[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for hlac0:ACM56309.1

[Show Plain Result]


## Summary of Sequence Search
    1::357
   28::310     6e-63  43%  353 aa  NUOH_DEHSC RecName: Full=NADH-quinone oxidoreductase subunit H;    
   28::310     8e-62  44%  353 aa  NUOH_DEHE1 RecName: Full=NADH-quinone oxidoreductase subunit H;    
   21::346     2e-60  39%  450 aa  NUOH_RHOSR RecName: Full=NADH-quinone oxidoreductase subunit H;    
   51::335     3e-60  42%  348 aa  NUOH_MOOTA RecName: Full=NADH-quinone oxidoreductase subunit H;    
   28::341     1e-57  41%  411 aa  NUOH_MYCVP RecName: Full=NADH-quinone oxidoreductase subunit H;    
   39::340     2e-57  41%  416 aa  NUOH_MYCSS RecName: Full=NADH-quinone oxidoreductase subunit H;    
   39::340     2e-57  41%  416 aa  NUOH_MYCSK RecName: Full=NADH-quinone oxidoreductase subunit H;    
   39::340     2e-57  41%  416 aa  NUOH_MYCSJ RecName: Full=NADH-quinone oxidoreductase subunit H;    
   52::360     2e-57  41%  372 aa  NU1C_PLEBO RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1; 
   39::340     2e-57  41%  410 aa  NUOH_MYCGI RecName: Full=NADH-quinone oxidoreductase subunit H;    
   40::329     4e-57  41%  336 aa  NUOH_BREBN RecName: Full=NADH-quinone oxidoreductase subunit H;    
   36::338     6e-57  40%  597 aa  NUOHI_NOCFA RecName: Full=NADH-quinone oxidoreductase subunits H/I;
   27::337     1e-56  43%  337 aa  NUOH2_GEOMG RecName: Full=NADH-quinone oxidoreductase subunit H 2; 
   50::346     1e-56  42%  372 aa  NU1C_CYAP4 RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1; 
   17::341     1e-56  37%  408 aa  NUOH_MYCS2 RecName: Full=NADH-quinone oxidoreductase subunit H;    
   55::338     1e-56  40%  350 aa  NUOH_CARHZ RecName: Full=NADH-quinone oxidoreductase subunit H;    
   50::362     2e-56  41%  372 aa  NU1C_SYNP6 RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1; 
   50::362     2e-56  41%  372 aa  NU1C_SYNE7 RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1; 
   50::346     2e-56  42%  372 aa  NU1C_ACAM1 RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1; 
   51::363     7e-56  42%  373 aa  NU1C_SYNJB RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1; 
   52::360     7e-56  42%  372 aa  NU1C_PROMS RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1; 
   52::360     7e-56  42%  372 aa  NU1C_PROMP RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1; 
   51::363     9e-56  42%  373 aa  NU1C_SYNJA RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1; 
   52::360     9e-56  42%  372 aa  NU1C_PROM9 RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1; 
   52::360     9e-56  42%  372 aa  NU1C_PROM2 RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1; 
   52::360     9e-56  42%  372 aa  NU1C_PROM0 RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1; 
   36::346     1e-55  40%  348 aa  NUOH1_GEOSL RecName: Full=NADH-quinone oxidoreductase subunit H 1; 
   18::362     1e-55  40%  372 aa  NU1C_SYNY3 RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1; 
   11::346     1e-55  41%  372 aa  NU1C_NOSP7 RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1; 
   36::328     3e-55  42%  333 aa  NUOH_BACCR RecName: Full=NADH-quinone oxidoreductase subunit H;    
