[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for hlac0:ACM56606.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1yz6A.bssp"
#ERROR : Can't open dsspfile "3cw2C.bssp"
#ERROR : Can't open dsspfile "2ahoB.bssp"
#ERROR : Can't open dsspfile "2k4kA.bssp"
#ERROR : Can't open dsspfile "1sroA.bssp"
#ERROR : Can't open dsspfile "2oceA.bssp"
#ERROR : Can't open dsspfile "3bzkA.bssp"
#ERROR : Can't open dsspfile "3bzcA.bssp"
#ERROR : Can't open dsspfile "1yz7A.bssp"
#ERROR : Can't open dsspfile "1q8kA.bssp"
#ERROR : Can't open dsspfile "2eqsA.bssp"
#ERROR : Can't open dsspfile "2a19A.bssp"
#ERROR : Can't open dsspfile "1q46A.bssp"
#ERROR : Can't open dsspfile "2a1aA.bssp"
#ERROR : Can't open dsspfile "1go3E.bssp"
#ERROR : Can't open dsspfile "1qx6A.bssp"

## Summary of PDB Search
:266
    6e-35  37%  1yz6A  [x.x.x] PROBABLE TRANSLATION INITIATION FACTOR 2 ALPHA
    3e-20  26%  3cw2C  [x.x.x] TRANSLATION INITIATION FACTOR 2 SUBUNIT ALPHA
    5e-16  25%  2ahoB  [x.x.x] TRANSLATION INITIATION FACTOR 2 ALPHA SUBUNIT
    4e-12  44%  2k4kA  [x.x.x] GENERAL STRESS PROTEIN 13
    5e-10  44%  1sroA  [x.x.x] PNPASE
    1e-09  36%  2oceA  [x.x.x] HYPOTHETICAL PROTEIN PA5201
    1e-09  36%  3bzkA  [x.x.x] TEX
    1e-09  36%  3bzcA  [x.x.x] TEX
    4e-09  32%  1yz7A  [x.x.x] PROBABLE TRANSLATION INITIATION FACTOR 2 ALPHA
    1e-08  24%  1q8kA  [b.40.4 - a.60.14 - d.58.51] EUKARYOTIC TRANSLATION
    2e-08  40%  2eqsA  [x.x.x] ATP-DEPENDENT RNA HELICASE DHX8
    8e-08  30%  2a19A  [x.x.x] EUKARYOTIC TRANSLATION INITIATION FACTOR 2 ALPHA
    1e-07  27%  1q46A  [b.40.4 - a.60.14] TRANSLATION INITIATION FACTOR 2 ALPHA
    7e-07  31%  2a1aA  [x.x.x] EUKARYOTIC TRANSLATION INITIATION FACTOR 2 ALPHA
    3e-04  31%  1go3E  [d.230.1 - b.40.4] DNA-DIRECTED RNA POLYMERASE SUBUNIT E
    6e-04  31%  1qx6A  [b.100.1] NPQTN SPECIFIC SORTASE B
:266

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxWPEPGELVVGDVDEIADFGVFVDLDEYEDKRGLCHISEVASGWIKNVRDHVREGQTVVAKVLDVD
1yz6A           -----YPEEGEFVVATVKRIHNYGAFLELDEYPGKEAFMHISEVASTWVRNIRDYLKEGQKVVAKVIRVD
3cw2C           ------PSEGEILIATVKQVFDYGSYVSLDEYGGLQAFLPWSEVSSKWVKNIRDVLKENXXXXXXXXXXX
2ahoB           ------PSEGEILIATVKQVFDYGSYVSLDEYGGLQAFLPWSEVS-----NIRDVLKENXXXXXXXXXXX
2k4kA           -------EVGSVYTGKVTGLQAYGAFVALDE--ETQGLVHISEVTHGFVKDINEHLSVGDEVQVKVLAVD
1sroA           -------EVGRVYTGKVTRIVDFGAFVAIGG--GKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVD
2oceA           -------KPGMVLEGVVTNVTNFGAFVDIGVHQD--GLVHISALSEKFVKDPYEVVKAGDIVKVKVMEVD
3bzkA           -------KPGMVLEGVVTNVTNFGAFVDIGVHQD--GLVHISALSEKFVKDPYEVVKAGDIVKVKVMEVD
3bzcA           -------KPGMVLEGVVTNVTNFGAFVDIGVHQD--GLVHISALSEKFVKDPYEVVKAGDIVKVKVMEVD
1yz7A           ----------------------------------------------------------------------
1q8kA           -----FPEVEDVVMVNVRSIQEMGAYVSLLEYNNIEGMIHLSELXXXXXXXXNKLIRIGRNECVKVIRVD
2eqsA           ------PTIGDIYNGKVTSIMQFGCFVQLEGLRKREGLVHISELREGRVANVADVVSKGQRVKVKVLSF-
2a19A           -----YPEIDDIVMVNVQQIAEMGAYVKLLEYDNIEGMILLS--------SIQKLIRVGKNDVAVVLRVD
1q46A           -----YPEIDDIVMVNVQQIAEMGAYVKLLEYDNIEGMXXXXXXXXXXXXXXQKLIRVGKNDVAVVLRVD
2a1aA           -----YPEIDDIVMVNVQQIAEMGAYVKLLEYDNIEGMILLS------------LIRVGKNDVAVVLRVD
1go3E           ------PEMYELIEGEVVDVVEFGSFVRLGPLD---GLIHVSQIMDDYVKETGKVLEIGDYVRARIVAIS
1qx6A           ----------------------------------------------GWIK------LSGTSLNYPVLQGK


