[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for hlac0:ACM57207.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1jpmC.bssp"
#ERROR : Can't open dsspfile "1jpmA.bssp"
#ERROR : Can't open dsspfile "2p8bA.bssp"
#ERROR : Can't open dsspfile "1jpdX.bssp"
#ERROR : Can't open dsspfile "3dfyL.bssp"
#ERROR : Can't open dsspfile "3dfyN.bssp"
#ERROR : Can't open dsspfile "3dfyH.bssp"
#ERROR : Can't open dsspfile "3dfyF.bssp"
#ERROR : Can't open dsspfile "3dfyE.bssp"
#ERROR : Can't open dsspfile "3dfyB.bssp"
#ERROR : Can't open dsspfile "2qdeA.bssp"
#ERROR : Can't open dsspfile "3dfyA.bssp"
#ERROR : Can't open dsspfile "3derA.bssp"
#ERROR : Can't open dsspfile "3ik4B.bssp"
#ERROR : Can't open dsspfile "3ik4A.bssp"
#ERROR : Can't open dsspfile "3ik4D.bssp"
#ERROR : Can't open dsspfile "3ik4C.bssp"
#ERROR : Can't open dsspfile "2bahA.bssp"
#ERROR : Can't open dsspfile "2zadA.bssp"
#ERROR : Can't open dsspfile "3dg6A.bssp"
#ERROR : Can't open dsspfile "3eezA.bssp"
#ERROR : Can't open dsspfile "3dg3A.bssp"
#ERROR : Can't open dsspfile "3mucA.bssp"
#ERROR : Can't open dsspfile "2mucA.bssp"
#ERROR : Can't open dsspfile "1mucA.bssp"
#ERROR : Can't open dsspfile "3dgbA.bssp"
#ERROR : Can't open dsspfile "1bkhC.bssp"
#ERROR : Can't open dsspfile "1bkhB.bssp"
#ERROR : Can't open dsspfile "1bkhA.bssp"
#ERROR : Can't open dsspfile "1f9cA.bssp"
#ERROR : Can't open dsspfile "1chrA.bssp"
#ERROR : Can't open dsspfile "1wufA.bssp"
#ERROR : Can't open dsspfile "1sjdB.bssp"
#ERROR : Can't open dsspfile "1sjdA.bssp"
#ERROR : Can't open dsspfile "3ct2A.bssp"
#ERROR : Can't open dsspfile "1xpyC.bssp"
#ERROR : Can't open dsspfile "1r0mA.bssp"
#ERROR : Can't open dsspfile "2gggC.bssp"
#ERROR : Can't open dsspfile "2gggA.bssp"
#ERROR : Can't open dsspfile "2ggjA.bssp"
#ERROR : Can't open dsspfile "3fcpE.bssp"
#ERROR : Can't open dsspfile "3fcpB.bssp"
#ERROR : Can't open dsspfile "3fcpA.bssp"
#ERROR : Can't open dsspfile "2ggiA.bssp"
#ERROR : Can't open dsspfile "1wueB.bssp"
#ERROR : Can't open dsspfile "1wueA.bssp"
#ERROR : Can't open dsspfile "3fv9A.bssp"
#ERROR : Can't open dsspfile "2pmqB.bssp"
#ERROR : Can't open dsspfile "2pmqA.bssp"
#ERROR : Can't open dsspfile "2zc8A.bssp"
#ERROR : Can't open dsspfile "3fv9B.bssp"
#ERROR : Can't open dsspfile "1nu5A.bssp"
#ERROR : Can't open dsspfile "2pceB.bssp"
#ERROR : Can't open dsspfile "2pceA.bssp"
#ERROR : Can't open dsspfile "3fv9H.bssp"
#ERROR : Can't open dsspfile "3fv9G.bssp"
#ERROR : Can't open dsspfile "2pgwC.bssp"
#ERROR : Can't open dsspfile "2pgwB.bssp"
#ERROR : Can't open dsspfile "2pgwA.bssp"
#ERROR : Can't open dsspfile "2pceF.bssp"
#ERROR : Can't open dsspfile "3i6tC.bssp"
#ERROR : Can't open dsspfile "3i6tD.bssp"
#ERROR : Can't open dsspfile "3i6tB.bssp"
#ERROR : Can't open dsspfile "3i6tA.bssp"
#ERROR : Can't open dsspfile "3bjsB.bssp"
#ERROR : Can't open dsspfile "3bjsA.bssp"
#ERROR : Can't open dsspfile "2ovlD.bssp"
#ERROR : Can't open dsspfile "2ovlA.bssp"
#ERROR : Can't open dsspfile "2ggeD.bssp"
#ERROR : Can't open dsspfile "2ggeB.bssp"
#ERROR : Can't open dsspfile "2gdqA.bssp"
#ERROR : Can't open dsspfile "3i6eA.bssp"
#ERROR : Can't open dsspfile "2qddA.bssp"
#ERROR : Can't open dsspfile "3i4kA.bssp"
#ERROR : Can't open dsspfile "2qddB.bssp"
#ERROR : Can't open dsspfile "3fvdA.bssp"
#ERROR : Can't open dsspfile "3fvdB.bssp"
#ERROR : Can't open dsspfile "2pp1C.bssp"
#ERROR : Can't open dsspfile "2pp0A.bssp"
#ERROR : Can't open dsspfile "2pgeA.bssp"
#ERROR : Can't open dsspfile "2pp3A.bssp"
#ERROR : Can't open dsspfile "2oz8A.bssp"
#ERROR : Can't open dsspfile "2rdxG.bssp"
#ERROR : Can't open dsspfile "2rdxA.bssp"
#ERROR : Can't open dsspfile "2pozB.bssp"
#ERROR : Can't open dsspfile "2rdxE.bssp"
#ERROR : Can't open dsspfile "2pozC.bssp"
#ERROR : Can't open dsspfile "3cyjA.bssp"
#ERROR : Can't open dsspfile "3gc2A.bssp"
#ERROR : Can't open dsspfile "1fhvA.bssp"
#ERROR : Can't open dsspfile "2pozH.bssp"
#ERROR : Can't open dsspfile "1r6wA.bssp"
#ERROR : Can't open dsspfile "2pozA.bssp"
#ERROR : Can't open dsspfile "2oqhC.bssp"
#ERROR : Can't open dsspfile "2oqhB.bssp"
#ERROR : Can't open dsspfile "1fhuA.bssp"
#ERROR : Can't open dsspfile "2ofjA.bssp"
#ERROR : Can't open dsspfile "1mraA.bssp"
#ERROR : Can't open dsspfile "3cb3D.bssp"
#ERROR : Can't open dsspfile "3cb3C.bssp"
#ERROR : Can't open dsspfile "3cb3B.bssp"
#ERROR : Can't open dsspfile "3cb3A.bssp"
#ERROR : Can't open dsspfile "2mnrA.bssp"
#ERROR : Can't open dsspfile "1dtnA.bssp"
#ERROR : Can't open dsspfile "1mdlA.bssp"
#ERROR : Can't open dsspfile "2ofjD.bssp"
#ERROR : Can't open dsspfile "2ofjC.bssp"
#ERROR : Can't open dsspfile "2qvhA.bssp"
#ERROR : Can't open dsspfile "2oqhA.bssp"
#ERROR : Can't open dsspfile "3ddmA.bssp"
#ERROR : Can't open dsspfile "3dipA.bssp"
#ERROR : Can't open dsspfile "2oqhD.bssp"
#ERROR : Can't open dsspfile "2og9A.bssp"
#ERROR : Can't open dsspfile "2oztA.bssp"
#ERROR : Can't open dsspfile "2nqlA.bssp"
#ERROR : Can't open dsspfile "3h7vA.bssp"
#ERROR : Can't open dsspfile "3bsmA.bssp"
#ERROR : Can't open dsspfile "2gl5A.bssp"
#ERROR : Can't open dsspfile "3dfhA.bssp"
#ERROR : Can't open dsspfile "3h12A.bssp"
#ERROR : Can't open dsspfile "2qjmA.bssp"
#ERROR : Can't open dsspfile "2qjjC.bssp"
#ERROR : Can't open dsspfile "2hxtA.bssp"
#ERROR : Can't open dsspfile "2hneD.bssp"
#ERROR : Can't open dsspfile "2hneC.bssp"
#ERROR : Can't open dsspfile "2hneB.bssp"
#ERROR : Can't open dsspfile "2hneA.bssp"
#ERROR : Can't open dsspfile "2qjnA.bssp"
#ERROR : Can't open dsspfile "2qjmB.bssp"
#ERROR : Can't open dsspfile "2olaA.bssp"
#ERROR : Can't open dsspfile "2oktA.bssp"
#ERROR : Can't open dsspfile "2qjjD.bssp"
#ERROR : Can't open dsspfile "3dipB.bssp"
#ERROR : Can't open dsspfile "2hxuA.bssp"
#ERROR : Can't open dsspfile "2o56G.bssp"
#ERROR : Can't open dsspfile "2o56H.bssp"
#ERROR : Can't open dsspfile "2o56A.bssp"
#ERROR : Can't open dsspfile "2opjA.bssp"
#ERROR : Can't open dsspfile "1tzzA.bssp"
#ERROR : Can't open dsspfile "3gd6A.bssp"
#ERROR : Can't open dsspfile "3fyyA.bssp"
#ERROR : Can't open dsspfile "3es7A.bssp"
#ERROR : Can't open dsspfile "2qjjA.bssp"
#ERROR : Can't open dsspfile "1bqgA.bssp"
#ERROR : Can't open dsspfile "2dw7A.bssp"
#ERROR : Can't open dsspfile "1yeyA.bssp"
#ERROR : Can't open dsspfile "2oo6A.bssp"
#ERROR : Can't open dsspfile "3go2A.bssp"
#ERROR : Can't open dsspfile "1rvkA.bssp"
#ERROR : Can't open dsspfile "2dw6A.bssp"
#ERROR : Can't open dsspfile "1tzzB.bssp"
#ERROR : Can't open dsspfile "3gy1A.bssp"
#ERROR : Can't open dsspfile "3gy1B.bssp"
#ERROR : Can't open dsspfile "1jdfA.bssp"
#ERROR : Can't open dsspfile "1jctB.bssp"
#ERROR : Can't open dsspfile "1jctA.bssp"
#ERROR : Can't open dsspfile "1ec9D.bssp"
#ERROR : Can't open dsspfile "1ec9A.bssp"
#ERROR : Can't open dsspfile "1ec8A.bssp"
#ERROR : Can't open dsspfile "1ec7D.bssp"
#ERROR : Can't open dsspfile "1ec7C.bssp"
#ERROR : Can't open dsspfile "1ec7B.bssp"
#ERROR : Can't open dsspfile "1ec7A.bssp"
#ERROR : Can't open dsspfile "2ppgB.bssp"

## Summary of PDB Search
:349
    6e-36  34%  1jpmC  [d.54.1 - c.1.11] L-ALA-D/L-GLU EPIMERASE
    6e-36  34%  1jpmA  [d.54.1 - c.1.11] L-ALA-D/L-GLU EPIMERASE
    5e-32  30%  2p8bA  [x.x.x] MANDELATE RACEMASE/MUCONATE LACTONIZING ENZYME
    2e-30  31%  1jpdX  [d.54.1 - c.1.11] L-ALA-D/L-GLU EPIMERASE
    4e-29  34%  3dfyL  [x.x.x] MUCONATE CYCLOISOMERASE
    5e-29  34%  3dfyN  [x.x.x] MUCONATE CYCLOISOMERASE
    7e-29  34%  3dfyH  [x.x.x] MUCONATE CYCLOISOMERASE
    7e-29  34%  3dfyF  [x.x.x] MUCONATE CYCLOISOMERASE
    9e-29  34%  3dfyE  [x.x.x] MUCONATE CYCLOISOMERASE
    9e-29  34%  3dfyB  [x.x.x] MUCONATE CYCLOISOMERASE
    2e-27  30%  2qdeA  [x.x.x] MANDELATE RACEMASE/MUCONATE LACTONIZING ENZYME
    5e-27  34%  3dfyA  [x.x.x] MUCONATE CYCLOISOMERASE
    5e-27  34%  3derA  [x.x.x] MUCONATE CYCLOISOMERASE
    6e-27  34%  3ik4B  [x.x.x] MANDELATE RACEMASE/MUCONATE LACTONIZING PROTEIN
    9e-23  34%  3ik4A  [x.x.x] MANDELATE RACEMASE/MUCONATE LACTONIZING PROTEIN
    1e-22  34%  3ik4D  [x.x.x] MANDELATE RACEMASE/MUCONATE LACTONIZING PROTEIN
    1e-22  34%  3ik4C  [x.x.x] MANDELATE RACEMASE/MUCONATE LACTONIZING PROTEIN
    2e-22  38%  2bahA  [x.x.x] N-ACYLAMINO ACID RACEMASE
    4e-22  33%  2zadA  [x.x.x] MUCONATE CYCLOISOMERASE
    4e-21  29%  3dg6A  [x.x.x] MUCONATE CYCLOISOMERASE
    7e-21  29%  3eezA  [x.x.x] PUTATIVE MANDELATE RACEMASE/MUCONATE LACTONIZING
    3e-20  29%  3dg3A  [x.x.x] MUCONATE CYCLOISOMERASE
    4e-20  29%  3mucA  [d.54.1 - c.1.11] PROTEIN (MUCONATE CYCLOISOMERASE)
    4e-20  29%  2mucA  [d.54.1 - c.1.11] PROTEIN (MUCONATE CYCLOISOMERASE)
    4e-20  29%  1mucA  [d.54.1 - c.1.11] MUCONATE LACTONIZING ENZYME
    4e-20  27%  3dgbA  [x.x.x] MUCONATE CYCLOISOMERASE
    4e-20  29%  1bkhC  [d.54.1 - c.1.11] MUCONATE LACTONIZING ENZYME
    4e-20  29%  1bkhB  [d.54.1 - c.1.11] MUCONATE LACTONIZING ENZYME
    4e-20  29%  1bkhA  [d.54.1 - c.1.11] MUCONATE LACTONIZING ENZYME
    6e-20  28%  1f9cA  [d.54.1 - c.1.11] PROTEIN (MUCONATE CYCLOISOMERASE I)
    6e-20  34%  1chrA  [d.54.1 - c.1.11] CHLOROMUCONATE CYCLOISOMERASE
    2e-19  29%  1wufA  [d.54.1 - c.1.11] HYPOTHETICAL PROTEIN LIN2664
    8e-19  31%  1sjdB  [d.54.1 - c.1.11] N-ACYLAMINO ACID RACEMASE
    8e-19  31%  1sjdA  [d.54.1 - c.1.11] N-ACYLAMINO ACID RACEMASE
    1e-18  27%  3ct2A  [x.x.x] MUCONATE CYCLOISOMERASE
    2e-18  31%  1xpyC  [d.54.1 - c.1.11] N-ACYLAMINO ACID RACEMASE
    3e-18  34%  1r0mA  [d.54.1 - c.1.11] N-ACYLAMINO ACID RACEMASE
    3e-18  34%  2gggC  [x.x.x] N-ACYLAMINO ACID RACEMASE
    3e-18  34%  2gggA  [x.x.x] N-ACYLAMINO ACID RACEMASE
    1e-17  34%  2ggjA  [x.x.x] N-ACYLAMINO ACID RACEMASE
    2e-17  27%  3fcpE  [x.x.x] L-ALA-D/L-GLU EPIMERASE, A MUCONATE LACTONIZING
    2e-17  27%  3fcpB  [x.x.x] L-ALA-D/L-GLU EPIMERASE, A MUCONATE LACTONIZING
    2e-17  27%  3fcpA  [x.x.x] L-ALA-D/L-GLU EPIMERASE, A MUCONATE LACTONIZING
    3e-17  31%  2ggiA  [x.x.x] N-ACYLAMINO ACID RACEMASE
    8e-17  28%  1wueB  [d.54.1 - c.1.11] MANDELATE RACEMASE/MUCONATE LACTONIZING
    8e-17  28%  1wueA  [d.54.1 - c.1.11] MANDELATE RACEMASE/MUCONATE LACTONIZING
    8e-17  33%  3fv9A  [x.x.x] MANDELATE RACEMASE/MUCONATE LACTONIZING ENZYME
    1e-16  42%  2pmqB  [x.x.x] MANDELATE RACEMASE/MUCONATE LACTONIZING ENZYME
    1e-16  42%  2pmqA  [x.x.x] MANDELATE RACEMASE/MUCONATE LACTONIZING ENZYME
    2e-16  31%  2zc8A  [x.x.x] N-ACYLAMINO ACID RACEMASE
    2e-16  32%  3fv9B  [x.x.x] MANDELATE RACEMASE/MUCONATE LACTONIZING ENZYME
    2e-16  27%  1nu5A  [d.54.1 - c.1.11] CHLOROMUCONATE CYCLOISOMERASE
    3e-16  33%  2pceB  [x.x.x] PUTATIVE MANDELATE RACEMASE/MUCONATE LACTONIZING
    3e-16  33%  2pceA  [x.x.x] PUTATIVE MANDELATE RACEMASE/MUCONATE LACTONIZING
    3e-16  33%  3fv9H  [x.x.x] MANDELATE RACEMASE/MUCONATE LACTONIZING ENZYME
    3e-16  33%  3fv9G  [x.x.x] MANDELATE RACEMASE/MUCONATE LACTONIZING ENZYME
    5e-16  29%  2pgwC  [x.x.x] MUCONATE CYCLOISOMERASE
    5e-16  29%  2pgwB  [x.x.x] MUCONATE CYCLOISOMERASE
    5e-16  29%  2pgwA  [x.x.x] MUCONATE CYCLOISOMERASE
    3e-15  33%  2pceF  [x.x.x] PUTATIVE MANDELATE RACEMASE/MUCONATE LACTONIZING
    5e-15  27%  3i6tC  [x.x.x] MUCONATE CYCLOISOMERASE
    1e-14  27%  3i6tD  [x.x.x] MUCONATE CYCLOISOMERASE