   36::328     3e-55  42%  333 aa  NUOH_BACC4 RecName: Full=NADH-quinone oxidoreductase subunit H;    
   36::328     3e-55  42%  333 aa  NUOH_BACC2 RecName: Full=NADH-quinone oxidoreductase subunit H;    
   36::328     3e-55  42%  333 aa  NUOH_BACCZ RecName: Full=NADH-quinone oxidoreductase subunit H;    
   36::328     3e-55  42%  333 aa  NUOH_BACCQ RecName: Full=NADH-quinone oxidoreductase subunit H;    
   36::328     3e-55  42%  333 aa  NUOH_BACC7 RecName: Full=NADH-quinone oxidoreductase subunit H;    
   36::328     3e-55  42%  333 aa  NUOH_BACC3 RecName: Full=NADH-quinone oxidoreductase subunit H;    
   36::328     3e-55  42%  333 aa  NUOH_BACC1 RecName: Full=NADH-quinone oxidoreductase subunit H;    
   36::328     3e-55  42%  333 aa  NUOH_BACC0 RecName: Full=NADH-quinone oxidoreductase subunit H;    
   36::328     3e-55  42%  333 aa  NUOH_BACAN RecName: Full=NADH-quinone oxidoreductase subunit H;    
   36::328     3e-55  42%  333 aa  NUOH_BACAH RecName: Full=NADH-quinone oxidoreductase subunit H;    
   36::328     3e-55  42%  333 aa  NUOH_BACAC RecName: Full=NADH-quinone oxidoreductase subunit H;    
   36::328     3e-55  42%  333 aa  NUOH_BACAA RecName: Full=NADH-quinone oxidoreductase subunit H;    
   34::353     3e-55  41%  360 aa  NU1C_CHLAT RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1,
   36::328     4e-55  42%  333 aa  NUOH_BACHK RecName: Full=NADH-quinone oxidoreductase subunit H;    
   36::328     6e-55  42%  333 aa  NUOH_BACWK RecName: Full=NADH-quinone oxidoreductase subunit H;    
   32::323     7e-55  41%  330 aa  NUOH_PELCD RecName: Full=NADH-quinone oxidoreductase subunit H;    
   39::331     7e-55  42%  341 aa  NUOH_MAGSA RecName: Full=NADH-quinone oxidoreductase subunit H;    
   36::328     1e-54  40%  333 aa  NUOH_ANOFW RecName: Full=NADH-quinone oxidoreductase subunit H;    
   52::356     2e-54  40%  362 aa  NU1C_NEPOL RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1,
   19::346     2e-54  40%  372 aa  NU1C_MICAN RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1; 
   50::346     2e-54  42%  372 aa  NU1C_ANASP RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1; 
   16::326     8e-54  39%  329 aa  NUOH2_GEOSL RecName: Full=NADH-quinone oxidoreductase subunit H 2; 
   36::328     2e-53  40%  333 aa  NUOH_BACCN RecName: Full=NADH-quinone oxidoreductase subunit H;    
   28::332     3e-53  35%  333 aa  NUOH_DESPS RecName: Full=NADH-quinone oxidoreductase subunit H;    
   52::352     3e-53  42%  372 aa  NU1C_PROM5 RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1; 
    1::320     4e-53  37%  325 aa  NUOH_PARUW RecName: Full=NADH-quinone oxidoreductase subunit H;    
   15::352     4e-53  36%  358 aa  NUOH_BACV8 RecName: Full=NADH-quinone oxidoreductase subunit H;    
   36::328     5e-53  41%  333 aa  NUOH_GEOKA RecName: Full=NADH-quinone oxidoreductase subunit H;    
   18::309     5e-53  38%  329 aa  NUOH1_SYNFM RecName: Full=NADH-quinone oxidoreductase subunit H 1; 
   51::354     1e-52  38%  451 aa  NUOH_ACIC1 RecName: Full=NADH-quinone oxidoreductase subunit H;    
   50::345     1e-52  40%  372 aa  NU1C_SYNP2 RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1; 
   35::326     2e-52  40%  337 aa  NUOH_RHORT RecName: Full=NADH-quinone oxidoreductase subunit H;    
