ----------------------------------------------------------------------
1m32A           ----------------------------------------------------------------------
1ei7A           ----------------------------------------------------------------------
1gpcA           EELNTKF--GQVM---------------------------------------------------------
2hevF1          ----------------------------------------------------------------------
2cfbA1          EHLDRITGKLVQGLLDAARMFGLFFTAGPVTNYEQAKQSDLK-KFAAFHRGMLEQGIYLAPSQFEAGFTS
2igsA1          ----------------------------------------------------------------------
2e7iA1          ----------------------------------------------------------------------
1jg8A           ----------------------------------------------------------------------
1w9gA1          ----------------------------------------------------------------------
1nc7A           ----------------------------------------------------------------------
1fhlA           ----------------------------------------------------------------------
1qz8A           ----------------------------------------------------------------------
1gr0A2          ----------------------------------------------------------------------
1svvA           ----------------------------------------------------------------------
1ynfA1          ----------------------------------------------------------------------
1ax4A           EEYLHYRIGQVKYLGDRLREAGIPIQYPTGGHAVFVDCKK------------------------------
1lk9A           KTQKGTMRDLNTFGFKKLRERYQELPQSEYCNYFRRMRPPSCYQTFQNGRINTQNGVGFE-ASSRYVRLS
1o61A           ----------------------------------------------------------------------
1vk9A           ----------------------------------------------------------------------
1c4kA2          ----------------------------------------------------------------------
1elqA           ----------------------------------------------------------------------
2aeuA1          ----------------------------------------------------------------------
2bkwA1          ----------------------------------------------------------------------
1tzzA1          ----------------------------------------------------------------------
1sf2A           ----------------------------------------------------------------------
1bj4A           ----------------------------------------------------------------------
1d7rA           ----------------------------------------------------------------------
1wytA1          ----------------------------------------------------------------------
2z67A1          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           YATDMATLRDAIDVMRAATAAVQ
1fg3A           -----------------------
1vp4A           FCLPDEKIVEGIKRLREV-----
1u08A           FAKKESTLLAAAERLR-------
1b5oA           YATSEENLRKALERFARV-----
2gb3A1          CVLEKDLLSRAIDVLXEG-----
1d2fA           AGCPRSKLEKGVAGLINAIRAVR
1b8gA           FANPERTLDLAMQRLKAFVG---
1lc5A           IRSA-AQNERLLAALRNV-----
1c7nA           LAAPSSVIQESLERLNKA-----
1h1cA           IGKR-EENDXILRELEV------
1bw0A           TTRPVEVYREAVERIKAFCQRH-
1dtyA           YIILPQQLQRLTAAVNRAVQDE-
1aamA           PL--CEAIVAVL-----------
1cl1A           AAIRPQGEIDFSG----------
1c8nA           -----------------------
1fc4A           AAHTPEQITRAVEAFTRIGKQLG
1iugA           GAYDRYEALGVAGMFREVLEEI-
1ecxA           KYNTEEEVDYFLKKIEEI-----
1h0cA           CNATRENVDRVTEALRAALQHC-
1pmmA           RGFEMDFAELLLEDYKASLKYL-
1xl7A1          -----------------------
2govA1          -----------------------
2bwnA1          PVHDLKQIDGLVHAMD-------
1qz9A           LYTTFTEVWDAVQILGEILDRKT
1agxA           -----------------------
1v72A1          FATTAEDVDHLLNQVRLA-----
1vefA1          PPLVIEDLERVVEAVRAVLA---
1s2bA           -----------------------
1b9hA           -----------------------
2fn6A1          -----------------------
3bc8A1          FMSHADNYPCAY-----------
1v8dA           -----------------------
1c0nA           -----------------------
1cs1A           -----------------------
1mdoA           -----------------------
1gbnA           LVIKEDELRESIEIINKTILS--
1ohvA           LVFRDHHAHLFLNIFSDI-----
1wytB1          -----------------------
1m32A           -----------------------
1ei7A           -----------------------
1gpcA           -----------------------
2hevF1          -----------------------
2cfbA1          LAHTEADIERTIAAARTVLSQL-
2igsA1          -----------------------
2e7iA1          -----------------------
1jg8A           -----------------------
1w9gA1          -----------------------
1nc7A           -----------------------
1fhlA           -----------------------
1qz8A           -----------------------
1gr0A2          -----------------------
1svvA           -----------------------
1ynfA1          -----------------------
1ax4A           -----------------------
1lk9A           LIKTQDDFDQLMYYLKDM-----
1o61A           -----------------------
1vk9A           -----------------------
1c4kA2          -----------------------
1elqA           -----------------------
2aeuA1          -----------------------
2bkwA1          -----------------------
1tzzA1          -----------------------
1sf2A           -----------------------
1bj4A           -----------------------
1d7rA           -----------------------
1wytA1          -----------------------
2z67A1          -----------------------