    1e-14  27%  3i6tB  [x.x.x] MUCONATE CYCLOISOMERASE
    1e-14  27%  3i6tA  [x.x.x] MUCONATE CYCLOISOMERASE
    5e-14  27%  3bjsB  [x.x.x] MANDELATE RACEMASE/MUCONATE LACTONIZING ENZYME
    5e-14  27%  3bjsA  [x.x.x] MANDELATE RACEMASE/MUCONATE LACTONIZING ENZYME
    5e-13  29%  2ovlD  [x.x.x] PUTATIVE RACEMASE
    5e-13  29%  2ovlA  [x.x.x] PUTATIVE RACEMASE
    5e-13  26%  2ggeD  [x.x.x] YITF
    5e-13  26%  2ggeB  [x.x.x] YITF
    5e-13  26%  2gdqA  [x.x.x] YITF
    7e-13  34%  3i6eA  [x.x.x] MUCONATE CYCLOISOMERASE I
    9e-13  26%  2qddA  [x.x.x] MANDELATE RACEMASE/MUCONATE LACTONIZING ENZYME
    1e-12  33%  3i4kA  [x.x.x] MUCONATE LACTONIZING ENZYME
    2e-12  28%  2qddB  [x.x.x] MANDELATE RACEMASE/MUCONATE LACTONIZING ENZYME
    2e-12  28%  3fvdA  [x.x.x] MANDELATE RACEMASE/MUCONATE LACTONIZING ENZYME
    4e-12  26%  3fvdB  [x.x.x] MANDELATE RACEMASE/MUCONATE LACTONIZING ENZYME
    6e-12  28%  2pp1C  [x.x.x] L-TALARATE/GALACTARATE DEHYDRATASE
    6e-12  28%  2pp0A  [x.x.x] L-TALARATE/GALACTARATE DEHYDRATASE
    2e-11  30%  2pgeA  [x.x.x] MENC
    3e-11  27%  2pp3A  [x.x.x] L-TALARATE/GALACTARATE DEHYDRATASE
    5e-11  37%  2oz8A  [x.x.x] MLL7089 PROTEIN
    6e-11  31%  2rdxG  [x.x.x] MANDELATE RACEMASE/MUCONATE LACTONIZING ENZYME,
    6e-11  31%  2rdxA  [x.x.x] MANDELATE RACEMASE/MUCONATE LACTONIZING ENZYME,
    1e-10  31%  2pozB  [x.x.x] PUTATIVE DEHYDRATASE
    1e-10  31%  2rdxE  [x.x.x] MANDELATE RACEMASE/MUCONATE LACTONIZING ENZYME,
    1e-10  32%  2pozC  [x.x.x] PUTATIVE DEHYDRATASE
    1e-10  30%  3cyjA  [x.x.x] MANDELATE RACEMASE/MUCONATE LACTONIZING ENZYME-
    2e-10  31%  3gc2A  [x.x.x] O-SUCCINYLBENZOATE SYNTHASE
    2e-10  33%  1fhvA  [d.54.1 - c.1.11] O-SUCCINYLBENZOATE SYNTHASE
    3e-10  32%  2pozH  [x.x.x] PUTATIVE DEHYDRATASE
    5e-10  32%  1r6wA  [d.54.1 - c.1.11] O-SUCCINYLBENZOATE SYNTHASE
    5e-10  31%  2pozA  [x.x.x] PUTATIVE DEHYDRATASE
    5e-10  30%  2oqhC  [x.x.x] PUTATIVE ISOMERASE
    5e-10  30%  2oqhB  [x.x.x] PUTATIVE ISOMERASE
    5e-10  33%  1fhuA  [d.54.1 - c.1.11] O-SUCCINYLBENZOATE SYNTHASE
    7e-10  31%  2ofjA  [x.x.x] O-SUCCINYLBENZOATE SYNTHASE
    7e-10  27%  1mraA  [x.x.x] MANDELATE RACEMASE
    7e-10  30%  3cb3D  [x.x.x] MANDELATE RACEMASE/MUCONATE LACTONIZING ENZYME
    7e-10  30%  3cb3C  [x.x.x] MANDELATE RACEMASE/MUCONATE LACTONIZING ENZYME
    7e-10  30%  3cb3B  [x.x.x] MANDELATE RACEMASE/MUCONATE LACTONIZING ENZYME
    7e-10  30%  3cb3A  [x.x.x] MANDELATE RACEMASE/MUCONATE LACTONIZING ENZYME
    9e-10  27%  2mnrA  [x.x.x] MANDELATE RACEMASE
    9e-10  27%  1dtnA  [x.x.x] MANDELATE RACEMASE
    2e-09  27%  1mdlA  [x.x.x] MANDELATE RACEMASE
    3e-09  32%  2ofjD  [x.x.x] O-SUCCINYLBENZOATE SYNTHASE
    3e-09  32%  2ofjC  [x.x.x] O-SUCCINYLBENZOATE SYNTHASE
    3e-09  35%  2qvhA  [x.x.x] O-SUCCINYLBENZOATE-COA SYNTHASE
    3e-09  31%  2oqhA  [x.x.x] PUTATIVE ISOMERASE
    4e-09  32%  3ddmA  [x.x.x] PUTATIVE MANDELATE RACEMASE/MUCONATE LACTONIZING
    1e-08  32%  3dipA  [x.x.x] ENOLASE
    1e-08  30%  2oqhD  [x.x.x] PUTATIVE ISOMERASE
    2e-08  30%  2og9A  [x.x.x] MANDELATE RACEMASE/MUCONATE LACTONIZING ENZYME
    2e-08  25%  2oztA  [x.x.x] TLR1174 PROTEIN
    2e-08  31%  2nqlA  [x.x.x] ISOMERASE/LACTONIZING ENZYME
    2e-08  25%  3h7vA  [x.x.x] O-SUCCINYLBENZOATE SYNTHASE
    3e-08  31%  3bsmA  [x.x.x] MANDELATE RACEMASE/MUCONATE LACTONIZING ENZYME
    5e-08  26%  2gl5A  [x.x.x] PUTATIVE DEHYDRATASE PROTEIN
    5e-08  23%  3dfhA  [x.x.x] MANDELATE RACEMASE
    1e-07  24%  3h12A  [x.x.x] MANDELATE RACEMASE
    1e-07  27%  2qjmA  [x.x.x] MANDELATE RACEMASE/MUCONATE LACTONIZING ENZYME
    1e-07  27%  2qjjC  [x.x.x] MANDELATE RACEMASE/MUCONATE LACTONIZING ENZYME
    1e-07  26%  2hxtA  [x.x.x] L-FUCONATE DEHYDRATASE
    1e-07  26%  2hneD  [x.x.x] L-FUCONATE DEHYDRATASE
    1e-07  26%  2hneC  [x.x.x] L-FUCONATE DEHYDRATASE
    1e-07  26%  2hneB  [x.x.x] L-FUCONATE DEHYDRATASE
    1e-07  26%  2hneA  [x.x.x] L-FUCONATE DEHYDRATASE
    2e-07  27%  2qjnA  [x.x.x] MANDELATE RACEMASE/MUCONATE LACTONIZING ENZYME
    2e-07  27%  2qjmB  [x.x.x] MANDELATE RACEMASE/MUCONATE LACTONIZING ENZYME
    2e-07  28%  2olaA  [x.x.x] O-SUCCINYLBENZOIC ACID SYNTHETASE
    2e-07  28%  2oktA  [x.x.x] O-SUCCINYLBENZOIC ACID SYNTHETASE
    3e-07  27%  2qjjD  [x.x.x] MANDELATE RACEMASE/MUCONATE LACTONIZING ENZYME
    4e-07  30%  3dipB  [x.x.x] ENOLASE
    7e-07  26%  2hxuA  [x.x.x] L-FUCONATE DEHYDRATASE
    1e-06  25%  2o56G  [x.x.x] PUTATIVE MANDELATE RACEMASE
    2e-06  25%  2o56H  [x.x.x] PUTATIVE MANDELATE RACEMASE
    2e-06  25%  2o56A  [x.x.x] PUTATIVE MANDELATE RACEMASE
    2e-06  37%  2opjA  [x.x.x] O-SUCCINYLBENZOATE-COA SYNTHASE
    3e-06  28%  1tzzA  [d.54.1 - c.1.11] HYPOTHETICAL PROTEIN L1841
    4e-06  24%  3gd6A  [x.x.x] MUCONATE CYCLOISOMERASE
    4e-06  24%  3fyyA  [x.x.x] MUCONATE CYCLOISOMERASE
    4e-06  24%  3es7A  [x.x.x] MUCONATE CYCLOISOMERASE
    5e-06  29%  2qjjA  [x.x.x] MANDELATE RACEMASE/MUCONATE LACTONIZING ENZYME
    5e-06  46%  1bqgA  [x.x.x] D-GLUCARATE DEHYDRATASE
    1e-05  25%  2dw7A  [x.x.x] BLL6730 PROTEIN
    2e-05  26%  1yeyA  [d.54.1 - c.1.11] L-FUCONATE DEHYDRATASE
    2e-05  27%  2oo6A  [x.x.x] PUTATIVE L-ALANINE-DL-GLUTAMATE EPIMERASE
    2e-05  27%  3go2A  [x.x.x] PUTATIVE L-ALANINE-DL-GLUTAMATE EPIMERASE
    5e-05  28%  1rvkA  [d.54.1 - c.1.11] ISOMERASE/LACTONIZING ENZYME
    5e-05  25%  2dw6A  [x.x.x] BLL6730 PROTEIN
    7e-05  27%  1tzzB  [d.54.1 - c.1.11] HYPOTHETICAL PROTEIN L1841
    1e-04  22%  3gy1A  [x.x.x] MANDELATE RACEMASE/MUCONATE LACTONIZING PROTEIN
    1e-04  22%  3gy1B  [x.x.x] MANDELATE RACEMASE/MUCONATE LACTONIZING PROTEIN
    2e-04  35%  1jdfA  [d.54.1 - c.1.11] GLUCARATE DEHYDRATASE
    2e-04  35%  1jctB  [d.54.1 - c.1.11] GLUCARATE DEHYDRATASE
    2e-04  35%  1jctA  [d.54.1 - c.1.11] GLUCARATE DEHYDRATASE
    2e-04  35%  1ec9D  [d.54.1 - c.1.11] GLUCARATE DEHYDRATASE
    2e-04  35%  1ec9A  [d.54.1 - c.1.11] GLUCARATE DEHYDRATASE
    2e-04  35%  1ec8A  [d.54.1 - c.1.11] GLUCARATE DEHYDRATASE
    2e-04  35%  1ec7D  [d.54.1 - c.1.11] GLUCARATE DEHYDRATASE
    2e-04  35%  1ec7C  [d.54.1 - c.1.11] GLUCARATE DEHYDRATASE
    2e-04  35%  1ec7B  [d.54.1 - c.1.11] GLUCARATE DEHYDRATASE
    2e-04  35%  1ec7A  [d.54.1 - c.1.11] GLUCARATE DEHYDRATASE
    3e-04  30%  2ppgB  [x.x.x] PUTATIVE ISOMERASE
:349

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxLETEFERVSLPLENPFTIFRGTQTDAENVIVKIADEAGMTGVGGAAPSAHYGETADTVEAVLPDLLDA
1jpmC           --IRIETSRIAVPLTKPFKTALRTVYTAESVIVRITYDSGAVGWGEAPPTLVIGDSMDSIESAIHHVLKP
1jpmA           --IRIETSRIAVPLTKPFKTALRTVYTAESVIVRITYDSGAVGWGEAPPTLVIGDSMDSIESAIHHVLKP
2p8bA           ---------IRLPLRNPFVISYGSYSDMPSIIVKMETDEGIIGYGGVADDHVTGESWESTFHTLKHTLTP
1jpdX           ---------------------------------------GIKGTGECTPYPRYGESDASVMAQIMSVVPQ
3dfyL           ------------------------ESESRNVEVEIVLESGVKGYGEASPS--FRVNGERVEALLA-IENA
3dfyN           ------------------------KSESRNVEVEIVLESGVKGYGEASPS--FRVNGERVEALLA-IENA
3dfyH           ------------------------EKESRNVEVEIVLESGVKGYGEASPS--FRVNGERVEALLA-IENA
3dfyF           -------------------------SESRNVEVEIVLESGVKGYGEASPS--FRVNGERVEALLA-IENA
3dfyE           --------------------------ESRNVEVEIVLESGVKGYGEASPS--FRVNGERVEALLA-IENA
3dfyB           --------------------------ESRNVEVEIVLESGVKGYGEASPS--FRVNGERVEALLA-IENA
2qdeA           ----------------------------DGVLLKLHSDEGLVGIADAGDTSSWGETQDSITSMICDFFAP
3dfyA           -------------------------------------ESGVKGYGEASPS--FRVNGERVEALLA-IENA
3derA           -------------------------------------ESGVKGYGEASPS--FRVNGERVEALLA-IENA
3ik4B           -------EAINLPLTEPFAIASGAQAVAANVLVKVQLADGTLGLGEAAPPAVSGETQTGTSAAI-ERLQS
3ik4A           -------EAINLPLTEPAV--------AANVLVKVQLADGTLGLGEAAPPAVSGETQTGTSAAI-ERLQS
3ik4D           -------EAINLPL---------TEAVAANVLVKVQLADGTLGLGEAAPPAVSGETQTGTSAAI-ERLQS
3ik4C           -------EAINLPL---------TEAVAANVLVKVQLADGTLGLGEAAPPAVSGETQTGTSAAI-ERLQS
2bahA           ----------------------------------------------------------------------
2zadA           -------------------------------------ESGVKGYGEASPS--FRVNGERVEALLAIENAV
3dg6A           ----------SIPYTKPLRFASGEVHAAEHVLVRVHTDDGIVGVAEAPPRPFYGETQTGIVAVIEQYF-A
3eezA           --------QVDLPLEHPYWKFE--LLDA--TLVKLETDAGITGWGEGTPWGH-----TYVPAHGPGIRAG
3dg3A           ----------------PFSI---PYTAAEHVLVRVHTDDGIVGVAEAPPRPFYGETQTGIVAVIEQYF-A
3mucA           ----------------------------------------------------------------------
2mucA           ----------------------------------------------------------------------
1mucA           ----------------------------------------------------------------------
3dgbA           ---------VDLPTIRPHKLAMHTMQNQTLVLIRLRCADGIEGLGESTTIAYGNESPDSIKTNIDRFVAP
1bkhC           ----------------------------------------------------------------------
1bkhB           ----------------------------------------------------------------------
1bkhA           ----------------------------------------------------------------------
1f9cA           ----------------------------------------------------------------------
1chrA           ----------------------------------------------------------------------
1wufA           -----------LPLLAPFKTSYGELKSKDFYIIELINEEGIHGYGEAFPLPDYTEETLSSEQLLPLL--A
1sjdB           -----ELRRVQMPLVAPFRTSFGTQSVRELLLLRAVTPAGCVTMAGPLYSSEYNDGAEHVHYLIPALLAA
1sjdA           -----ELRRVQMPLVAPFRTSFGTQSVRELLLLRAVTPAGCVTMAGPLYSSEYNDGAEHVHYLIPALLAA
3ct2A           ------------------------------VLIRLRCADGIEGLGESTTIAYGNESPDSIKTNIDRFVAP
1xpyC           -----------LPLKFRFETSFGVQTH-KVVPLLILHGEGVQGVAEGTMEARPMYREETIAGAL-DLLRG
1r0mA           ----------------------------------------------------------------------
2gggC           ----------------------------------------------------------------------
2gggA           ----------------------------------------------------------------------
2ggjA           ----------------------------------------------------------------------
3fcpE           ------------------------------VIVRLTRSDGICGIGEATTGLSYGESPEAISSAITHYLTP
3fcpB           ------------------------------VIVRLTRSDGICGIGEATTGLSYGESPEAISSAITHYLTP
3fcpA           ------------------------------VIVRLTRSDGICGIGEATTGLSYGESPEAISSAITHYLTP
2ggiA           ----------------------------------------------------------------------
1wueB           -----ETYQVRLPLKTPFVTSYGRLEEKAFDLFVITDEQGNQGFGELVAFEQPDYVQETLQHLIPLLL--
1wueA           -----ETYQVRLPLKTPFVTSYGRLEEKAFDLFVITDEQGNQGFGELVAFEQPDYVQETLQHLIPLLL--
3fv9A           -----DIHRTDLPV-------RGHSYDA--TIVSIETDTGLTGWGESTPAAHAGGTRAALELLAPAILGM
2pmqB           ----------------------------------------------------------------------
2pmqA           ----------------------------------------------------------------------
2zc8A           ----------------------------------------------------------------------
3fv9B           -----DIHRTDLPVRG------GEYHSYDATIVSIETDTGLTGWGESTPAAHAGGTRAALELLAPAILGM
1nu5A           ------------------------------------------------------ESAETIKVIIDNYLAP
2pceB           -------------------------------IVSIETDTGLTGWGESTPAAHAGGTRAALELLAPAILGM
2pceA           -------------------------------IVSIETDTGLTGWGESTPAAHAGGTRAALELLAPAILGM