   27::317     3e-52  39%  317 aa  NUOH1_NITMU RecName: Full=NADH-quinone oxidoreductase subunit H 1; 
   50::366     4e-52  40%  376 aa  NU1C_CHAVU RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1,
   12::341     8e-52  37%  341 aa  NQO8_RHOMR RecName: Full=NADH-quinone oxidoreductase subunit 8;    
   34::325     1e-51  38%  335 aa  NUOH_PSEPW RecName: Full=NADH-quinone oxidoreductase subunit H;    
   34::325     1e-51  38%  335 aa  NUOH_PSEPG RecName: Full=NADH-quinone oxidoreductase subunit H;    
   13::319     2e-51  40%  339 aa  NUOH_RICCN RecName: Full=NADH-quinone oxidoreductase subunit H;    
   36::320     2e-51  41%  328 aa  NUOH_CHRSD RecName: Full=NADH-quinone oxidoreductase subunit H;    
   50::346     2e-51  41%  372 aa  NU1C_CYAA5 RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1; 
   34::325     4e-51  38%  335 aa  NUOH_PSEPK RecName: Full=NADH-quinone oxidoreductase subunit H;    
   34::325     4e-51  38%  335 aa  NUOH_PSEP1 RecName: Full=NADH-quinone oxidoreductase subunit H;    
   38::328     4e-51  39%  333 aa  NUOH_ACIAD RecName: Full=NADH-quinone oxidoreductase subunit H;    
   33::366     5e-51  40%  372 aa  NUOH_CHLCH RecName: Full=NADH-quinone oxidoreductase subunit H;    
    7::326     5e-51  38%  329 aa  NUOH1_GEOMG RecName: Full=NADH-quinone oxidoreductase subunit H 1; 
   50::360     5e-51  40%  366 aa  NU1C_ANTFO RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1,
   16::340     6e-51  35%  343 aa  NUOH_MAGSM RecName: Full=NADH-quinone oxidoreductase subunit H;    
   15::333     6e-51  38%  336 aa  NUOH_AQUAE RecName: Full=NADH-quinone oxidoreductase subunit H;    
   27::313     6e-51  39%  319 aa  NUOH1_NITOC RecName: Full=NADH-quinone oxidoreductase subunit H 1; 
   34::325     8e-51  39%  335 aa  NUOH_PSEE4 RecName: Full=NADH-quinone oxidoreductase subunit H;    
   32::366     1e-50  39%  372 aa  NUOH_CHLPD RecName: Full=NADH-quinone oxidoreductase subunit H;    
   50::346     1e-50  39%  361 aa  NU1C_JASNU RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1,
   51::361     1e-50  40%  369 aa  NU1C_ANGEV RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1,
   43::333     2e-50  37%  338 aa  NUOH_ACIBT RecName: Full=NADH-quinone oxidoreductase subunit H;    
   46::348     2e-50  41%  407 aa  NU1C_GLOVI RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1; 
   50::340     2e-50  37%  347 aa  NUOH_PSYCK RecName: Full=NADH-quinone oxidoreductase subunit H;    
   18::354     2e-50  39%  362 aa  NU1C_MAIZE RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1,
   50::340     3e-50  37%  347 aa  NUOH_PSYA2 RecName: Full=NADH-quinone oxidoreductase subunit H;    
   14::322     3e-50  36%  342 aa  NUOH1_CYTH3 RecName: Full=NADH-quinone oxidoreductase subunit H 1; 
   50::346     3e-50  39%  372 aa  NU1C_CYAP7 RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1; 
   34::325     4e-50  37%  335 aa  NUOH_PSESM RecName: Full=NADH-quinone oxidoreductase subunit H;    
   34::325     4e-50  36%  335 aa  NUOH_PSEF5 RecName: Full=NADH-quinone oxidoreductase subunit H;    
   36::325     5e-50  37%  335 aa  NUOH_PSEU2 RecName: Full=NADH-quinone oxidoreductase subunit H;    
   36::325     5e-50  37%  335 aa  NUOH_PSE14 RecName: Full=NADH-quinone oxidoreductase subunit H;    