                         .         .         *         .         .         .         .:140
query           ESANQIDLSIKDVNEHQRKDKIQDWKNSQKADNWMLIALGEDVDDDRYTAVANALLVEFDSLYDAFEAAA
1yz6A           PRKGHIDLSLRRVTQQQRKAKLQEFKRXXXXXXXXXXXXXXXXXDTAWREVWVPLEEEWGEVYAAFEDAA
3cw2C           XXXGTVDVSLKKVTDDERRKKNLQWKKIQRLDK-ILELVSQKLEKDAWEQVAWKLEAKYGDPITAIEKAV
2ahoB           XXXGTVDVSLKKVTDDERRKKNLQWKKIQRLDK-ILELVSQKLEKDAWEQVAWKLEAKYGDPITAIEKAV
2k4kA           EEKGKISLSIR-----------------------------------------------------------
1sroA           RQ-GRIRLSIKE----------------------------------------------------------
2oceA           IPRNRVGLSMR-----------------------------------------------------------
3bzkA           IPRNRVGLSMR-----------------------------------------------------------
3bzcA           IPRNRVGLSMR-----------------------------------------------------------
1yz7A           ---------------------------------------------------------EWGEVYAAFEDAA
1q8kA           KEKGYIDLSKRRVSP-EEAIKCEDKFTKSKTVYSILRHVAEVLEDEQLESLFQRTAWVFDGAYDAFK-HA
2eqsA           -TGTKTSLSMKDVDQETGED--------------------------------------------------
2a19A           KEKGYIDLSKRRVSS-EDIIKCEEKYQKSKTVHSILRYCAEKFQEELYKTIAWPLSRKFGHAYEAFKLSI
1q46A           KEKGYIDLSKRRVSS-EDIIKCEEKYQKSKTVHSILRYCAEKFQEELYKTIAWPLSRKFGHAYEAFKLSI
2a1aA           KEKGYIDLSKRRVSS-EDIIKCEEKYQKSKTVHSILRYCAEKFQEELYKTIAWPLSRKFGHAYEAFKLSI
1go3E           LKASKIALTMR-----------------------------------------------------------
1qx6A           TNHDYLNLDFE--REHRRKGSIFDFRNELKNLNHNTILYGHHVGDNTFDVLEDYLIIEFDNKYGKYQLQV


                         +         .         .         .         .         *         .:210
query           ISGXXXXXXXXXXXXXXXXXVTAARDNVSVPYVDVTGYVDLESTAPNGVDDVKAALEAAEGNGEVPDGVD
1yz6A           KDG--IDVLKGHVPDEWLPVLKEIIDNVEVPTVTIDAEFEITVPKPNGVEIIKEALIRARDRANKEKDVE
3cw2C           KEGEKILIDAGVPEIWVKPLLEEASKHAEERKVKMSGLITVRTNEPLGVEKIKEVISKALENIEYESLLN
2ahoB           KEGEKILIDAGVPEIWVKPLLEEASKHAEERKVKMSGLITVRTNEPLGVEKIKEVISKALENIEYESLLN
2k4kA           ----------------------------------------------------------------------
1sroA           ----------------------------------------------------------------------
2oceA           ----------------------------------------------------------------------
3bzkA           ----------------------------------------------------------------------
3bzcA           ----------------------------------------------------------------------
1yz7A           KDGIDVLKGHVPDEWLPV--LKEIIDNVEVPTVTIDAEFEITVPKPNGVEIIKEALIRARDRANKEKDVE
1q8kA           VSDPSILDSLDLNEDEREVLINNINRRLTPQAVKIRADIEVACYGYEGIDAVKEALRA--GLNCSTENMP
2eqsA           ----------------------------------------------------------------------
2a19A           I---------------------------------------------------------------------
1q46A           I---------------------------------------------------------------------
2a1aA           I---------------------------------------------------------------------
1go3E           ----------------------------------------------------------------------
1qx6A           FS--------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           LEVGYVGSPEYRIKVRAPNYKTAEDQLxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1yz6A           VKFTYLGAPRYRIDITAPDYYKAEEVL-----------------------------
3cw2C           IKIYTIGAPRYRVDVVGTNPKEASEAL-----------------------------
2ahoB           IKIYTIGAPRYRVDVVGTNPKEASEAL-----------------------------
2k4kA           --------------------------------------------------------
1sroA           --------------------------------------------------------
2oceA           --------------------------------------------------------
3bzkA           --------------------------------------------------------
3bzcA           --------------------------------------------------------
1yz7A           VKFTYLGAPRYRIDITAPDYYKAEEVL-----------------------------
1q8kA           IKINLIAPPRY---------------------------------------------
2eqsA           --------------------------------------------------------
2a19A           --------------------------------------------------------
1q46A           --------------------------------------------------------
2a1aA           --------------------------------------------------------
1go3E           --------------------------------------------------------
1qx6A           --------------------------------------------------------