3fv9H           -------------------------------IVSIETDTGLTGWGESTPAAHAGGTRAALELLAPAILGM
3fv9G           -------------------------------IVSIETDTGLTGWGESTPAAHAGGTRAALELLAPAILGM
2pgwC           -----------LPLKQPYHWSYGIRESFAVNLIEIEADDGTVGIGECTVAPDQTGTAAILYRLAKHLVGS
2pgwB           -----------LPLKQPYHWSYGIRESFAVNLIEIEADDGTVGIGECTVAPDQTGTAAILYRLAKHLVGS
2pgwA           -----------LPLKQPYHWSYGIRESFAVNLIEIEADDGTVGIGECTVAPDQTGTAAILYRLAKHLVGS
2pceF           -------------------------------IVSIETDTGLTGWGESTPAAHAGGTRAALELLAPAILGM
3i6tC           -------------------------TAVEVVVLRLQADSGAVGYGEASPWVVFTGSVEATYAALDRYLRP
3i6tD           ----------------------------EVVVLRLQADSGAVGYGEASPWVVFTGSVEATYAALDRYLRP
3i6tB           ----------------------------EVVVLRLQADSGAVGYGEASPWVVFTGSVEATYAALDRYLRP
3i6tA           ----------------------------EVVVLRLQADSGAVGYGEASPWVVFTGSVEATYAALDRYLRP
3bjsB           ----------------------GSTIKRDAIIIRVETSEGITGYGEAHPGRSPGAITSLIHNTIAPMLKA
3bjsA           ----------------------GSTIKRDAIIIRVETSEGITGYGEAHPGRSPGAITSLIHNTIAPMLKA
2ovlD           --------------------------DFELITVRIEDSDGATGLGYTYTVNHGGAAVATVDKDLRGCLEQ
2ovlA           --------------------------DFELITVRIEDSDGATGLGYTYTVNHGGAAVATVDKDLRGCLEQ
2ggeD           -------------LEKPYGDANGFKRYRTCYLIRIITESGIDGWGECVPALHVGFT----KRIIPFLLG-
2ggeB           -------------LEKPYGDANGFKRYRTCYLIRIITESGIDGWGECVPALHVGFT----KRIIPFLLG-
2gdqA           -------------LEKPYGDANGFKRYRTCYLIRIITESGIDGWGECVPALHVGFT----KRIIPFLLG-
3i6eA           ----------------------------------------------------------------------
2qddA           ---------LDLPLAKPYWLSGLKFDRLDSTYLRIDTDEGVTGWGEGCPPAHGPGLRAGIATLAPHLLGL
3i4kA           ----------------------------------------------------------------------
2qddB           ---------LDLPLAKPFDRLDSTY-------LRIDTDEGVTGWGEGCPPAHGPGLRAGIATLAPHLLGL
3fvdA           ---------LDLPLAKPFDRLDSTY-------LRIDTDEGVTGWGEGCPPAHGPGLRAGIATLAPHLLGL
3fvdB           ---------LDLPLAKPYWLSLKFDR-LDSTYLRIDTDEGVTGWGEGCPPAHGPGLRAGIATLAPHLLGL
2pp1C           -----------LPLATPVSVLTGRQTEVAIIIAEIRSRDGFEGVGGQGIYAHAKEIADNLLGEDPNDIDK
2pp0A           -----------LPLATPVSVLTGRQTEVAIIIAEIRSRDGFEGVGGQGIYAHAKEIADNLLGEDPNDIDK
2pgeA           ----------------------------------------------------------------------
2pp3A           -----------LPLATPVSVLTGRQTEVAIIIAEIRSRDGFEGVGGQGIYAHAKEIADNLLGEDPNDIDK
2oz8A           ----------------------------------------------------------------------
2rdxG           -------------------------TVARASVVVIDTDAGLQGCGEFTPCGENYMIAHSEGVDAFARLAA
2rdxA           -------------------------TVARASVVVIDTDAGLQGCGEFTPCGENYMIAHSEGVDAFARLAA
2pozB           ----------------------------------------------------------------------
2rdxE           -------------------------TVARASVVVIDTDAGLQGCGEFTPCGENYMIAHSEGVDAFARLAA
2pozC           ----------------------------------------------------------------------
3cyjA           ----------------------------------------------------------------------
3gc2A           ----------------------------------------------------------------------
1fhvA           ----------------------------------------------------------------------
2pozH           ----------------------------------------------------------------------
1r6wA           ----------------------------------------------------------------------
2pozA           ----------------------------------------------------------------------
2oqhC           ---------VNLPLVNPFTSSFETKTGEXXXXXXXXXDSGVEGWGETAPVAAIVRRAPDLIGTSPFALEA
2oqhB           ---------VNLPLVNPFTSSFETKTGEXXXXXXXXXDSGVEGWGETAPVAAIVRRAPDLIGTSPFALEA
1fhuA           ----------------------------------------------------------------------
2ofjA           ----------------------------------------------------------------------
1mraA           ----------------------------------------------------------------------
3cb3D           ----------------------------------------------------------------------
3cb3C           ----------------------------------------------------------------------
3cb3B           ----------------------------------------------------------------------
3cb3A           ----------------------------------------------------------------------
2mnrA           ----------------------------------------------------------------------
1dtnA           ----------------------------------------------------------------------
1mdlA           ----------------------------------------------------------------------
2ofjD           ----------------------------------------------------------------------
2ofjC           ----------------------------------------------------------------------
2qvhA           ----------------------------------------------------------------------
2oqhA           ---------VNLPLVNPFGETR--------TVVRVRTDSGVEGWGETAPVAAIVRRAPDLIGTSPFALEA
3ddmA           -------------------VFRYPVHDRPAVLVEVEDSDGAVGWGEVFPACGAEHRARLVETVLAPLLTX
3dipA           ----------------------------------------------------------------------
2oqhD           ---------VNLPLVNPFE----TKTGEXXXXXXXXXDSGVEGWGETAPVAAIVRRAPDLIGTSPFALEA
2og9A           ----------------------------------------------------------------------
2oztA           ------------PLQEPLTTAQGVWRSRSGIYLRLEDEQGQVGYGEIAPLPGWGSETLNADIALCQQLPG
2nqlA           ----------------------------------------------------------------------
3h7vA           ------------PLQEPLTTAQGVWRSRSGIYLRLEDEQGQVGYGEIAPLPGWGSETLNADIALCQQLPG
3bsmA           ----------------------------------------------------------------------
2gl5A           -----------------------TMSSYNPVLIRVNTDSGLSGIGGAGAKAGVGIIRDLAPLIVGEDPLN
3dfhA           ----------------------------------------------------------------------
3h12A           ----------------------GLKLNRQMILVEVRTDEGVTGVG--SPSGPYDLAV--LKRAIEDVIGP
2qjmA           ----------------------------------------------------------------------
2qjjC           ----------------------------------------------------------------------
2hxtA           ----------------------------------------------------------------------
2hneD           ----------------------------------------------------------------------
2hneC           ----------------------------------------------------------------------
2hneB           ----------------------------------------------------------------------
2hneA           ----------------------------------------------------------------------
2qjnA           ----------------------------------------------------------------------
2qjmB           ----------------------------------------------------------------------
2olaA           ----------------------------------------------------------------------
2oktA           ----------------------------------------------------------------------
2qjjD           ----------------------------------------------------------------------
3dipB           ----------------------------------------------------------------------
2hxuA           ----------------------------------------------------------------------
2o56G           ------------------------------VVVKINTDEGISGFGGVGASAGIGMAKD-----LSAIIIG
2o56H           ------------------------------VVVKINTDEGISGFGGVGASAGIGMAKD-----LSAIIIG
2o56A           ------------------------------VVVKINTDEGISGFGGVGASAGIGMAKD-----LSAIIIG
2opjA           ----------------------------------------------------------------------
1tzzA           ----------------------------------------------------------------------
3gd6A           ----------------------------KHVIVKIHTDEGLTGIGEMSDFSHLPDLHDLKQGLLSILLNP
3fyyA           ----------------------------KHVIVKIHTDEGLTGIGEMSDFSHLPDLHDLKQGLLSILLNP
3es7A           ----------------------------KHVIVKIHTDEGLTGIGEMSDFSHLPDLHDLKQGLLSILLNP
2qjjA           ----------------------------------------------------------------------
1bqgA           ----------------------------------------------------------------------
2dw7A           ---------ISSPIRNAYIDFTKMTTSLVAVVTDVVREGKRVVGYGFNSNGRYGQGGLIRERFASRILEA
1yeyA           ----------------------------------------------------------------------
2oo6A           ----------------------------------------------------------------------
3go2A           ----------------------------------------------------------------------
1rvkA           ----------------------------------------------------------------------
2dw6A           ---------ISSPIRNAYIDFTKMTTSLVAVVTDVVREGKRVVGYGFNSNGRYGQGGLIRERFASRILEA
1tzzB           ----------------------------------------------------------------------
3gy1A           -----------------------TKPDRHNVVVKVETNKGIYGLGCATFQQRPKAVSLVVSEYLKPIL--
3gy1B           -----------------------TKPDRHNVVVKVETNKGIYGLGCATFQQRPKAVSLVVSEYLKPIL--
1jdfA           ----------------------------------------------------------------------
1jctB           ----------------------------------------------------------------------
1jctA           ----------------------------------------------------------------------
1ec9D           ----------------------------------------------------------------------
1ec9A           ----------------------------------------------------------------------
1ec8A           ----------------------------------------------------------------------
1ec7D           ----------------------------------------------------------------------
1ec7C           ----------------------------------------------------------------------
1ec7B           ----------------------------------------------------------------------
1ec7A           ----------------------------------------------------------------------
2ppgB           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           VERVGDPXXXXXXXXXXXXVVNGNPAARAAVSIAVHDLAAKRLGVPLHRLWGLDPTAAPATSYTIGLDET
1jpmC           ALLGKSLAGYEAILHDIQHLLTGNMSAKAAVEMALYDGWAQMCGLPLYQMLG-GYRDTLETDYTVSVNSP
1jpmA           ALLGKSLAGYEAILHDIQHLLTGNMSAKAAVEMALYDGWAQMCGLPLYQMLG-GYRDTLETDYTVSVNSP
2p8bA           ALIGQNPMNIEKIHDMMDNTIYGVPTAKAAIDIACFDIMGKKLNQPVYQLIGGRYHEEFPVTHVLSIADP
1jpdX           LEK--------GLTREELQKILPAGAARNALDCALWDLAARRQQQSLADLIGITLPETVITAQTVVIGTP
3dfyL           VREMGIDVRNYARIFEITDRLFGFPSLKAAVQFATLDALSQELGTQVCYLLG-GKRDEIETDKTVGIDTV
3dfyN           VREMGIDVRNYARIFEITDRLFGFPSLKAAVQFATLDALSQELGTQVCYLLG-GKRDEIETDKTVGIDTV
3dfyH           VREMGIDVRNYARIFEITDRLFGFPSLKAAVQFATLDALSQELGTQVCYLLG-GKRDEIETDKTVGIDTV
3dfyF           VREMGIDVRNYARIFEITDRLFGFPSLKAAVQFATLDALSQELGTQVCYLLG-GKRDEIETDKTVGIDTV
3dfyE           VREMGIDVRNYARIFEITDRLFGFPSLKAAVQFATLDALSQELGTQVCYLLG-GKRDEIETDKTVGIDTV
3dfyB           VREMGIDVRNYARIFEITDRLFGFPSLKAAVQFATLDALSQELGTQVCYLLG-GKRDEIETDKTVGIDTV
2qdeA           KVLLGDPTKIEKIVGRMDILTRDNNQAKATVDFALHDLVGKRFGVPVYQLLGGKTIERIPLGLXXXXXXX
3dfyA           VREMGIDVRNYARIFEITDRLFGFPSLKAAVQFATLDALSQELGTQVCYLLG-GKRDEIETDKTVGIDTV
3derA           VREMGIDVRNYARIFEITDRLFGFPSLKAAVQFATLDALSQELGTQVCYLLG-GKRDEIETDKTVGIDTV
3ik4B           HLLGADVRGWRKLAAMLDHAEHEAAAARCGLEMAMLDALTRHYHMPLHVFFG-GVSKQLETDMTITAGDE
3ik4A           HLLGADVRGWRKLAAMLDHAEHEAAAARCGLEMAMLDALTRHYHMPLHVFFG-GVSKQLETDMTITAGDE
3ik4D           HLLGADVRGWRKLAAMLDHAEHEAAAARCGLEMAMLDALTRHYHMPLHVFFG-GVSKQLETDMTITAGDE
3ik4C           HLLGADVRGWRKLAAMLDHAEHEAAAARCGLEMAMLDALTRHYHMPLHVFFG-GVSKQLETDMTITAGDE
2bahA           ----------------------GNRMARAMVEMAAWDLWARTLGVPLCTLLGGHKEQVEVVSLGIQADEQ