   50::346     5e-50  40%  372 aa  NU1C_CYAP8 RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1; 
   49::351     5e-50  40%  363 aa  NU1C_CUCSA RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1,
   11::344     7e-50  34%  354 aa  NUOH_RALEH RecName: Full=NADH-quinone oxidoreductase subunit H;    
   50::365     7e-50  38%  372 aa  NU1C_STAPU RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1,
    8::328     9e-50  38%  336 aa  NUOH_RHOCS RecName: Full=NADH-quinone oxidoreductase subunit H;    
   44::340     9e-50  37%  347 aa  NUOH_ORITI RecName: Full=NADH-quinone oxidoreductase subunit H;    
    9::320     9e-50  38%  345 aa  NUOH_DINSH RecName: Full=NADH-quinone oxidoreductase subunit H;    
   57::320     9e-50  41%  351 aa  NUOH_DESHY RecName: Full=NADH-quinone oxidoreductase subunit H;    
   18::351     9e-50  38%  363 aa  NU1C_LOTJA RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1,
   33::366     1e-49  38%  372 aa  NUOH_PELLD RecName: Full=NADH-quinone oxidoreductase subunit H;    
   44::340     1e-49  37%  356 aa  NUOH_ORITB RecName: Full=NADH-quinone oxidoreductase subunit H;    
   41::332     2e-49  39%  342 aa  NUOH_GRABC RecName: Full=NADH-quinone oxidoreductase subunit H;    
   49::353     2e-49  38%  365 aa  NU1C_POPTR RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1,
   34::325     2e-49  36%  335 aa  NUOH_PSEPF RecName: Full=NADH-quinone oxidoreductase subunit H;    
   32::352     2e-49  35%  358 aa  NUOH_BACTN RecName: Full=NADH-quinone oxidoreductase subunit H;    
   38::327     3e-49  39%  332 aa  NUOH_GEOTN RecName: Full=NADH-quinone oxidoreductase subunit H;    
   49::353     3e-49  38%  365 aa  NU1C_POPAL RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1,
   48::354     3e-49  40%  362 aa  NU1C_ORYSJ RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1,
   48::354     3e-49  40%  362 aa  NU1C_ORYSI RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1,
   48::354     3e-49  40%  362 aa  NU1C_ORYSA RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1,
   48::354     3e-49  40%  362 aa  NU1C_ORYNI RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1,
   43::348     4e-49  38%  356 aa  NUOH_NITWN RecName: Full=NADH-quinone oxidoreductase subunit H;    
   10::342     4e-49  36%  356 aa  NUOH_LEPBP RecName: Full=NADH-quinone oxidoreductase subunit H;    
   10::342     4e-49  36%  356 aa  NUOH_LEPBA RecName: Full=NADH-quinone oxidoreductase subunit H;    
   49::349     4e-49  43%  367 aa  NU1C_TOBAC RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1,
   48::354     4e-49  40%  362 aa  NU1C_SACOF RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1,
   48::354     4e-49  40%  362 aa  NU1C_SACHY RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1,
   14::316     5e-49  40%  339 aa  NUOH_RICPR RecName: Full=NADH-quinone oxidoreductase subunit H;    
   23::344     5e-49  33%  354 aa  NUOH_RALME RecName: Full=NADH-quinone oxidoreductase subunit H;    
   23::344     5e-49  33%  354 aa  NUOH_RALEJ RecName: Full=NADH-quinone oxidoreductase subunit H;    
   40::347     5e-49  38%  367 aa  NUOH_EHRRW RecName: Full=NADH-quinone oxidoreductase subunit H;    
   40::347     5e-49  38%  367 aa  NUOH_EHRRG RecName: Full=NADH-quinone oxidoreductase subunit H;    
