[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for halo0:AAG19982.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1sezA1.bssp"
#ERROR : Can't open dsspfile "2ivdA1.bssp"
#ERROR : Can't open dsspfile "1i8tA1.bssp"
#ERROR : Can't open dsspfile "2dw4A2.bssp"
#ERROR : Can't open dsspfile "1b37A1.bssp"
#ERROR : Can't open dsspfile "1ng3A1.bssp"
#ERROR : Can't open dsspfile "1el5A1.bssp"

## Summary of PDB Search
:536
    3e-17  11%  1sezA1 [c.3.1.2] PROTOPORPHYRINOGEN OXIDASE, MITOCHONDRIAL A:13 --
    1e-09  22%  2ivdA1 [c.3.1.2] PROTOPORPHYRINOGEN OXIDASE A:10 -- 306 A:415 --
    2e-09   9%  1i8tA1 [c.4.1.3] UDP-GALACTOPYRANOSE MUTASE A:1 -- 244 A:314 -- 367
    4e-07  40%  2dw4A2 [c.3.1.2] LYSINE-SPECIFIC HISTONE DEMETHYLASE 1 A:274 --
    8e-06  29%  1b37A1 [c.3.1.2] PROTEIN (POLYAMINE OXIDASE) A:5 -- 293 A:406 --
    3e-05  13%  1ng3A1 [c.3.1.2] GLYCINE OXIDASE A:1 -- 218 A:307 -- 364
    3e-04  22%  1el5A1 [c.3.1.2] SARCOSINE OXIDASE A:1 -- 217 A:322 -- 385
:536

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxDVTVVXXXXXXXXXXXXXXXXXXSVTLLEQHDTVGGRAGVLER
1sezA1          ----------------------------------------------------------------------
2ivdA1          ---------------------------NVAVVGGGISGLAVAHHLRSRGTDAVLLESSARLGGAVGTHAL
1i8tA1          ---------------------------DYIIVGSGLFGAVCANELKKLNKKVLVIEKRNHIGGNAYTEDC
2dw4A2          ---------------------------------------------------VTLLEARDRVGGRVATFRK
1b37A1          ---------------------------------------------------LLILEATDHIGGRMHKTNF
1ng3A1          ----------------------------------------------------------------------
1el5A1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           DGFRFDTGPSWYLMPDVFERXXXXXXXXXXXXYELTRLDPQYRVFWTDGDSATIEPNRRNAHELFESYEE
1sezA1          ---------------------------------------------------------LQXLLEPILWSHE
2ivdA1          AGYLVEQGPNSFLDREPATRALAAALNLEG---RIRAADPKRRYVYTRGR--------------LRSVPA
1i8tA1          EGIQIHKYGAHIFHTNDK---------------YIWDYVNDLVEFNRFTNSPLAIYKDKLFNLPFNMNTF
2dw4A2          GNYVADLGAMV-----------------------------------------------------------
1b37A1          AGINVELGANWV----------------------------------------------------------
1ng3A1          ----------------------------------------------------------------------
1el5A1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           GAGDALATYLDRAATNYDLAMNRVVYPDRTAFRDYASTDMLPLASRLRLFGNMDDYVSRFFDHPKLRQLL
1sezA1          SVSGFFQRHFKEVVDYLIDPFVAGTC-----GGDPDSLSXHHSFPELWNLEKRFGSVILGAIRSKLSKTS
2ivdA1          SPPAFLASDIARLRVAGELFSRRAPEGVDESLAAFGR----------RHLG--HRATQVLLDAPMLVKME
1i8tA1          HQMWGVKDPQEAQNIINAQKKKYGDKVPENLEE--------------QAISLVGEDLYQALIKGYTEKQW
2dw4A2          ----------------------------------------------------------------------
1b37A1          ----------------------------------------------------------------------
1ng3A1          ----------------------------------------------------------------------
1el5A1          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           EYTLVFLGGAPHNTPALYSIMSHVDLNGNVFYPEGGIAGVVDALAELAVEQGATIETGVGVNAISGRRGE
1sezA1          ANK---------------------KRQRGSFSFLGGXQTLTDAICKDL--REDELRLNSRVLELSCSCTE
2ivdA1          REHRSLILGAIRAQKAQRQAGTAPKLSGALSTFDGGLQVLIDALAA---SLGDAAHVGARVEGLA--REG
1i8tA1          GRSAKELPAFIIKRPVRFTFDNNYFSDRYQGIPVGGYTKLIEKML-----EGVDVKLGIDFLKD------
2dw4A2          ----------------------------------------------------------------------
1b37A1          ----------------------------------------------------------------------
1ng3A1          ------------------------DIFGASFIQDDVHYFVCKAYVKAAKMLGAEIFEHTPVLHVERDGEA
1el5A1          ----------------------------------------IRAYRELAEARGAKVLTHTRVEDFDISPDS


                         .         *         .         .         .         .         +:350
query           FTLATDDGTRTTDLVVNNANPAYAERELLDTGGRDHAPDYWDDQTYAPSALMFYLGVEGDVEPLAHHSLV
1sezA1          DSAIRQSEEESFDAVIXTAPLCDVKSXKIAKRGNPFLLNFIPEVYGHNYD-SVLDAIDKXEKNLPGLFYA
2ivdA1          WRLIIEEHGRRAELSVAQAAPAHATAKLL-----------------------------------------
1i8tA1          ----KDSLASKAHRIIYTGPIDQYFDYR----FGALNDNKNMELFKKYRELASREDKVIFGGRLAEYKYY
2dw4A2          ----------------------------------------------------------------------
1b37A1          ----------------------------------------------------------------------
1ng3A1          LFIKTPSGDVWANHVVVASGVWSGMFFKQLGLNNADGKPYIGRHPEDSRILFAAGHFRNGILLAPATGLI
1el5A1          VKIETANGSYTADKLIVSMG-AWN-SKLLSKLNLDIPDEHFIIDL-------------------------


                         .         .         .         .         *         .         .:420
query           LPPDWDGHFAQLFDDPGWPDDPAFYLSVASxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1sezA1          GNHRGGLSVGKALSSGCNADLVISYLESVS----------------------------------------
2ivdA1          ----------------------------------------------------------------------
1i8tA1          --DMHQVISAALYQVKNMSTD-------------------------------------------------
2dw4A2          ----------------------------------------------------------------------
1b37A1          ----------------------------------------------------------------------
1ng3A1          SDLIMNKEV-----NQDWLHAFRI----------------------------------------------
1el5A1          ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1sezA1          ----------------------------------------------------------------------
2ivdA1          ----------------------------------------------------------------------
1i8tA1          ----------------------------------------------------------------------
2dw4A2          ----------------------------------------------------------------------
1b37A1          ----------------------------------------------------------------------
1ng3A1          ----------------------------------------------------------------------
1el5A1          ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1sezA1          ----------------------------------------------
2ivdA1          ----------------------------------------------
1i8tA1          ----------------------------------------------
2dw4A2          ----------------------------------------------
1b37A1          ----------------------------------------------
1ng3A1          ----------------------------------------------
1el5A1          ----------------------------------------------