2zadA           REITGIDVRNYARIFEITDRLFGFPSLKAAVQFATLDALSQELGTQVCYLLG-GKRDEIETDKTVGIDTV
3dg6A           PALIGLTLTEREVAHTRMARTVGNPTAKAAIDMAMWDALGQSLRLSVSEMLG-GYTDRMRVSHMLGFDDP
3eezA           IETMADPRRLLDVERAMDIALPGHLYAKSPIDMACWDIAGQAAGLPIADLMGGGSRTPRPIASSVGAKSV
3dg3A           PALIGLTLTEREVAHTRMARTVGNPTAKAAIDMAMWDALGQSLRLSVSEMLG-GYTDRMRVSHMLGFDDP
3mucA           -------------------LAKGNTFAKSGIESALLDAQGKRLGLPVSELLGGRVRDSLEVAWTLASGDT
2mucA           -------------------LAKGNTFAKSGIESALLDAQGKRLGLPVSELLGGRVRDSLEVAWTLASGDT
1mucA           -------------------LAKGNTFAKSGIESALLDAQGKRLGLPVSELLGGRVRDSLEVAWTLASGDT
3dgbA           LLIGQDASNINAAMLRLEQSIRGNTFAKSGIESALLDAQGKRLGLPVSELLGGRVRDALPVAWTLASGDT
1bkhC           -------------------LAKGNTFAKSGIESALLDAQGKRLGLPVSELLGGRVRDSLEVAWTLASGDT
1bkhB           -------------------LAKGNTFAKSGIESALLDAQGKRLGLPVSELLGGRVRDSLEVAWTLASGDT
1bkhA           -------------------LAKGNTFAKSGIESALLDAQGKRLGLPVSELLGGRVRDSLEVAWTLASGDT
1f9cA           -------------------LAKGNTFAKSGIESALLDAQGKRLGLPVSELLGGRVRDSLEVAWTLASGDT
1chrA           --------------------VTGNASAKAAVEMALLDLKARALGVSIAELLGGPLRSAIPIAWTLASGDT
1wufA           QRKIRKPEEIQELFSW----IQGNEMAKAAVELAVWDAFAKMEKRSLAKMIGATKESIKV-GVSIGLQQN
1sjdB           EDITAAKVTPLLAKF------KGHRMAKGALEMAVLDAELRAHERSFAAELGSVRDSVPCGVSVGIMDTI
1sjdA           EDITAAKVTPLLAKF------KGHRMAKGALEMAVLDAELRAHERSFAAELGSVRDSVPCGVSVGIMDTI
3ct2A           LLIGQDASNINAAMLRLEQSIRGNTFAKSGIESALLDAQGKRLGLPVSELLGGRVRDALPVAWTLASGDT
1xpyC           TAILGQTFANPEAVSDALGSYRGNRMARAMVEMAAWDLWARXXXXXXXXXXXXHKEQVEVVSLGIQADEQ
1r0mA           ----------------------GNRMARAMVEMAAWDLWARXXXXXXXXXXXXHKEQVEVVSLGIQADEQ
2gggC           ----------------------GNRMARAMVEMAAWDLWARXXXXXXXXXXXXHKEQVEVVSLGIQADEQ
2gggA           ----------------------GNRMARAMVEMAAWDLWARXXXXXXXXXXXXHKEQVEVVSLGIQADEQ
2ggjA           ----------------------GNRMARAMVEMAAWDLWARXXXXXXXXXXXXHKEQVEVVSLGIQADEQ
3fcpE           LLKGQPADNLNALTARMNGAIKGNTFAKSAIETALLDAQGKALGLPVSALLGGALQTALPVLWTLASGDT
3fcpB           LLKGQPADNLNALTARMNGAIKGNTFAKSAIETALLDAQGKALGLPVSALLGGALQTALPVLWTLASGDT
3fcpA           LLKGQPADNLNALTARMNGAIKGNTFAKSAIETALLDAQGKALGLPVSALLGGALQTALPVLWTLASGDT
2ggiA           ----------------------GNRMARAMVEMAAWDLWARXXXXXXXXXXXXHKEQVEV-GVSLGIQDC
1wueB           TEAIEQPQEVSTIFEE----VKGHWMGKAALETAIWDLYAKRQQKSLTEFFGPTRRKIPV-GISLGIQED
1wueA           TEAIEQPQEVSTIFEE----VKGHWMGKAALETAIWDLYAKRQQKSLTEFFGPTRRKIPV-GISLGIQED
3fv9A           -----DPRQHDRIWDRMRDTLKGHRDARAALDIACWDIAAQAAGLPLCDMTGGRVAGPVPVISSIGGDTP
2pmqB           ----------------------GHNYAKSALDIAVHDLWGKRLGVPVHELLGGALTDSVSSYYSLGVEPD
2pmqA           ----------------------GHNYAKSALDIAVHDLWGKRLGVPVHELLGGALTDSVSSYYSLGVEPD
2zc8A           ----------------------GNPMAKAVLEMAFFDLWAKALGRPLWQVLG-GVRQAVEVGVSLGIQPS
3fv9B           -----DPRQHDRIWDRMRDTLKGHRDARAALDIACWDIAAQAAGLPLCDMTGGRVAGPVPVISSIGGDTP
1nu5A           LLVGKDASNLSQARVLMDRAVTGNLSAKAAIDIALHDLKARALNLSIADLIGGTMRTSIPIAWTLASGDT
2pceB           -----DPRQHDRIWDRMRDTLKGHRDARAALDIACWDIAAQAAGLPLCDMTGGRVAGPVPVISSIGGDTP
2pceA           -----DPRQHDRIWDRMRDTLKGHRDARAALDIACWDIAAQAAGLPLCDMTGGRVAGPVPVISSIGGDTP
3fv9H           -----DPRQHDRIWDRMRDTLKGHRDARAALDIACWDIAAQAAGLPLCDMTGGRVAGPVPVISSIGGDTP
3fv9G           -----DPRQHDRIWDRMRDTLKGHRDARAALDIACWDIAAQAAGLPLCDMTGGRVAGPVPVISSIGGDTP
2pgwC           PHDVAPLIARIFHQEYLGHGANIRAANQIFSGIDAWDLQGKLAGLPVHQLLGGAHRKAVGYFYFLQGETA
2pgwB           PHDVAPLIARIFHQEYLGHGANIRAANQIFSGIDAWDLQGKLAGLPVHQLLGGAHRKAVGYFYFLQGETA
2pgwA           PHDVAPLIARIFHQEYLGHGANIRAANQIFSGIDAWDLQGKLAGLPVHQLLGGAHRKAVGYFYFLQGETA
2pceF           -----DPRQHDRIWDRMRDTLKGHRDARAALDIACWDIAAQAAGLPLCDMTGGRVAGPVPVISSIGGDTP
3i6tC           LRAVGD---HAAIMEDARAAVAHCTEAKAALDTALYDLRARIAGVPVWALLGGRCRDRIPLSCSIADPDF
3i6tD           LRAVGD---HAAIMEDARAAVAHCTEAKAALDTALYDLRARIAGVPVWALLGGRCRDRIPLSCSIADPDF
3i6tB           LRAVGD---HAAIMEDARAAVAHCTEAKAALDTALYDLRARIAGVPVWALLGGRCRDRIPLSCSIADPDF
3i6tA           LRAVGD---HAAIMEDARAAVAHCTEAKAALDTALYDLRARIAGVPVWALLGGRCRDRIPLSCSIADPDF
3bjsB           TDCVGAWQRVHRMQXXXXXXXXXXXXXXXXXDMALWDIRGKAANMPLYELLGGSKRRIPAYAIALGYQPK
3bjsA           TDCVGAWQRVHRMQXXXXXXXXXXXXXXXXXDMALWDIRGKAANMPLYELLGGSKRRIPAYAIALGYQPK
2ovlD           IEKIWQSWWRLHYAGRGGHATS----AISAVDIALWDLKGIRARTPLWKLFGGYDPVVPVYAGGIDLEPV
2ovlA           IEKIWQSWWRLHYAGRGGHATS----AISAVDIALWDLKGIRARTPLWKLFGGYDPVVPVYAGGIDLEPV
2ggeD           -KQAGS------RLSLVRTIQKWHQRAASAVSMALTEIAAKAADCSVCELWGGRPVYASFQSYSDSPQWI
2ggeB           -KQAGS------RLSLVRTIQKWHQRAASAVSMALTEIAAKAADCSVCELWGGRPVYASFQSYSDSPQWI
2gdqA           -KQAGS------RLSLVRTIQKWHQRAASAVSMALTEIAAKAADCSVCELWGGRPVYASFQSYSDSPQWI
3i6eA           ----------------------------------------------------------------------
2qddA           -----DPRSLDHVNRVMDLQLPGHSYVKSPIDMACWDILGQVAGLPLWQLLGGEAATPVPINSSISTGTP
3i4kA           -----------------------------------HDAWARSLNVPVRDLLGGTVRDKVDVTWALGVLPL
2qddB           -----DPRSLDHVNRVMDLQLPGHSYVKSPIDMACWDILGQVAGLPLWQLLGGEAATPVPINSSISTGTP
3fvdA           -----DPRSLDHVNRVMDLQLPGHSYVKSPIDMACWDILGQVAGLPLWQLLGGEAATPVPINSSISTGTP
3fvdB           -----DPRSLDHVNRVMDLQLPGHSYVKSPIDMACWDILGQVAGLPLWQLLGGEAATPVPINSSISTGTP
2pp1C           I--------YTKLLWAGASVGRSGMAVQAIIDIALWDMKAKRAGLPLAKLLGAHRDSVQCYNTSGGFLHT
2pp0A           I--------YTKLLWAGASVGRSGMAVQAIIDIALWDMKAKRAGLPLAKLLGAHRDSVQCYNTSGGFLHT
2pgeA           ----------------------------------------------------------------IWMGEA
2pp3A           I--------YTKLLWAGASVGRSGMAVQAIIDIALWDMKAKRAGLPLAKLLGAHRDSVQCYNTSGGFLHT
2oz8A           -----------------------------AVQVALWDLAAKEAGLPLHVLLGSRRNRVKA--YASGLDDD
2rdxG           PQLLGDPRQVARMERLMDHLVQGHGYAKAPFDAAFWDILGQATGQPVWMLLG-GKLCDGAPMYRVAPQRS
2rdxA           PQLLGDPRQVARMERLMDHLVQGHGYAKAPFDAAFWDILGQATGQPVWMLLG-GKLCDGAPMYRVAPQRS
2pozB           ---------------------------------ALWDIKGKCLGVPVYELFGRDRVRAYANGWYGAADTP
2rdxE           PQLLGDPRQVARMERLMDHLVQGHGYAKAPFDAAFWDILGQATGQPVWMLLG-GKLCDGAPMYRVAPQAE
2pozC           ---------------------------------ALWDIKGKCLGVPVYELFGRDRVRAYANGWYGAADTP
3cyjA           --------------------------AVSAVDIALWDLKARLLGLPLADALPRFHAEVPVTSYPL-----
3gc2A           ----------------------------------------------------------------------
1fhvA           ----------------------------------------------------------------------
2pozH           ---------------------------------ALWDIKGKCLGVPVYELFGRDRVRAYANGWYGAADTP
1r6wA           ----------------------------------------------------------------------
2pozA           ---------------------------------ALWDIKGKCLGVPVYELFGRDRVRAYANGWYGAADTP
2oqhC           FHRKQHVPFFYGYLGY---------AAIAAVDVACWD-AGKATGQSVDLLGGAVRDEVPITALITRADDL
2oqhB           FHRKQHVPFFYGYLGY---------AAIAAVDVACWD-AGKATGQSVDLLGGAVRDEVPITALITRADDL
1fhuA           ----------------------------------------------------------------------
2ofjA           ----------------------------------------------------------------------
1mraA           ---------------------------------------------PLVKLLGAN--ARPVQAYSHSLDGV
3cb3D           --------------------------AIGAFDVALWDLKAKRAGLSLAKLLGSYRDSVRCYNTSGGFLHT
3cb3C           --------------------------AIGAFDVALWDLKAKRAGLSLAKLLGSYRDSVRCYNTSGGFLHT
3cb3B           --------------------------AIGAFDVALWDLKAKRAGLSLAKLLGSYRDSVRCYNTSGGFLHT
3cb3A           --------------------------AIGAFDVALWDLKAKRAGLSLAKLLGSYRDSVRCYNTSGGFLHT
2mnrA           ---------------------------------------------PLVKLLGAN--ARPVQAYSHSLDGV
1dtnA           ---------------------------------------------PLVKLLGAN--ARPVQAYSHSLDGV
1mdlA           ---------------------------------------------PLVKLLGAN--ARPVQAYSHSLDGV
2ofjD           ----------------------------------------------------------------------
2ofjC           ----------------------------------------------------------------------
2qvhA           -----------------------------------------------------DTVPVNATVPAVGPEEA
2oqhA           FHRKQHVPFFYGYLGY---------AAIAAVDVACWD-AGKATGQSVDLLGGAVRDEVPITALITRADDL
3ddmA           XXXXXXXXXXXHLEARTAVLATGEPGAIAGLDIALCDLAARRAGQPLWAWLGGSGDRIGVYASGINPENP
3dipA           --------------------------------IALWDLAGQRAGVPLHALGGAARDRVPVYATCAGYDFD
2oqhD           FHRKQHVPFFYGYLGY---------AAIAAVDVACWD-AGKATGQSVDLLGGAVRDEVPITALITRADDL
2og9A           --------------------------AIGAFDVALWDLKAKRAGLSLAKLLGSYRDSVRCYNTSGGFLHT
2oztA           -----------HLTPEIATIPEALPAAQFGFATAWQSVGRLPYRV---RPW---PICALLGSGQAALEQW
2nqlA           -------------------------------------------------------------AYVSGLPET
3h7vA           -----------HLTPEIATIPEALPAAQFGFATAWQSVGRLPYRV---RPW---PICALLGSGQAALEQW
3bsmA           --------------------------AIAAVDMALWDIKAKAAGMPLYQLLGGKSTYAHCTGQTI-----
2gl5A           IEKIWE----FFFRKTFWGMGGGNVAGMSAIDIALWDIKGKYLGVPVYQLLGGKTTYASQLQFGWGLVTP
3dfhA           --------------------------AISGVDMALWDIKAKLAGMPLHQLFGKSRDAIPVYTHATS-DTM
3h12A           QLIGEDPANINYLWHK---VFHGEVAAMSGVDIALWDLKGRAMNQPIYQLLGFHTRGVRAYASSIYWDLT
2qjmA           --------------------------AIAAVDMALWDIKAKMAGMPLYQLLGRSRDGIMVYGHANGSDIA
2qjjC           --------------------------AIAAVDMALWDIKAKMAGMPLYQLLGRSRDGIMVYGHANGSDIA
2hxtA           ----------------------------------------------------------------LGYSDE
2hneD           ----------------------------------------------------------------LGYSDE
2hneC           ----------------------------------------------------------------LGYSDE
2hneB           ----------------------------------------------------------------LGYSDE
2hneA           ----------------------------------------------------------------LGYSDE
2qjnA           --------------------------AIAAVDMALWDIKAKMAGMPLYQLLGRSRDGIMVYGHANGSDIA
2qjmB           --------------------------AIAAVDMALWDIKAKMAGMPLYQLLGRSRDGIMVYGHANGSDIA
2olaA           --------------------LENTPAARATIVMALYQM--------FHVL--------PSFSVAYGATAS
2oktA           --------------------LENTPAARATIVMALYQM--------FHVL--------PSFSVAYGATAS
2qjjD           --------------------------AIAAVDMALWDIKAKMAGMPLYQLLGRSRDGIMVYGHANGSDIA
3dipB           --------------------------------IALWDLAGQRAGVPLHVALG----GAARDRVPVYATFM
2hxuA           ----------------------------------------------------------------LGYSDE
2o56G           MDPMNNEAIWEKMLKKTFWGQGGGSAAMSGIDIALWDIKGKAWGVPLYKMLGREKIRTYASQLQFGLTEP
2o56H           MDPMNNEAIWEKMLKKTFWGQGGGSAAMSGIDIALWDIKGKAWGVPLYKMLGREKIRTYASQLQFGLTEP
2o56A           MDPMNNEAIWEKMLKKTFWGQGGGSAAMSGIDIALWDIKGKAWGVPLYKMLGREKIRTYASQLQFGLTEP
2opjA           -----------------------------------------------------DTVPVNATVPAVGPEEA
1tzzA           --------------------------AVGTIDMAVWDAVAKIAGKPLFRLLGVKANPRVFVYAAGGYYGL
3gd6A           FDLMKINKELTDNFPETMYYYEKGSFIRNGIDNALHDLCAKYLDISVSDFLGGRVKEKIKVCYPIFREEV
3fyyA           FDLMKINKELTDNFPETMYYYEKGSFIRNGIDNALHDLCAKYLDISVSDFLGGRVKEKIKVCYPIFREEV
3es7A           FDLMKINKELTDNFPETMYYYEKGSFIRNGIDNALHDLCAKYLDISVSDFLGGRVKEKIKVCYPIFREEV
2qjjA           --------------------------AIAAVDMALWDIKAKMAGMPLYQLLGRSRDGIMVYGHANGSDIA
1bqgA           ----------------------------------------------------------------------
2dw7A           LNEAGD--NLDPDKVWAAMMINEKPGAVGTIDMAVWDAVAKIAGKPLFRLLAANPRVXXXXXXXXXXXXL
1yeyA           -------------------------------------------------------------AYTTSPGWD
2oo6A           ----------------------------------------------------------------------