   44::344     5e-49  34%  354 aa  NUOH_CUPTR RecName: Full=NADH-quinone oxidoreductase subunit H;    
   13::330     6e-49  37%  339 aa  NUOH_RICCK RecName: Full=NADH-quinone oxidoreductase subunit H;    
   29::337     6e-49  35%  343 aa  NUOH_FLAPJ RecName: Full=NADH-quinone oxidoreductase subunit H;    
   53::356     6e-49  40%  368 aa  NU1C_CYCTA RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1,
   13::330     8e-49  38%  339 aa  NUOH_RICB8 RecName: Full=NADH-quinone oxidoreductase subunit H;    
   35::343     8e-49  38%  347 aa  NUOH_RHILO RecName: Full=NADH-quinone oxidoreductase subunit H;    
   16::337     8e-49  36%  410 aa  NUOH_MYCTU RecName: Full=NADH-quinone oxidoreductase subunit H;    
   16::337     8e-49  36%  410 aa  NUOH_MYCTA RecName: Full=NADH-quinone oxidoreductase subunit H;    
   16::337     8e-49  36%  410 aa  NUOH_MYCBT RecName: Full=NADH-quinone oxidoreductase subunit H;    
   16::337     8e-49  36%  410 aa  NUOH_MYCBP RecName: Full=NADH-quinone oxidoreductase subunit H;    
   16::337     8e-49  36%  410 aa  NUOH_MYCBO RecName: Full=NADH-quinone oxidoreductase subunit H;    
   51::353     8e-49  38%  365 aa  NU1C_SPIOL RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1,
   49::355     8e-49  39%  363 aa  NU1C_LACSA RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1,
    1::301     1e-48  38%  324 aa  NUOH2_RHOPB RecName: Full=NADH-quinone oxidoreductase subunit H 2; 
   13::330     1e-48  38%  339 aa  NUOH_RICBR RecName: Full=NADH-quinone oxidoreductase subunit H;    
   12::337     1e-48  34%  424 aa  NUOH_MYCUA RecName: Full=NADH-quinone oxidoreductase subunit H;    
   35::342     1e-48  37%  348 aa  NUOH_BARQU RecName: Full=NADH-quinone oxidoreductase subunit H;    
   36::343     1e-48  37%  349 aa  NUOH_BARHE RecName: Full=NADH-quinone oxidoreductase subunit H;    
   27::339     1e-48  35%  349 aa  NUOH_AZOSE RecName: Full=NADH-quinone oxidoreductase subunit H;    
   48::354     1e-48  39%  362 aa  NU1C_HORVU RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1,
   48::354     2e-48  39%  362 aa  NU1C_WHEAT RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1,
   29::333     2e-48  36%  341 aa  NUOH_THERP RecName: Full=NADH-quinone oxidoreductase subunit H;    
   18::330     2e-48  39%  347 aa  NUOH_SPHAL RecName: Full=NADH-quinone oxidoreductase subunit H;    
   13::319     2e-48  38%  339 aa  NUOH_RICFE RecName: Full=NADH-quinone oxidoreductase subunit H;    
    5::327     2e-48  36%  329 aa  NUOH_HELAH RecName: Full=NADH-quinone oxidoreductase subunit H;    
   46::329     2e-48  39%  354 aa  NUOH_BURXL RecName: Full=NADH-quinone oxidoreductase subunit H;    
   18::345     2e-48  36%  363 aa  NU1C_VITVI RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1,
   49::345     2e-48  39%  363 aa  NU1C_PELHO RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1,
   34::320     3e-48  38%  325 aa  NUOH_CITK8 RecName: Full=NADH-quinone oxidoreductase subunit H;    
    5::327     4e-48  37%  329 aa  NUOH_HELPY RecName: Full=NADH-quinone oxidoreductase subunit H;    
   49::351     4e-48  38%  363 aa  NU1C_MORIN RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1,
   18::345     4e-48  36%  363 aa  NU1C_DRIGR RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1,
