[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for hlac0:ACM57205.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2zdsB.bssp"
#ERROR : Can't open dsspfile "2zdsA.bssp"

## Summary of PDB Search
:323
    1e-13  36%  2zdsB  [x.x.x] PUTATIVE DNA-BINDING PROTEIN
    1e-13  36%  2zdsA  [x.x.x] PUTATIVE DNA-BINDING PROTEIN
:323

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2zdsB           ----------------------------------------------------------------------
2zdsA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2zdsB           ----------------------------------------------------------------------
2zdsA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxWTDLAKHADHHGVDVAIEMHPNMLVYEPTGMLALREATNERIGANFDPSHLYWQGIDVIE
2zdsB           ----------WNPILDVFDAEGVRFAHEVHPSEIAYDYWTTHRALEAVGHRFGLNFDPSHFVWQDLD---
2zdsA           ----------WNPILDVFDAEGVRFAHEVHPSEIAYDYWTTHRALEAVGHRFGLNFDPSHFVWQDLD---


                         .         .         .         +         .         .         .:280
query           AIRFLGDHDAIHHFHAKDTKVYDANARVKGVLDTTSYTDESDRSWLFRSIGYGHDESHWKDVVSTLRMVG
2zdsB           PVGFLWDRDRIYHVDCKEAKRLDGR---NGRLGSHLPWGDPRRGWDF--VSAGHGDVPWEDVF-RLRSID
2zdsA           PVGFLWDRDRIYHVDCKEAKRLDGR---NGRLGSHLPWGDPRRGWDF--VSAGHGDVPWEDVF-RLRSID


                         .         *         .         .         .         .         +:350
query           YEGALSIEHEDSLTSSREGLEKAVDVLDRAVFETQPxxxxxxx
2zdsB           YQGPVSVEWED----AGDRLQGAPEALTRKAFDFEP-------
2zdsA           YQGPVSVEWED----AGDRLQGAPEALTRKAFDFEP-------