3go2A           ----------------------------------------------------------------------
1rvkA           ----------------------------AVVDCALWDLAGRSLGQPVYKLIGLAYGSICGDELEGGLATP
2dw6A           LNEAGD--NLDPDKVWAAMMINEKPGAVGTIDMAVWDAVAKIAGKPLFRLLAANPRVXXXXXXXXXXXXL
1tzzB           --------------------------AVGTIDMAVWDAVAKIAGKPLFRLLAANPRVXXXXXXXXXXXXL
3gy1A           IGRDANNIEDLWQMMMVNSYWRNGPILNNAISMALWDIKGKLANMPLYQLFGGKSRDAIAAYTHAVADNL
3gy1B           IGRDANNIEDLWQMMMVNSYWRNGPILNNAISMALWDIKGKLANMPLYQLFGGKSRDAIAAYTHAVADNL
1jdfA           ----------------------------------------------------------------------
1jctB           ----------------------------------------------------------------------
1jctA           ----------------------------------------------------------------------
1ec9D           ----------------------------------------------------------------------
1ec9A           ----------------------------------------------------------------------
1ec8A           ----------------------------------------------------------------------
1ec7D           ----------------------------------------------------------------------
1ec7C           ----------------------------------------------------------------------
1ec7B           ----------------------------------------------------------------------
1ec7A           ----------------------------------------------------------------------
2ppgB           ----------------------------------------KLAGLPVCKLLGGQRRDRIA-AYISGLPED


                         +         .         .         .         .         *         .:210
query           ERVREKAEAAVDAGYPILKIKLGTDRDRELIDAVREAAPDARLRVDANEAWTPREAVRKCEWLADRDVEF
1jpmC           EEMAADAENYLKQGFQTLKIKVGKDTDIARIQEIRKRVGSAKLRLDANQGWRPKEAVTAIRKMEDAGIEL
1jpmA           EEMAADAENYLKQGFQTLKIKVGKDTDIARIQEIRKRVGSAKLRLDANQGWRPKEAVTAIRKMEDAGIEL
2p8bA           ENMAEEAASMIQKGYQSFKMKVGTNEDVKRIEAVREVGNDIAIRVDVNQGWNSANTLTALRSLGHLNIDW
1jpdX           DQMANSASTLWQAGAKLLKVKLDNHLISERMVAIRTAVPDATLIVDANESWRAEGLAARCQLLADLGVAM
3dfyL           ENRVKEAKKIFEEGFRVIKIKVGENEDIEAVEEIAKVTRGAKYIVDANMGYTQKEAVEFARAVYQKDIAV
3dfyN           ENRVKEAKKIFEEGFRVIKIKVGENEDIEAVEEIAKVTRGAKYIVDANMGYTQKEAVEFARAVYQKDIAV
3dfyH           ENRVKEAKKIFEEGFRVIKIKVGENEDIEAVEEIAKVTRGAKYIVDANMGYTQKEAVEFARAVYQKDIAV
3dfyF           ENRVKEAKKIFEEGFRVIKIKVGENEDIEAVEEIAKVTRGAKYIVDANMGYTQKEAVEFARAVYQKDIAV
3dfyE           ENRVKEAKKIFEEGFRVIKIKVGENEDIEAVEEIAKVTRGAKYIVDANMGYTQKEAVEFARAVYQKDIAV
3dfyB           ENRVKEAKKIFEEGFRVIKIKVGENEDIEAVEEIAKVTRGAKYIVDANMGYTQKEAVEFARAVYQKDIAV
2qdeA           XXXXXXXXXXXXXXFHFVKLKAGLKADIAMVAEVRRAVDDVDLFIDINGAWTYDQALTTIRALEKYNLSK
3dfyA           ENRVKEAKKIFEEGFRVIKIKVGENEDIEAVEEIAKVTRGAKYIVDANMGYTQKEAVEFARAVYQKDIAV
3derA           ENRVKEAKKIFEEGFRVIKIKVGENEDIEAVEEIAKVTRGAKYIVDANMGYTQKEAVEFARAVYQKDIAV
3ik4B           VHAAASAKAILARGIKSIKVKAGVDYDLARLRAIHQAAPTAPLIVDGNCGYDVERALAFCAACKAESIPM
3ik4A           VHAAASAKAILARGIKSIKVKTGVDVAYDLLRAIHQAAPTAPLIVDGNCGYDVERALAFCAACKAESIPM
3ik4D           VHAAASAKAILARGIKSIKVKTGVDVAYDLLRAIHQAAPTAPLIVDGNCGYDVERALAFCAACKAESIPM
3ik4C           VHAAASAKAILARGIKSIKVKTGVDVAYDLLRAIHQAAPTAPLIVDGNCGYDVERALAFCAACKAESIPM
2bahA           ATV-DLVRRHVEQGYRRIKLKIKPGWDVQPVRATREAFPDIRLTVDANSAYTLADAGR-LRQLDEYDLTY
2zadA           ENRVKEAKKIFEEGFRVIKIKVGENEDIEAVEEIAKVTRGAKYIVDAN-GYTQKEAVEFARAVYQKDIAV
3dg6A           VKMVAEAERIRETGINTFKVKVGVQLDTAVVRALRERFGDAELYVDGNRGWSAAESLRAMREMADLDLLF
3eezA           EETRAVIDRYRQRGYVAHSVKIGGDVERDIVEDIRE--PGEIVLYDVNRGWTRQQALRVMRATEDLHVMF
3dg3A           VKMVAEAERIRETGINTFKVKVGVQLDTAVVRALRERFGDAELYVDGNRGWSAAESLRAMREMADLDLLF
3mucA           ARDIAEARHMLEIRHRVFKLKIGAEQDKHVVTIKRELGDSASVRVDVNQYWDESQAIRACQVLGDNGIDL
2mucA           ARDIAEARHMLEIRHRVFKLKIGAEQDKHVVTIKRELGDSASVRVDVNQYWDESQAIRACQVLGDNGIDL
1mucA           ARDIAEARHMLEIRHRVFKLKIGAEQDKHVVTIKRELGDSASVRVDVNQYWDESQAIRACQVLGDNGIDL
3dgbA           AKDIAEAQKMLDLRHRIFKLKIGADRDLAHVIAIKKALGDASVRVDVNQAWDEAVALRACRILGGNGIDL
1bkhC           ARDIAEARHMLEIRHRVFKLKIGAEQDKHVVTIKRELGDSASVRVDVNQYWDESQAIRACQVLGDNGIDL
1bkhB           ARDIAEARHMLEIRHRVFKLKIGAEQDKHVVTIKRELGDSASVRVDVNQYWDESQAIRACQVLGDNGIDL
1bkhA           ARDIAEARHMLEIRHRVFKLKIGAEQDKHVVTIKRELGDSASVRVDVNQYWDESQAIRACQVLGDNGIDL
1f9cA           ARDIAEARHMLEIRHRVFKLKIGANNLKHVVTIKRELGDSASVRVDVNQYWDESQAIRACQVLGDNGIDL
1chrA           KRDLDSAVEMIERRHNRFKVKLGPQDDLIHMEALSNSGSKAYLRVDVNQAWDEQVASVYIPELEALGVEL
1wufA           ETLLQLVNQYVDQGYERVKLKIAPNKDIQFVEAVRKSFPKLSLMADANSAYN-REDFLLLKELDQYDLEM
1sjdB           PQLLDVVGGYLDEGYVRIKLKIEPGWDVEPVRAVRERGDDVLLQVDANTAYTLGDAPQLAR-LDPFGLLL
1sjdA           PQLLDVVGGYLDEGYVRIKLKIEPGWDVEPVRAVRERGDDVLLQVDANTAYTLGDAPQLAR-LDPFGLLL
3ct2A           AKDIAEAQKMLDLRHRIFKLKIGADRDLAHVIAIKKALGDASVRVDVNQAWDEAVALRACRILGGNGIDL
1xpyC           ATV-DLVRRHVEQGYRRIKLKIKPGWDVQPVRATREAFPDIRLTVDANSAYTLADAGR-LRQLDEYDLTY
1r0mA           ATV-DLVRRHVEQGYRRIKLKIKPGWDVQPVRATREAFPDIRLTVDANSAYTLADAGR-LRQLDEYDLTY
2gggC           ATV-DLVRRHVEQGYRRIKLKIKPGWDVQPVRATREAFPDIRLTVDANSAYTLADAGR-LRQLDEYDLTY
2gggA           ATV-DLVRRHVEQGYRRIKLKIKPGWDVQPVRATREAFPDIRLTVDANSAYTLADAGR-LRQLDEYDLTY
2ggjA           ATV-DLVRRHVEQGYRRIKLKIKPGWDVQPVRATREAFPDIRLTVDANSAYTLADAGR-LRQLDEYDLTC
3fcpE           AKDIAEGEKLLARAF---KLKIGAREDLRHTRAIVEALGDASIRVDVNQAWDAATGAKGCRELAAMGVDL
3fcpB           AKDIAEGEKLLARAF---KLKIGAREDLRHTRAIVEALGDASIRVDVNQAWDAATGAKGCRELAAMGVDL
3fcpA           AKDIAEGEKLLARAF---KLKIGAREDLRHTRAIVEALGDASIRVDVNQAWDAATGAKGCRELAAMGVDL
2ggiA           QATVDLVRRHVEQGYRRIKLKIKPGWDVQPVRCTREAFPDIRLTVDANSAYTLADAGR-LRQLDEYDLTY
1wueB           PQLLKQVQLAVEKGYQRVKLKIRPGYDVEPVALIRQHFPNLPLMVDANSAYTLAD-LPQLQRLDHYQLAM
1wueA           PQLLKQVQLAVEKGYQRVKLKIRPGYDVEPVALIRQHFPNLPLMVDANSAYTLAD-LPQLQRLDHYQLAM
3fv9A           EAMRAKVARHRAQGFKGHSIKIGASEDAERITALADRQPGEWYLADANNGLTVEHALRMLSLLPPGLDIV
2pmqB           EAARQALEKQRE-GYSRLQVKLGARPIEIDIEAIRKVWEAVRLAADGNRGWTTRDALRECP-----DIPF
2pmqA           EAARQALEKQRE-GYSRLQVKLGARPIEIDIEAIRKVWEAVRLAADGNRGWTTRDALRECP-----DIPF
2zc8A           EDTLRVVERHLEEGYRRIKLKIKPGWDYEVLKAVREAFPEATLTADANSAYSLAN-LAQLKRLDELRLDY
3fv9B           EAMRAKVARHRAQGFKGHSIKIGASEDAERITALADRQPGEWYLADANNGLTVEHALRMLSLLPPGLDIV
1nu5A           ARDIDSALEMIETRHNRFKVKLGARQDLEHIRSIVKAVGDASVRVDVNQGWDEQTASIWIPRLEEAGVEL
2pceB           EAMRAKVARHRAQGFKGHSIKIGASEDAERITALADRQPGEWYLADANNGLTVEHALRMLSLLPPGLDIV
2pceA           EAMRAKVARHRAQGFKGHSIKIGASEDAERITALADRQPGEWYLADANNGLTVEHALRMLSLLPPGLDIV
3fv9H           EAMRAKVARHRAQGFKGHSIKIGASEDAERITALADRQPGEWYLADANNGLTVEHALRMLSLLPPGLDIV
3fv9G           EAMRAKVARHRAQGFKGHSIKIGASEDAERITALADRQPGEWYLADANNGLTVEHALRMLSLLPPGLDIV
2pgwC           EELARDAAVGHAQGERVFYLKVGRGEDLEITAAVRGEIGDARLRLDANEGWSVHDAI-NCRKLEKYDIEF
2pgwB           EELARDAAVGHAQGERVFYLKVGRGEDLEITAAVRGEIGDARLRLDANEGWSVHDAI-NCRKLEKYDIEF
2pgwA           EELARDAAVGHAQGERVFYLKVGRGEDLEITAAVRGEIGDARLRLDANEGWSVHDAI-NCRKLEKYDIEF
2pceF           EAMR--AKVARHRAFKGHSIKIGASEDAERITALADRQPGEWYLADANNGLTVEHALRMLSLLPPGLDIV
3i6tC           DKDLALMQRLQDDDVRIIKLKTGFKDDMMRLERLRADFPAFDIRVDYNQGLHHDVALARVRDVATFKPTF
3i6tD           DKDLALMQRLQDDDVRIIKLKTGFKDDMMRLERLRADFPAFDIRVDYNQGLHHDVALARVRDVATFKPTF
3i6tB           DKDLALMQRLQDDDVRIIKLKTGFKDDMMRLERLRADFPAFDIRVDYNQGLHHDVALARVRDVATFKPTF
3i6tA           DKDLALMQRLQDDDVRIIKLKTGFKDDMMRLERLRADFPAFDIRVDYNQGLHHDVALARVRDVATFKPTF
3bjsB           ESLAEEAQEYIARGYKALKLRIG-DAARVDIERVRHVGDEVDILTDANTAYTMADARRVLPVLAEIQAGW
3bjsA           ESLAEEAQEYIARGYKALKLRIG-DAARVDIERVRHVGDEVDILTDANTAYTMADARRVLPVLAEIQAGW
2ovlD           ADLKTQADRFLAGGFRAIK-KVGRPDLKEDVDALREHLGDSFPLVDANK-WTVDGAIRAARALAPFDLHW
2ovlA           ADLKTQADRFLAGGFRAIK-KVGRPDLKEDVDALREHLGDSFPLVDANK-WTVDGAIRAARALAPFDLHW
2ggeD           SRSVSNVEAQLKKGFEQIKVKIGGTSFKEHINALQHTAGSSTMILDANQSYDAAAAFKWERYFSETNIGW
2ggeB           SRSVSNVEAQLKKGFEQIKVKIGGTSFKEHINALQHTAGSSTMILDANQSYDAAAAFKWERYFSETNIGW
2gdqA           SRSVSNVEAQLKKGFEQIKVKIGGTSFKEHINALQHTAGSSTMILDANQSYDAAAAFKWERYFSETNIGW
3i6eA           -------------GVGLIKLKTGF-RDHAFLELIARDFPEFRVRVDYNQGLEIDEAVPRVLDVAQFQPDF
2qddA           DQMLGLIAEAAAQGYRTHSAKIGGSQDIARIEAISAGLPDGRVTFDVNRAWTPAIAVEVLNSVRARD--W
3i4kA           DXXXXXXXXXXXXGNRSFKLKGAGDPTRRVAELAREVGDRVSLRIDINARWDRRTALHYLPILAEAGVEL
2qddB           DQMLGLIAEAAAQGYRTHSAKIGGSQDIARIEAISAGLPDGRVTFDVNRAWTPAIAVEVLNSVRARD--W
3fvdA           DQMLGLIAEAAAQGYRTHSAKIGGSQDIARIEAISAGLPDGRVTFDVNRAWTPAIAVEVLNSVRARD--W
3fvdB           DQMLGLIAEAAAQGYRTHSAKIGGSQDIARIEAISAGLPDGRVTFDVNRAWTPAIAVEVLNSVRARD--W
2pp1C           DQVLKNVVISRENGIGGIKLKVGQPNDIRRLTAVREALGDEPLMVDANQQWDRETAIRMGRKMEQFNLIW
2pp0A           DQVLKNVVISRENGIGGIKLKVGQPNDIRRLTAVREALGDEPLMVDANQQWDRETAIRMGRKMEQFNLIW
2pgeA           AFMQEQIEAKLAEGYGCLKLKIDFDKECALLAGIRESFSPQQLRVDANGAFSPANAPQRLKRLSQFHLHS
2pp3A           DQVLKNVVISRENGIGGIKLAVGQPNDIRRLTAVREALGDEPLMVDANQQWDRETAIRMGRKMEQFNLIW
2oz8A           DAFVSLFSHAASIGYSAFKIKVGXXXXXXXXXXXKTCVPGSKVMIDPNEAWTSKEALTKLVAIAGHDLLW
2rdxG           E-AETRAELARHAGYRQFQIKVGADWQSD-IDRIRACLPGEKAMADANQGWRVDNAIRLAR--ATRDLDY
2rdxA           E-AETRAELARHAGYRQFQIKVGADWQSD-IDRIRACLPGEKAMADANQGWRVDNAIRLAR--ATRDLDY
2pozB           DEFARAVERPLKEGYPLAQLQHVTRRSSRRVKAVRDAAGPEIELVDLSGGLTTDETIRFCRKIGELDICF
2rdxE           TRAELARHRA--AGYRQFQIKVGADWQSD-IDRIRACLPGEKAMADANQGWRVDNAIRLAR--ATRDLDY
2pozC           DEFARAVERPLKEGYGALKFRRSSAEAIELVKAVRDAAGPEIELVDLSGGLTTDETIRFCRKIGELDICF
3cyjA           RRLQEQLGGWAAAGIPRVKMKVGREKDPERVRAAREAIGESELMVDANGAYTRKQALYWAGAFAEAGISY
3gc2A           -----------DPGEKIAKVKVGLEAVRDVVNLLLEAIPDLHLRLDANRAWTPLKAQQFAKYVNPARIAF
1fhvA           -------------GEKVAKVKVGAVRDGMVVNLLLEAIPDLHLRLDANRAWTPLKGQQFAKYVRDR-IAF
2pozH           DEFARAVERPLKEGYGALKFYPLAQRSAEAIEAVRDAAGPEIELVDLSGGLTTDETIRFCRKIGELDICF
1r6wA           -------------GEKVAKVRVGAVRDGMVVNLLLEAIPDLHLRLDANRAWTPLKGQQFAKYVRDR-IAF
2pozA           DEFARAVERPLKEGYGALKFRVGSALQHRRVKAVRDAAGPEIELVDLSGGLTTDETIRFCRKIGELDICF
2oqhC           PKAAEHAVRVVEGGFDAVKLKGTTDGDVAILRAVREALPGVNLRVDPNAAWSVPDSVR--AGIAXXXXXX
2oqhB           PKAAEHAVRVVEGGFDAVKLKGTTDGDVAILRAVREALPGVNLRVDPNAAWSVPDSVR--AGIAXXXXXX
1fhuA           ----------------VAKVKVGAVRDGMVVNLLLEAIPDLHLRLDANRAWTPLKGQQFAKYVRDR-IAF
2ofjA           -----RAAPLCNPGEKVAKVKVGAVRDGMVVNLLLEAIPDLHLRLDANRAWTPLKGQQFAKYVRDR-IAF
1mraA           KLATERAVTAAELGFRAVKTKIGLDQDLAVVRSIRQAVDDFGIMVDYNQSLDVPAAIKRSQALQQEGVTW
3cb3D           DQLMVNASASIERGIGGIKLKVGQPDDIARVTAVRKHLGDAPLMVDANQQWDRPTAQRMCRIFEPFNLVW
3cb3C           DQLMVNASASIERGIGGIKLKVGQPDDIARVTAVRKHLGDAPLMVDANQQWDRPTAQRMCRIFEPFNLVW
3cb3B           DQLMVNASASIERGIGGIKLKVGQPDDIARVTAVRKHLGDAPLMVDANQQWDRPTAQRMCRIFEPFNLVW
3cb3A           DQLMVNASASIERGIGGIKLKVGQPDDIARVTAVRKHLGDAPLMVDANQQWDRPTAQRMCRIFEPFNLVW
2mnrA           KLATERAVTAAELGFRAVKTKIGLDQDLAVVRSIRQAVDDFGIMVDYNQSLDVPAAIKRSQALQQEGVTW
1dtnA           KLATERAVTAAELGFRAVKTKIGLDQDLAVVRSIRQAVDDFGIMVDYNQSLDVPAAIKRSQALQQEGVTW
1mdlA           KLATERAVTAAELGFRAVKTRIGLDQDLAVVRSIRQAVDDFGIMVDYNQSLDVPAAIKRSQALQQEGVTW
2ofjD           ----------------VAKVKVGAVRDGMVVNLLLEAIPDLHLRLDANRAWTPLKGQQFAKYVRDR-IAF
2ofjC           ----------------VAKVKVGAVRDGMVVNLLLEAIPDLHLRLDANRAWTPLKGQQFAKYVRDR-IAF
2qvhA           ARI------VASSGCTTAKVKVAERGQSEAVEAVRDAGPRGRVRIDVNGAWDVDTAVR--IRLLDRELEY
2oqhA           PKAAEHAVRVVEGGFDAVKLKGTTDGDVAILRAVREALPGVNLRVDPNAAWSVPDSVR--AGIAXXXXXX