   34::320     5e-48  37%  325 aa  NUOH_SALTY RecName: Full=NADH-quinone oxidoreductase subunit H;    
   34::320     5e-48  37%  325 aa  NUOH_SALPC RecName: Full=NADH-quinone oxidoreductase subunit H;    
   34::320     5e-48  37%  325 aa  NUOH_SALPB RecName: Full=NADH-quinone oxidoreductase subunit H;    
   34::320     5e-48  37%  325 aa  NUOH_SALPA RecName: Full=NADH-quinone oxidoreductase subunit H;    
   34::320     5e-48  37%  325 aa  NUOH_SALNS RecName: Full=NADH-quinone oxidoreductase subunit H;    
   34::320     5e-48  37%  325 aa  NUOH_SALDC RecName: Full=NADH-quinone oxidoreductase subunit H;    
   34::320     5e-48  37%  325 aa  NUOH_SALCH RecName: Full=NADH-quinone oxidoreductase subunit H;    
   34::320     5e-48  37%  325 aa  NUOH_SALA4 RecName: Full=NADH-quinone oxidoreductase subunit H;    
   13::319     5e-48  38%  339 aa  NUOH_RICRS RecName: Full=NADH-quinone oxidoreductase subunit H;    
   13::319     5e-48  38%  339 aa  NUOH_RICRO RecName: Full=NADH-quinone oxidoreductase subunit H;    
   34::320     5e-48  37%  325 aa  NUOH_ESCF3 RecName: Full=NADH-quinone oxidoreductase subunit H;    
   34::320     5e-48  37%  326 aa  NUOH_ENTS8 RecName: Full=NADH-quinone oxidoreductase subunit H;    
   49::348     5e-48  39%  363 aa  NU1C_GOSBA RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1,
   49::345     5e-48  42%  363 aa  NU1C_ATRBE RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1,
   34::320     7e-48  37%  325 aa  NUOH_SHISS RecName: Full=NADH-quinone oxidoreductase subunit H;    
   34::320     7e-48  37%  325 aa  NUOH_SHIDS RecName: Full=NADH-quinone oxidoreductase subunit H;    
   34::320     7e-48  37%  325 aa  NUOH_SHIBS RecName: Full=NADH-quinone oxidoreductase subunit H;    
   34::320     7e-48  37%  325 aa  NUOH_SHIB3 RecName: Full=NADH-quinone oxidoreductase subunit H;    
   34::320     7e-48  37%  325 aa  NUOH_SALTI RecName: Full=NADH-quinone oxidoreductase subunit H;    
   34::320     7e-48  37%  325 aa  NUOH_SALAR RecName: Full=NADH-quinone oxidoreductase subunit H;    
   31::332     7e-48  37%  340 aa  NUOH_LEGPL RecName: Full=NADH-quinone oxidoreductase subunit H;    
   34::320     7e-48  37%  325 aa  NUOH_ECOUT RecName: Full=NADH-quinone oxidoreductase subunit H;    
   34::320     7e-48  37%  325 aa  NUOH_ECOSM RecName: Full=NADH-quinone oxidoreductase subunit H;    
   34::320     7e-48  37%  325 aa  NUOH_ECOSE RecName: Full=NADH-quinone oxidoreductase subunit H;    
   34::320     7e-48  37%  325 aa  NUOH_ECOLU RecName: Full=NADH-quinone oxidoreductase subunit H;    
   34::320     7e-48  37%  325 aa  NUOH_ECOLI RecName: Full=NADH-quinone oxidoreductase subunit H;    
   34::320     7e-48  37%  325 aa  NUOH_ECOLC RecName: Full=NADH-quinone oxidoreductase subunit H;    
   34::320     7e-48  37%  325 aa  NUOH_ECOL6 RecName: Full=NADH-quinone oxidoreductase subunit H;    
   34::320     7e-48  37%  325 aa  NUOH_ECOL5 RecName: Full=NADH-quinone oxidoreductase subunit H;    
   34::320     7e-48  37%  325 aa  NUOH_ECOK1 RecName: Full=NADH-quinone oxidoreductase subunit H;    
   34::320     7e-48  37%  325 aa  NUOH_ECOHS RecName: Full=NADH-quinone oxidoreductase subunit H;    
   34::320     7e-48  37%  325 aa  NUOH_ECODH RecName: Full=NADH-quinone oxidoreductase subunit H;    