3ddmA           EDVVARKAAE---GYRAFKLKVGFDDARDVRNAVRELLGAATLMADANQGWDLPRARQMAQRLGPAQLDW
3dipA           AGV--LAESLVAEGYAAMKIKDGLEPFRKIRAAVGQR---IEIMCELHSLWGTHAAARICNALADYGVLW
2oqhD           PKAAEHAVRVVEGGFDAVKLKGTTDGDVAILRAVREALPGVNLRVDPNAAWSVPDSVR--AGIAXXXXXX
2og9A           PIDQVNASASIERGIGGIKLKVGQPDDIARVTAVRKHLGDAVPLVDANQQWD-RPTAQRCRIFEPFNLVW
2oztA           QQSWQR-------GQTTFKWKVGVSPEEEXXXXXXXXXXXXXXRLDANGSWDRATANRWFAWLGNGKIEY
2nqlA           LKARELAKYWQDRGFNAFKFATPVADDAEIANLRQVLGPQAKIAADMHWNQTPERALELIAEMQPFDPWF
3h7vA           QQSWQR-------GQTTFKWKVGVSPEEEXXXXXXXXXXXXXXRLDANGSWDRATANRWFAWLGNGKIEY
3bsmA           EDCLGEVARHVELGYRAVRVQSGVPGSTELFAAVRERGXXXXXXXXXXXRLTPIEAARLGKAVEPYHLFW
2gl5A           EEYAEAARAALDDGYDAIKVPLEIDRNGDRIAAMREAGDDADIIVEIHSLLGTNSAIQFAKAIEKYRIFL
3dfhA           EGIYDLVEGFLEKGYKHIRCQLGFDQDQTMFKSLREKGNQFHILHDVHERLFPNQAIQFAKEVEQYKPYF
3h12A           DQAADELAGWVEQGFTAAKLKVGRAKDAANLRAMRQVGADVEILVDANQSLGRHDALAMLRILDEAGCYW
2qjmA           ETV-EAVGHYIDMGYKAIRAQTGVPGTRKALNYVPKLFEELRXXXXXXXRYTPQEAANLGKMLEPYQLFW
2qjjC           ETV-EAVGHYIDMGYKAIRAQTGVPGTRKALNYVPKLFEELRXXXXXXXRYTPQEAANLGKMLEPYQLFW
2hxtA           KLVRLAKEAVAD-GFRTIKLKVGADDIRRCRLARAAIGPDIAMAVDANQRWDVGPAIDWMRQLAEFDIAW
2hneD           KLVRLAKEAVAD-GFRTIKLKVGADDIRRCRLARAAIGPDIAMAVDANQRWDVGPAIDWMRQLAEFDIAW
2hneC           KLVRLAKEAVAD-GFRTIKLKVGADDIRRCRLARAAIGPDIAMAVDANQRWDVGPAIDWMRQLAEFDIAW
2hneB           KLVRLAKEAVAD-GFRTIKLKVGADDIRRCRLARAAIGPDIAMAVDANQRWDVGPAIDWMRQLAEFDIAW
2hneA           KLVRLAKEAVAD-GFRTIKLKVGADDIRRCRLARAAIGPDIAMAVDANQRWDVGPAIDWMRQLAEFDIAW
2qjnA           ETV-EAVGHYIDMGYKAIRAQTGVPGTRKALNYVPKLFEELRXXXXXXXRYTPQEAANLGKMLEPYQLFW
2qjmB           ETV-EAVGHYIDMGYKAIRAQTGVPGTRKALNYVPKLFEELRXXXXXXXRYTPQEAANLGKMLEPYQLFW
2olaA           GLSNKQLESLKATKPTRIKLKW-TPQIMHQIRVLRELDFHFQLVIDANES-LDRQDFTQLQLLAREQVLY
2oktA           GLSNKQLESLKATKPTRIKLKW-TPQIMHQIRVLRELDFHFQLVIDANES-LDRQDFTQLQLLAREQVLY
2qjjD           ETV-EAVGHYIDMGYKAIRAQTGVPGTRKALNYVPKLFEELRXXXXXXXRYTPQEAANLGKMLEPYQLFW
3dipB           RDAGVLAESLVAEGYAAMKIKDGLEPFRKIRAAVGQR---IEIMCELHSLWGTHAAARICNALADYGVLW
2hxuA           KLVRLAKEAVAD-GFRTIKLAVGADDIRRCRLARAAIGPDIAMAVDANQRWDVGPAIDWMRQLAEFDIAW
2o56G           EQYAQAALTAVSEGYDAIKVRLGYDRMAAIRDAV---GPDVDIIAEMHAFTDTTSAIQFGRMIEELGIFY
2o56H           EQYAQAALTAVSEGYDAIKVRLGYDRMAAIRDAV---GPDVDIIAEMHAFTDTTSAIQFGRMIEELGIFY
2o56A           EQYAQAALTAVSEGYDAIKVRLGYDRMAAIRDAV---GPDVDIIAEMHAFTDTTSAIQFGRMIEELGIFY
2opjA           ARI------VASSGCTTAKVKVA-ENDVARVEAVRDAGPRGRVRIDVNGAWDVDTAVR--IRLLDRELEY
1tzzA           SMLRGEMRGYLDRGYNVVKMKIGIEEDRMRIEAVEEIGKDAQLAVDANGRFNLETGIAYAKMLRDYPLFW
3gd6A           ESNLDVVRQKLEQGFDVFRLYVGKDADEEFLSRVKEEF-GSRVRIDFSHLLNWKDAHRAIKRLTKYDLEM
3fyyA           ESNLDVVRQKLEQGFDVFRLYVGKDADEEFLSRVKEEF-GSRVRIDFSHLLNWKDAHRAIKRLTKYDLEM
3es7A           ESNLDVVRQKLEQGFDVFRLYVGKDADEEFLSRVKEEF-GSRVRIDFSHLLNWKDAHRAIKRLTKYDLEM
2qjjA           ETV-EAVGHYIDMGYPGIKDAYGVGRGKLYYEPADASLPDTRKALNXXXRYTPQEAANLGKMLEPYQLFW
1bqgA           ESVVALAEAAYDRGFKDFKLKGGVLRGEDEIAAVTERFPDARITLDPNGAWSLKEAVALC-----RDLAY
2dw7A           SMLRGEMRGYLDRGYNVVKMKIGIEEDRMRIEAVEEIGKDAQLAVDANGRFNLETGIAYAKMLRDYPLFW
1yeyA           EKLVRLAKEAVADGFRTIKLKVGANDDIRRCRLARAAIGPDIAAVDANQRWDVGPAI---DWLAEFDIAW
2oo6A           ---------------------------RAHLEALRDGAPDVEILLDLNFNAKPEGYLKILRELADFDLFW
3go2A           ---------------------------RAHLEALRDGAPDVEILLDLNFNAKPEGYLKILRELADFDLFW
1rvkA           EDYGRFAETLVKRGYKGIKLHTWPPKDLKACAAVREAGPDIRL-IDAFHWYSRTDALALGRGLEKLGFDW
2dw6A           SMLRGEMRGYLDRGYNVVKMAIGIEEDRMRIEAVEEIGKDAQLAVDANGRFNLETGIAYAKMLRDYPLFW
1tzzB           SMLRGEMRGYLDRGYNVVKMKIGIEEDRMRIEAVEEIGKDAQLAVDANGRFNLETGIAYAKMLRDYPLFW
3gy1A           EDLYTEIDEIRKKGYQHIRCQLGFDQDESMFSSLREKGYKFHILHDVHERLFPNQAVQFAKDVEKYKPYF
3gy1B           EDLYTEIDEIRKKGYQHIRCQLGFDQDESMFSSLREKGYKFHILHDVHERLFPNQAVQFAKDVEKYKPYF
1jdfA           ------AEAAYEKGFNDFKLKGGVEEEAESIVALAQRFPQARITLDPNGAWSLNEAIKIGKYLKG-SLAY
1jctB           ------AEAAYEKGFNDFKLKGGVEEEAESIVALAQRFPQARITLDPNGAWSLNEAIKIGKYLKG-SLAY
1jctA           ------AEAAYEKGFNDFKLKGGVEEEAESIVALAQRFPQARITLDPNGAWSLNEAIKIGKYLKG-SLAY
1ec9D           ------AEAAYEKGFNDFKLKGGVEEEAESIVALAQRFPQARITLDPNGAWSLNEAIKIGKYLKG-SLAY
1ec9A           ------AEAAYEKGFNDFKLKGGVEEEAESIVALAQRFPQARITLDPNGAWSLNEAIKIGKYLKG-SLAY
1ec8A           ------AEAAYEKGFNDFKLKGGVEEEAESIVALAQRFPQARITLDPNGAWSLNEAIKIGKYLKG-SLAY
1ec7D           ------AEAAYEKGFNDFKLKGGVEEEAESIVALAQRFPQARITLDPNGAWSLNEAIKIGKYLKG-SLAY
1ec7C           ------AEAAYEKGFNDFKLKGGVEEEAESIVALAQRFPQARITLDPNGAWSLNEAIKIGKYLKG-SLAY
1ec7B           ------AEAAYEKGFNDFKLKGGVEEEAESIVALAQRFPQARITLDPNGAWSLNEAIKIGKYLKG-SLAY
1ec7A           ------AEAAYEKGFNDFKLKGGVEEEAESIVALAQRFPQARITLDPNGAWSLNEAIKIGKYLKG-SLAY
2ppgB           TRAKRAELAAAWQAKGFSSFKFASPVAKEEILRER-LGPAVRIACD-HWAHTASEAVALIK-AEPHGLWF


                         .         .         .         +         .         .         .:280
query           VEQPVPAEDPEGLRFVYERSALPVAADESCVTLSDIPAIADRCDIANLKLMKTGGLLEAKRMIAAARAHG
1jpmC           VEQPVHKDDLAGLKKVTDATDTPIMADESVFTPRQAFEVLQTADLINIKLMKAGGISGAEKINAMAEACG
1jpmA           VEQPVHKDDLAGLKKVTDATDTPIMADESVFTPRQAFEVLQTADLINIKLMKAGGISGAEKINAMAEACG
2p8bA           IEQPVIADDIDAMAHIRSKTDLPLMIDEGLKSSREMRQILEAADKVNIKLMKCGGIYPAVKLAHQAEMAG
1jpdX           LEQPLPAQDDAALNFIH---PLPICADESCHTRSNLKALKGRYEMVNIKLDKXXXXXXXXXXXXXXRAQG
3dfyL           YEQPVRREDIEGLKFVRFHSPFPVAADESARTKFDVMRLVEAVDYVNIKLMKS-GISDALAIVEIAESSG
3dfyN           YEQPVRREDIEGLKFVRFHSPFPVAADESARTKFDVMRLVEAVDYVNIKLMKS-GISDALAIVEIAESSG
3dfyH           YEQPVRREDIEGLKFVRFHSPFPVAADESARTKFDVMRLVEAVDYVNIKLMKS-GISDALAIVEIAESSG
3dfyF           YEQPVRREDIEGLKFVRFHSPFPVAADESARTKFDVMRLVEAVDYVNIKLMKS-GISDALAIVEIAESSG
3dfyE           YEQPVRREDIEGLKFVRFHSPFPVAADESARTKFDVMRLVEAVDYVNIKLMKS-GISDALAIVEIAESSG
3dfyB           YEQPVRREDIEGLKFVRFHSPFPVAADESARTKFDVMRLVEAVDYVNIKLMKS-GISDALAIVEIAESSG
2qdeA           IEQPLPAWDLDGMARLRGKVATPIYADESAQELHDLLAIINKADGLMIKTQKAGGLLKAQRWLTLARLAN
3dfyA           YEQPVRREDIEGLKFVRFHSPFPVAADESARTKFDVMRLVEAVDYVNIKLMKS-GISDALAIVEIAESSG
3derA           YEQPVRREDIEGLKFVRFHSPFPVAADESARTKFDVMRLVEAVDYVNIKLMKS-GISDALAIVEIAESSG
3ik4B           VEQPLPREDWAGMAQVTAQSGFAVAADESARSAHDVLRIAGTASVINIKLMK-AGVAEGLKMIAIAQAAG
3ik4A           VEQPLPREDWAGMAQVTAQSGFAVAADESARSAHDVLRIAGTASVINIKLMK-AGVAEGLKMIAIAQAAG
3ik4D           VEQPLPREDWAGMAQVTAQSGFAVAADESARSAHDVLRIAGTASVINIKLMK-AGVAEGLKMIAIAQAAG
3ik4C           VEQPLPREDWAGMAQVTAQSGFAVAADESARSAHDVLRIAGTASVINIKLMK-AGVAEGLKMIAIAQAAG
2bahA           IEQPLAWDDLVDHAELARRIRTPLCLDESVASASDAKALAGAGGVINLKVARVGGHAESRRVHDVAQSFG
2zadA           YEQPVRREDIEGLKFVRFHSPFPVAADESARTKFDVRLVKEEADYVNIKL--KSGISDALAIVEIAESSG
3dg6A           AEELCPADDVLSRRRLVGQLDMPFIADESVPTPADVEVLGGSATAISIKTART-GFTGSTRVHHLAEGLG
3eezA           EQ---PGETLDDIAAIRPLHSAPVSVDECLVTLQDAARVAGLAEVFGIKLNRVGGLTRAARMRDIALTHG
3dg3A           AEELCPADDVLSRRRLVGQLDMPFIADESVPTPADVEVLGGSATAISIKTART-GFTGSTRVHHLAEGLG
3mucA           IEQPISRINRGGQVRLNQRTPAPIMADESIESVEDAFSLAGAASIFALKIAKNGGPRAVLRTAQIAEAAG
2mucA           IEQPISRINRGGQVRLNQRTPAPIMADESIESVEDAFSLAGAASIFALKIAKNGGPRAVLRTAQIAEAAG
1mucA           IEQPISRINRGGQVRLNQRTPAPIMADESIESVEDAFSLAGAASIFALKIAKNGGPRAVLRTAQIAEAAG
3dgbA           IEQPISRNNRAGMVRLNASSPAPIMADESIECVEDAFNLAGAASVFALKIAKNGG---------------
1bkhC           IEQPISRINRGGQVRLNQRTPAPIMADESIESVEDAFSLAGAASIFALKIAKNGGPRAVLRTAQIAEAAG
1bkhB           IEQPISRINRGGQVRLNQRTPAPIMADESIESVEDAFSLAGAASIFALKIAKNGGPRAVLRTAQIAEAAG
1bkhA           IEQPISRINRGGQVRLNQRTPAPIMADESIESVEDAFSLAGAASIFALKIAKNGGPRAVLRTAQIAEAAG
1f9cA           IEQPISRINRGGQVRLNQRTPAPIMADESIESVEDAFSLAGAASIFALKIAKNGGPRAVLRTAQIAEAAG
1chrA           IEQPVGRENTQALRRLSDNNRVAIMADESLSTLASAFDLADRVDVFSLKLCNMGGVSATQKIAAVAEASG
1wufA           IEQPFGTKDFVDHAWLQKQLKTRICLDENIRSVKDVEQAIGSCRAINLKLARVGGMSSALKIAEYCALNE
1sjdB           IEQPLEEEDVLGHAELARRIQTPICLDESIVSAR---AAADAIQIVNIKPGRVGGYLEARRVHDVCAAHG
1sjdA           IEQPLEEEDVLGHAELARRIQTPICLDESIVSAR---AAADAIQIVNIKPGRVGGYLEARRVHDVCAAHG
3ct2A           IEQPISRNNRAGMVRLNASSPAPIMADESIECVEDAFNLAGAASVFALKIAKNGG---------------
1xpyC           IEQPLAWDDLVDHAELARRIRTPLCLDESVASASDAKALAGAGGVINLKVARVGGHAESRRVHDVAQSFG
1r0mA           IEQPLAWDDLVDHAELARRIRTPLCLDESVASASDAKALAGAGGVINLKVARVGGHAESRRVHDVAQSFG
2gggC           IEQPLAWDDLVDHAELARRIRTPLCLDESVASASDAKALAGAGGVINLKVARVGGHAESRRVHDVAQSFG
2gggA           IEQPLAWDDLVDHAELARRIRTPLCLDESVASASDAKALAGAGGVINLKVARVGGHAESRRVHDVAQSFG
2ggjA           IEQPLAWDDLVDHAELARRIRTPLCLDESVASASDAKALAGAGGVINLKVARVGGHAESRRVHDVAQSFG
3fcpE           IEQPVSAHDNAALVRLSQQIETAILADEAVATAYDGYQLAQQTGAYALKIAKAGGPNSVLALARVAQAAG
3fcpB           IEQPVSAHDNAALVRLSQQIETAILADEAVATAYDGYQLAQQTGAYALKIAKAGGPNSVLALARVAQAAG
3fcpA           IEQPVSAHDNAALVRLSQQIETAILADEAVATAYDGYQLAQQTGAYALKIAKAGGPNSVLALARVAQAAG
2ggiA           IEQPLAWDDLVDHAELARRIRTPLCLDESVASASDAKALAGAGGVINLKVARVGGHAESRRVHDVAQSFG
1wueB           IEQPFAADDFLDHAQLQRELKTRICLDENIRSLKDVALALGSCRSINLKIPRVGGIHEALKIAAFCQEND
1wueA           IEQPFAADDFLDHAQLQRELKTRICLDENIRSLKDVALALGSCRSINLKIPRVGGIHEALKIAAFCQEND
3fv9A           LEAPCASAETKSLR---ARCALPLLLDELIQTETDLIAAIDLCDGVGLKVSKQGGITPMLRQRAIAAAAG
2pmqB           VEQPCNSEDLEAIR--------------------------------------------------------
2pmqA           VEQPCNSEDLEAIR--------------------------------------------------------
2zc8A           IEQPLAYDDLLDHAKLQRELSTPICLDESLTARKAIELGAGR--VFNVKPARLGGHGESLRVHALAESAG
3fv9B           LEAPCASAETKSLR---ARCALPLLLDELIQTETDLIAAIDLCDGVGLKVSKQGGITPMLRQRAIAAAAG
1nu5A           VEQPVPRANFGALRRLTEQNGVXXXXXXXXXXXXXXXXXXHAVDAFSLKLCNMGGIANTLKVAAVAEAAG
2pceB           LEAPCASAETKSLR---ARCALPLLLDELIQTETDLIAAIDLCDGVGLKVSKQGGITPMLRQRAIAAAAG
2pceA           LEAPCASAETKSLR---ARCALPLLLDELIQTETDLIAAIDLCDGVGLKVSKQGGITPMLRQRAIAAAAG
3fv9H           LEAPCASAETKSLR---ARCALPLLLDELIQTETDLIAAIDLCDGVGLKVSKQGGITPMLRQRAIAAAAG
3fv9G           LEAPCASAETKSLR---ARCALPLLLDELIQTETDLIAAIDLCDGVGLKVSKQGGITPMLRQRAIAAAAG
2pgwC           IEQPIPA------AHVREKVGIPIVADQAAFTLYDV----------------------------------
2pgwB           IEQPIPA------AHVREKVGIPIVADQAAFTLYDV----------------------------------
2pgwA           IEQPIPA------AHVREKVGIPIVADQAAFTLYDV----------------------------------
2pceF           LEAPCASAETKSLR---ARCALPLLLDELIQTETDLIAAIDLCDGVGLKVSKQGGITPMLRQRAIAAAAG
3i6tC           IEQPVKAHLRGLMARIRDAVDVPLLADESIFGPEDMAEHPEIADGVSIKIMKSGGLTRAQTVARMAAARG
3i6tD           IEQPVKAHLRGLMARIRDAVDVPLLADESIFGPEDMAEHPEIADGVSIKIMKSGGLTRAQTVARMAAARG
3i6tB           IEQPVKAHLRGLMARIRDAVDVPLLADESIFGPEDMAEHPEIADGVSIKIMKSGGLTRAQTVARMAAARG
3i6tA           IEQPVKAHLRGLMARIRDAVDVPLLADESIFGPEDMAEHPEIADGVSIKIMKSGGLTRAQTVARMAAARG
3bjsB           LEEPFACNDFASYREVAKITPLPIAAGENHYTRFEFGQMLDAVQVWQPDLSKCGGITEGIRIAAMASAYR
3bjsA           LEEPFACNDFASYREVAKITPLPIAAGENHYTRFEFGQMLDAVQVWQPDLSKCGGITEGIRIAAMASAYR
2ovlD           IEEPTIPDDLVGNARIVRESGHTIAGGENLHTLYDFSLTLPEPDVSNITFRKVAALAEANNLLTSHGVHD
2ovlA           IEEPTIPDDLVGNARIVRESGHTIAGGENLHTLYDFSLTLPEPDVSNITFRKVAALAEANNLLTSHGVHD
2ggeD           LEEPLPFDQPQDYAMLRSRLSVPVAGGENMKGPAQVPLLSQRCDIIQPDVMHVNGIDEFRDCLQLARYFG
2ggeB           LEEPLPFDQPQDYAMLRSRLSVPVAGGENMKGPAQVPLLSQRCDIIQPDVMHVNGIDEFRDCLQLARYFG
2gdqA           LEEPLPFDQPQDYAMLRSRLSVPVAGGENMKGPAQVPLLSQRCDIIQPDVMHVNGIDEFRDCLQLARYFG