   34::320     7e-48  37%  325 aa  NUOH_ECOBW RecName: Full=NADH-quinone oxidoreductase subunit H;    
   34::320     7e-48  37%  325 aa  NUOH_ECO8A RecName: Full=NADH-quinone oxidoreductase subunit H;    
   34::320     7e-48  37%  325 aa  NUOH_ECO81 RecName: Full=NADH-quinone oxidoreductase subunit H;    
   34::320     7e-48  37%  325 aa  NUOH_ECO7I RecName: Full=NADH-quinone oxidoreductase subunit H;    
   34::320     7e-48  37%  325 aa  NUOH_ECO5E RecName: Full=NADH-quinone oxidoreductase subunit H;    
   34::320     7e-48  37%  325 aa  NUOH_ECO57 RecName: Full=NADH-quinone oxidoreductase subunit H;    
   34::320     7e-48  37%  325 aa  NUOH_ECO55 RecName: Full=NADH-quinone oxidoreductase subunit H;    
   34::320     7e-48  37%  325 aa  NUOH_ECO45 RecName: Full=NADH-quinone oxidoreductase subunit H;    
   34::320     7e-48  37%  325 aa  NUOH_ECO27 RecName: Full=NADH-quinone oxidoreductase subunit H;    
   34::320     7e-48  37%  325 aa  NUOH_ECO24 RecName: Full=NADH-quinone oxidoreductase subunit H;    
   46::343     7e-48  37%  354 aa  NUOH_BURTA RecName: Full=NADH-quinone oxidoreductase subunit H;    
   49::348     7e-48  39%  363 aa  NU1C_GOSHI RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1,
    9::328     7e-48  37%  350 aa  FPOH_METMA RecName: Full=F(420)H(2) oxidoreductase subunit
   44::344     9e-48  33%  354 aa  NUOH_RALSO RecName: Full=NADH-quinone oxidoreductase subunit H;    
    5::327     9e-48  37%  329 aa  NUOH_HELPS RecName: Full=NADH-quinone oxidoreductase subunit H;    
    5::327     9e-48  37%  329 aa  NUOH_HELPJ RecName: Full=NADH-quinone oxidoreductase subunit H;    
    5::327     9e-48  37%  329 aa  NUOH_HELP2 RecName: Full=NADH-quinone oxidoreductase subunit H;    
   46::329     9e-48  38%  354 aa  NUOH_BURPP RecName: Full=NADH-quinone oxidoreductase subunit H;    
   52::346     9e-48  39%  372 aa  NU1C_SYNS3 RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1; 
   49::345     9e-48  42%  363 aa  NU1C_SOLTU RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1,
   49::345     9e-48  42%  363 aa  NU1C_SOLBU RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1,
   49::345     9e-48  42%  363 aa  NU1C_NICTO RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1,
   51::348     9e-48  37%  360 aa  NU1C_ARATH RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1,
   50::346     9e-48  40%  372 aa  NU1C_ANAVT RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1; 
   28::332     1e-47  37%  336 aa  NUOH_NEOSM RecName: Full=NADH-quinone oxidoreductase subunit H;    
   31::332     1e-47  37%  340 aa  NUOH_LEGPH RecName: Full=NADH-quinone oxidoreductase subunit H;    
   46::343     1e-47  37%  354 aa  NUOH_BURPS RecName: Full=NADH-quinone oxidoreductase subunit H;    
   46::343     1e-47  37%  354 aa  NUOH_BURP6 RecName: Full=NADH-quinone oxidoreductase subunit H;    
   46::343     1e-47  37%  354 aa  NUOH_BURP1 RecName: Full=NADH-quinone oxidoreductase subunit H;    
   46::343     1e-47  37%  354 aa  NUOH_BURP0 RecName: Full=NADH-quinone oxidoreductase subunit H;    
   46::343     1e-47  37%  354 aa  NUOH_BURMA RecName: Full=NADH-quinone oxidoreductase subunit H;    
   39::346     1e-47  40%  372 aa  NU1C_THEEB RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1; 