3i6eA           IEQPVRAHHFELMARLRGLTDVPLLADESVYGPEDMVRAAHECDGVSIKIMKSGGLTRAQTVARIAAAHG
2qddA           IEQPCQTLDQ--CAHVARRVANPIMLDECLHEFSDHLAAWSRCEGVKIKPNRVGGLTRARQI--------
3i4kA           FEQPTPADDLETLREITRRTNVSV-ADESVWTXXXXXXXXXXXXXIALKTTKHGGLLESKKIAAIAEAGG
2qddB           IEQPCQTLDQ--CAHVARRVANPIMLDECLHEFSDHLAAWSRCEGVKIKPNRVGGLTRARQI--------
3fvdA           IEQPCQTLDQ--CAHVARRVANPIMLDECLHEFSDHLAAWSRCEGVKIKPNRVGGLTRARQI--------
3fvdB           IEQPCQTLDQ--CAHVARRVANPIMLDECLHEFSDHLAAWSRCEGVKIKPNRVGGLTRARQI--------
2pp1C           IEEPLDAYDIEGHAQLAAALDTPIATGEMLTSFREHEILGNASDFVQPDAPRVGGISPFLKIMDLAAKHG
2pp0A           IEEPLDAYDIEGHAQLAAALDTPIATGEMLTSFREHEILGNASDFVQPDAPRVGGISPFLKIMDLAAKHG
2pgeA           IEQPIRQHQWSEMAALCANSPLAIALDEELIGLEQRSAMLDRPQYIILKPSLLGGFHYAGQWIELARERG
2pp3A           IEEPLDAYDIEGHAQLAAALDTPIATGEMLTSFREHEILGNASDFVQPDAPRVGGISPFLKIMDLAAKHG
2oz8A           VEDPILRHDHDGLR--------------------------------------------------------
2rdxG           IEQPCRSEECQQVRRVADQ---PMKLDE-CVTGLHMAIVADRAEICCLKISNLGGLSKARR---------
2rdxA           IEQPCRSEECQQVRRVADQ---PMKLDE-CVTGLHMAIVADRAEICCLKISNLGGLSKARR---------
2pozB           VEEPCDPFDNGALKVISEQIPLPIAVGERVYTRFGFRKIFEACGIIQPDIGTAGG-LETKKICAA-----
2rdxE           IEQPCRSEECQQVRRVADQ---PMKLDE-CVTGLHMAIVADRAEICCLKISNLGGLSKARR---------
2pozC           VEEPCDPFDNGALKVISEQIPLPIAVGERVYTRFGFRKIFEACGIIQPDIGTAGG-LETKKICAA-----
3cyjA           LEEPVSSXXXXXXXXXXXXXXVAIAAGEYEWTLPQLHDLAGCVDILQADVTRCGGITGLLRVDGICRGHQ
3gc2A           LEEPCKTRDDS--RAFARETGIAIAWDESLREADFTFEAEEGVRAVVIKPTLTGSLDKVREQVAAAHALG
1fhvA           LEEPCKTRDDS--RAFARETGIAIAWDES-LREPDFAFVAEEVRAVVIKPTLTGSLEKVREQVQAAHALG
2pozH           VEEPCDPFDNGALKVISEQIPLPIAVGERVYTRFGFRKIFEACGIIQPDIGTAGG-LETKKICAA-----
1r6wA           LEEPCKTRDDS--RAFARETGIAIAWDES-LREPDFAFVAEEVRAVVIKPTLTGSLEKVREQVQAAHALG
2pozA           VEEPCDPFDNGALKVISEQIPLPIAVGERVYTRFGFRKIFEACGIIQPDIGTAGG-LETKKICAA-----
2oqhC           XXXXXPCVGIEGAQ-VKAKVRIPLCT--NCVVRFEAPARLNAVDVIHGDVYKWGGIAATKALAAHCETFG
2oqhB           XXXXXPCVGIEGAQ-VKAKVRIPLCT--NCVVRFEAPARLNAVDVIHGDVYKWGGIAATKALAAHCETFG
1fhuA           LEEPCKTRDDS--RAFARETGIAIAWDES-LREPDFAFVAEEVRAVVIKPTLTGSLEKVREQVQAAHALG
2ofjA           LAEPCKTRDDS--RAFARETGIAIAWDES-LREPDFAFVAEEVRAVVIKPTLTGSLEKVREQVQAAHALG
1mraA           IEEPTLQHDYEGHQRIQSKLNVPVQMGENWLGPEEMALSIGACRLAMPNAMKIGGVTGWIRASALAQQFG
3cb3D           IEEPLDAYDHEGHAALALQFDTPIATGEMLTSAAE-----------------------------------
3cb3C           IEEPLDAYDHEGHAALALQFDTPIATGEMLTSAAE-----------------------------------
3cb3B           IEEPLDAYDHEGHAALALQFDTPIATGEMLTSAAE-----------------------------------
3cb3A           IEEPLDAYDHEGHAALALQFDTPIATGEMLTSAAE-----------------------------------
2mnrA           IEEPTLQHDYEGHQRIQSKLNVPVQMGENWLGPEEMALSIGACRLAMPDAMKIGGVTGWIRASALAQQFG
1dtnA           IEEPTLQHDYEGHQRIQSKLNVPVQMGENWLGPEEMALSIGACRLAMPDAMKIGGVTGWIRASALAQQFG
1mdlA           IEEPTLQHDYEGHQRIQSKLNVPVQMGENWLGPEEMALSIGACRLAMPDAMKIGGVTGWIRASALAQQFG
2ofjD           LAEPCKTRDDS--RAFARETGIAIAWDES-LREPDFAFVAEEVRAVVIKPTLTGSLEKVREQVQAAHALG
2ofjC           LAEPCKTRDDS--RAFARETGIAIAWDES-LREPDFAFVAEEVRAVVIKPTLTGSLEKVREQVQAAHALG
2qvhA           VEQPCATVDE--LAEVRRRVSVPIAADESIRRAEDXXXXXXXXXXXXLKVQPLGGVRAALRL---AEECG
2oqhA           XXXXXPCVGIEGAQ-VKAKVRIPLCT--NCVVRFEAPARLNAVDVIHGDVYKWGGIAATKALAAHCETFG
3ddmA           LEEPLRADRP------------------------------------------------------------
3dipA           VEDPIAKMDNPAVADLRRQTRAPICGGENLAGTRRFHEMADAIDFVMLDLTWCGGLSEGRKIAALAETH-
2oqhD           XXXXXPCVGIEGAQ-VKAKVRIPLCT--NCVVRFEAPARLNAVDVIHGDVYKWGGIAATKALAAHCETFG
2og9A           IEEPLDAYDHEGHAALALQFDTPIATGE------------------------------------------
2oztA           VEQPLPPDQWQALLSLAQTVTTAIALDESVVSAAEVQRWVDR----------------------------
2nqlA           AEAPVWTEDIAGLEKVSKNTDVPIAVGEEWRTHWDMRARIERCRIAIVQEMGHKGITNFIRIGALAAEHG
3h7vA           VEQPLPPDQWQALLSLAQTVTTAIALDESVVSAAEVQRWVDR----------------------------
3bsmA           LEDCVPAENQESLRLIREHTTTPLAIGEVFNSIHDCRELIQNQWIDYIRMPLTGGGITAMRRVA------
2gl5A           YEEPIHPLNSDNMQKVSRSTTIPIATGERSYTRWGYRELLEKQSIAVAQLCLCGGITEGKKICDYANIYD
3dfhA           IEDILPPNQTEWLDNIRSQSSVSLGLGELFNNPEEWKSLIRRIDFIRCHVSQIGGITPALKLGHLCQNFG
3h12A           FEEPLSIDDIEGHRILAQGTPVRIATGENLYTRNAFNDYIDAIDVLQADASRAGGITE------------
2qjmA           LEDCTPAENQEAFRLVRQHTVTPLAVGEIFNTIWDAEDLIQNIDYIRATVVGAGGLTHLRRIADLASLY-
2qjjC           LEDCTPAENQEAFRLVRQHTVTPLAVGEIFNTIWDAKDLIQNIDYIRATVVGAGGLTHLRRIADLASLY-
2hxtA           IEEPTSPDDVLGHAAIRQGTPVPVSTGEHTQNRVVFKQLAGAVDLIQIDAARVGGVNENLAILLLAAKFG
2hneD           IEEPTSPDDVLGHAAIRQGTPVPVSTGEHTQNRVVFKQLAGAVDLIQIDAARVGGVNENLAILLLAAKFG
2hneC           IEEPTSPDDVLGHAAIRQGTPVPVSTGEHTQNRVVFKQLAGAVDLIQIDAARVGGVNENLAILLLAAKFG
2hneB           IEEPTSPDDVLGHAAIRQGTPVPVSTGEHTQNRVVFKQLAGAVDLIQIDAARVGGVNENLAILLLAAKFG
2hneA           IEEPTSPDDVLGHAAIRQGTPVPVSTGEHTQNRVVFKQLAGAVDLIQIDAARVGGVNENLAILLLAAKFG
2qjnA           LEDCTPAENQEAFRLVRQHTVTPLAVGEIFNTIWDAKDLIQNIDYIRATVVGAGGLTHLRRIADLASLY-
2qjmB           LEDCTPAENQEAFRLVRQHTVTPLAVGEIFNTIWDAEDLIQNIDYIRATVVGAGGLTHLRRIADLASLY-
2olaA           IEEPF--KDISMLDEVADGTIPPIALDEKATSLLDIINLIENVKVVVLKPFRLGGIDKVQTAIDTLKSHG
2oktA           IEEPF--KDISMLDEVADGTIPPIALDEKATSLLDIINLIENVKVVVLKPFRLGGIDKVQTAIDTLKSHG
2qjjD           LEDCTPAENQEAFRLVRQHTVTPLAVGEIFNTIWDAKDLIQNIDYIRATVVGAGGLTHLRRIADLASLY-
3dipB           VEDPIAKMDNPAVADLRRQTRAPICGGENLAGTRRFHEMADAIDFVMLDLTWCGGLSEGRKIAALAETH-
2hxuA           IEEPTSPDDVLGHAAIRQGTPVPVSTGEHTQNRVVFKQLAGAVDLIQIDAARVGGVNENLAILLLAAKFG
2o56G           YEEPVMPLNPAQMKQVADKVNIPLAAGERIYWRWGYRPFLENGSLSVIQICTCGGITEVKKICDMAHVYD
2o56H           YEEPVMPLNPAQMKQVADKVNIPLAAGERIYWRWGYRPFLENGSLSVIQICTCGGITEVKKICDMAHVYD
2o56A           YEEPVMPLNPAQMKQVADKVNIPLAAGERIYWRWGYRPFLENGSLSVIQICTCGGITEVKKICDMAHVYD
2opjA           VEQPCATVDE--LAEVRRRVSVPI----------------------------------------------
1tzzA           YEEVGDPLDYALQAALAEFYPGPMATGENLFSHQDARNLPDR-DWLQFDCALSYGLCEYQRTLEVLKTHG
3gd6A           IESPAPRNDFDGLYQLRLKTDYPISEHVWSFKQQQEMIKKDAIDIFNISPVFIGGL--------------
3fyyA           IESPAPRNDFDGLYQLRLKTDYPISEHVWSFKQQQEMIKKDAIDIFNISPVFIGGL--------------
3es7A           IESPAPRNDFDGLYQLRLKTDYPISEHVWSFKQQQEMIKKDAIDIFNISPVFIGGL--------------
2qjjA           LEDCTPAENQEAFRLVRQHTVTPLAVGEIFNTIWDAKDLIQNIDYIRATVVGAGGLTHLRRIADLASLY-
1bqgA           AEDPCGAEN-------------------------------------------------------------
2dw7A           YEEVGDPLDYALQAALAEFYPGPMATGENLFSHQDARNLPDR-DWLQFDCALSYGLCEYQRTLEVLKTHG
1yeyA           IEEPTSPDDVLGHAAIRQGTPVPVSTGEHTQNRVVFKQLAGAVDLIQIDAARVGGVNENLAILLLAAKFG
2oo6A           VE--IDSYSPQGLAYVRNHSPHPISSCETLFGIREFKPFFD-ANAVDVAIVDTNGVWQSMKIAAFADAHD
3go2A           VE--IDSYSPQGLAYVRNHSPHPISSCETLFGIREFKPFFD-ANAVDVAIVDTNGVWQSMKIAAFADAHD
1rvkA           IEEP-DEQSLSSYKWLSDNLDIPVVGPESAAGKHWHRAKAGACDILRTGVNDVGGI------TPALKTHL
2dw6A           YEEVGDPLDYALQAALAEFYPGPMATGENLFSHQDARNLPDR-DWLQFDCALSYGLCEYQRTLEVLKTHG
1tzzB           YEEVGDPLDYALQAALAEFYPGPMATGENLFSHQDARNLPDR-DWLQFDCALSYGLCEYQRTLEVLKTHG
3gy1A           IEDILPPDQNEWLGQIRSQTSTPLATGELFNNPMEWKSIANRVDFIRCHVSQIGGITPALKLGSLCAAFG
3gy1B           IEDILPPDQNEWLGQIRSQTSTPLATGELFNNPMEWKSIANRVDFIRCHVSQIGGITPALKLGSLCAAFG
1jdfA           AEDPCGAE--------------------------------------------------------------
1jctB           AEDPCGAE--------------------------------------------------------------
1jctA           AEDPCGAE--------------------------------------------------------------
1ec9D           AEDPCGAE--------------------------------------------------------------
1ec9A           AEDPCGAE--------------------------------------------------------------
1ec8A           AEDPCGAE--------------------------------------------------------------
1ec7D           AEDPCGAE--------------------------------------------------------------
1ec7C           AEDPCGAE--------------------------------------------------------------
1ec7B           AEDPCGAE--------------------------------------------------------------
1ec7A           AEDPCGAE--------------------------------------------------------------
2ppgB           AEAPVRTEDIDGLARVAASVSTAIAVGEEWRTVHDVPRVARR----------------------------


                         .         *         .         .         .         .         +:350
query           LEVMCGCMIESNXXXXXXXXXXXXXXXXXXXGSLLLAEDQYDGIEMGGGEIRLxxxxxxxxxxxxxxxx
1jpmC           VECMVGSMIET----------------------------------------------------------
1jpmA           VECMVGSMIET----------------------------------------------------------
2p8bA           IECQVGSMVESS---------------------------------------------------------
1jpdX           FSLMLGCMLCTSRAISAALPLVPQVSFADLDGPTWLAVDVEPALQFTTGELHL----------------
3dfyL           LKLMIGCMGESS---------------------------------------------------------
3dfyN           LKLMIGCMGESS---------------------------------------------------------
3dfyH           LKLMIGCMGESS---------------------------------------------------------
3dfyF           LKLMIGCMGESS---------------------------------------------------------
3dfyE           LKLMIGCMGESS---------------------------------------------------------
3dfyB           LKLMIGCMGESS---------------------------------------------------------
2qdeA           LPVICGCMVGS----------------------------------------------------------
3dfyA           LKLMIGCMGESS---------------------------------------------------------
3derA           LKLMIGCMGESS---------------------------------------------------------
3ik4B           LGLMIGGMVES----------------------------------------------------------
3ik4A           LGLMIGGMVES----------------------------------------------------------
3ik4D           LGLMIGGMVES----------------------------------------------------------
3ik4C           LGLMIGGMVES----------------------------------------------------------
2bahA           APVWCGGMLES----------------------------------------------------------
2zadA           LKLICG---------------------------------------------------------------
3dg6A           LDMVMGNQID-----------------------------------------------------------
3eezA           IDM------------------------------------------------------------------
3dg3A           LDMVMGNQID-----------------------------------------------------------
3mucA           IGLYGGTMLEGS---------------------------------------------------------
2mucA           IGLYGGTMLEGS---------------------------------------------------------
1mucA           IGLYGGTMLEGS---------------------------------------------------------
3dgbA           ---------------------------------------------------------------------
1bkhC           IGLYGGTMLEGS---------------------------------------------------------
1bkhB           IGLYGGTMLEGS---------------------------------------------------------
1bkhA           IGLYGGTMLEGS---------------------------------------------------------
1f9cA           IGLYGGTMLEGS---------------------------------------------------------
1chrA           IASYGGTMLDS----------------------------------------------------------
1wufA           ILVWCGGMLEA----------------------------------------------------------
1sjdB           IPVWCGGMIET----------------------------------------------------------
1sjdA           IPVWCGGMIET----------------------------------------------------------
3ct2A           ---------------------------------------------------------------------
1xpyC           APVWCGGMLES----------------------------------------------------------
1r0mA           APVWCGGMLES----------------------------------------------------------
2gggC           APVWCGGMLES----------------------------------------------------------
2gggA           APVWCGGMLES----------------------------------------------------------
2ggjA           APVWCGGMLES----------------------------------------------------------
3fcpE           IGLYGGTMLE-----------------------------------------------------------
3fcpB           IGLYGGTMLE-----------------------------------------------------------
3fcpA           IGLYGGTMLE-----------------------------------------------------------
2ggiA           APVWCGGMLES----------------------------------------------------------
1wueB           LLVWLGGMFES----------------------------------------------------------
1wueA           LLVWLGGMFES----------------------------------------------------------
3fv9A           M--------------------------------------------------------------------
2pmqB           ---------------------------------------------------------------------
2pmqA           ---------------------------------------------------------------------
2zc8A           IPLWMGGMLEA----------------------------------------------------------
3fv9B           M--------------------------------------------------------------------
1nu5A           ISSYGGTMLDS----------------------------------------------------------
2pceB           M--------------------------------------------------------------------
2pceA           M--------------------------------------------------------------------
3fv9H           M--------------------------------------------------------------------
3fv9G           M--------------------------------------------------------------------
2pgwC           ---------------------------------------------------------------------
2pgwB           ---------------------------------------------------------------------
2pgwA           ---------------------------------------------------------------------
2pceF           M--------------------------------------------------------------------
3i6tC           LSAYGGDMFEA----------------------------------------------------------
3i6tD           LSAYGGDMFEA----------------------------------------------------------
3i6tB           LSAYGGDMFEA----------------------------------------------------------
3i6tA           LSAYGGDMFEA----------------------------------------------------------
3bjsB           IPI------------------------------------------------------------------
3bjsA           IPI------------------------------------------------------------------
2ovlD           LTV------------------------------------------------------------------
2ovlA           LTV------------------------------------------------------------------
2ggeD           V--------------------------------------------------------------------
2ggeB           V--------------------------------------------------------------------
2gdqA           V--------------------------------------------------------------------
3i6eA           LMAYGGDMFEA----------------------------------------------------------
2qddA           ---------------------------------------------------------------------
3i4kA           L--------------------------------------------------------------------
2qddB           ---------------------------------------------------------------------
3fvdA           ---------------------------------------------------------------------
3fvdB           ---------------------------------------------------------------------
2pp1C           ---------------------------------------------------------------------
2pp0A           ---------------------------------------------------------------------
2pgeA           IGFWITSALESN---------------------------------------------------------
2pp3A           ---------------------------------------------------------------------
2oz8A           ---------------------------------------------------------------------
2rdxG           ---------------------------------------------------------------------
2rdxA           ---------------------------------------------------------------------
2pozB           ---------------------------------------------------------------------
2rdxE           ---------------------------------------------------------------------
2pozC           ---------------------------------------------------------------------
3cyjA           IPFSAHC--------------------------------------------------------------
3gc2A           LTAVISSSIESS---------------------------------------------------------
1fhvA           LTAVISSSIESS---------------------------------------------------------
2pozH           ---------------------------------------------------------------------
1r6wA           LTAVISSSIESS---------------------------------------------------------
2pozA           ---------------------------------------------------------------------
2oqhC           L--------------------------------------------------------------------
2oqhB           L--------------------------------------------------------------------
1fhuA           LTAVISSSIESS---------------------------------------------------------
2ofjA           LTAVISSSIESS---------------------------------------------------------
1mraA           I--------------------------------------------------------------------
3cb3D           ---------------------------------------------------------------------
3cb3C           ---------------------------------------------------------------------
3cb3B           ---------------------------------------------------------------------
3cb3A           ---------------------------------------------------------------------
2mnrA           I--------------------------------------------------------------------
1dtnA           I--------------------------------------------------------------------
1mdlA           I--------------------------------------------------------------------
2ofjD           LTAVISSSIESS---------------------------------------------------------
2ofjC           LTAVISSSIESS---------------------------------------------------------
2qvhA           LPVVVSSAVETS---------------------------------------------------------
2oqhA           L--------------------------------------------------------------------
3ddmA           ---------------------------------------------------------------------
3dipA           ---------------------------------------------------------------------
2oqhD           L--------------------------------------------------------------------
2og9A           ---------------------------------------------------------------------
2oztA           ---------------------------------------------------------------------
2nqlA           IDVI-----------------------------------------------------------------
3h7vA           ---------------------------------------------------------------------
3bsmA           ---------------------------------------------------------------------
2gl5A           TTVVCG---------------------------------------------------------------
3dfhA           VRIAWHC--------------------------------------------------------------
3h12A           ---------------------------------------------------------------------
2qjmA           -QVRTGC--------------------------------------------------------------
2qjjC           -QVRTGC--------------------------------------------------------------
2hxtA           VRV------------------------------------------------------------------
2hneD           VRV------------------------------------------------------------------
2hneC           VRV------------------------------------------------------------------
2hneB           VRV------------------------------------------------------------------
2hneA           VRV------------------------------------------------------------------
2qjnA           -QVRTGC--------------------------------------------------------------
2qjmB           -QVRTGC--------------------------------------------------------------
2olaA           AKVVIGGMYE-----------------------------------------------------------
2oktA           AKVVIGGMYE-----------------------------------------------------------
2qjjD           -QVRTGC--------------------------------------------------------------
3dipB           ---------------------------------------------------------------------
2hxuA           VRV------------------------------------------------------------------
2o56G           KTVVCG---------------------------------------------------------------
2o56H           KTVVCG---------------------------------------------------------------
2o56A           KTVVCG---------------------------------------------------------------
2opjA           ---------------------------------------------------------------------
1tzzA           ---------------------------------------------------------------------
3gd6A           ---------------------------------------------------------------------
3fyyA           ---------------------------------------------------------------------
3es7A           ---------------------------------------------------------------------
2qjjA           -QVRTGC--------------------------------------------------------------
1bqgA           ---------------------------------------------------------------------
2dw7A           ---------------------------------------------------------------------
1yeyA           VRV------------------------------------------------------------------
2oo6A           INV------------------------------------------------------------------
3go2A           INV------------------------------------------------------------------
1rvkA           AEAFGECEVHGN---------------------------------------------------------
2dw6A           ---------------------------------------------------------------------
1tzzB           ---------------------------------------------------------------------
3gy1A           VRI------------------------------------------------------------------
3gy1B           VRI------------------------------------------------------------------
1jdfA           ---------------------------------------------------------------------
1jctB           ---------------------------------------------------------------------
1jctA           ---------------------------------------------------------------------
1ec9D           ---------------------------------------------------------------------
1ec9A           ---------------------------------------------------------------------
1ec8A           ---------------------------------------------------------------------
1ec7D           ---------------------------------------------------------------------
1ec7C           ---------------------------------------------------------------------
1ec7B           ---------------------------------------------------------------------
1ec7A           ---------------------------------------------------------------------
2ppgB           ---------------------------------------------------------------------