   50::362     1e-47  38%  372 aa  NU1C_PROMA RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1; 
   49::349     1e-47  38%  361 aa  NU1C_NYMAL RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1,
   49::345     1e-47  41%  363 aa  NU1C_COFAR RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1,
   18::345     1e-47  36%  363 aa  NU1C_CITSI RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1,
   13::319     1e-47  38%  339 aa  NUOH_RICPU RecName: Full=NADH-quinone oxidoreductase subunit H;    
   44::344     1e-47  34%  354 aa  NUOH_RALPJ RecName: Full=NADH-quinone oxidoreductase subunit H;    
   15::320     1e-47  34%  324 aa  NUOH_PECCP RecName: Full=NADH-quinone oxidoreductase subunit H;    
    1::326     1e-47  33%  409 aa  NUOH_MYCPA RecName: Full=NADH-quinone oxidoreductase subunit H;    
    5::327     1e-47  37%  329 aa  NUOH_HELPH RecName: Full=NADH-quinone oxidoreductase subunit H;    
    5::327     1e-47  37%  329 aa  NUOH_HELPG RecName: Full=NADH-quinone oxidoreductase subunit H;    
   49::345     1e-47  40%  363 aa  NU1C_PANGI RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1,
   49::345     1e-47  40%  363 aa  NU1C_DAUCA RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1,
   34::320     2e-47  37%  325 aa  NUOH_SHIFL RecName: Full=NADH-quinone oxidoreductase subunit H;    
   34::320     2e-47  37%  325 aa  NUOH_SHIF8 RecName: Full=NADH-quinone oxidoreductase subunit H;    
   50::347     2e-47  35%  348 aa  NUOH_PSYWF RecName: Full=NADH-quinone oxidoreductase subunit H;    
   36::320     2e-47  36%  325 aa  NUOH_PROMH RecName: Full=NADH-quinone oxidoreductase subunit H;    
   35::343     2e-47  38%  347 aa  NUOH_OCHA4 RecName: Full=NADH-quinone oxidoreductase subunit H;    
   16::341     2e-47  33%  418 aa  NUOH_MYCA1 RecName: Full=NADH-quinone oxidoreductase subunit H;    
   35::343     2e-47  38%  347 aa  NUOH_BRUO2 RecName: Full=NADH-quinone oxidoreductase subunit H;    
   49::345     2e-47  42%  363 aa  NU1C_SOLLC RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1,
   51::348     2e-47  37%  360 aa  NU1C_OLIPU RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1,
   49::349     2e-47  37%  361 aa  NU1C_NUPAD RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1,
   49::345     2e-47  42%  363 aa  NU1C_NICSY RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1,
   49::348     2e-47  37%  363 aa  NU1C_EUCGG RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1,
   35::353     2e-47  37%  365 aa  NU1C_ARAHI RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1,
   52::350     3e-47  35%  360 aa  NUOH_NEIMF RecName: Full=NADH-quinone oxidoreductase subunit H;    
   24::356     3e-47  38%  359 aa  NUOH_CHLTE RecName: Full=NADH-quinone oxidoreductase subunit H;    
   46::329     3e-47  37%  355 aa  NUOH_BURCM RecName: Full=NADH-quinone oxidoreductase subunit H;    
   46::329     3e-47  37%  355 aa  NUOH_BURA4 RecName: Full=NADH-quinone oxidoreductase subunit H;    
   35::343     3e-47  38%  347 aa  NUOH_BRUSU RecName: Full=NADH-quinone oxidoreductase subunit H;    
   35::343     3e-47  38%  347 aa  NUOH_BRUSI RecName: Full=NADH-quinone oxidoreductase subunit H;    
   35::343     3e-47  38%  347 aa  NUOH_BRUME RecName: Full=NADH-quinone oxidoreductase subunit H;    
   35::343     3e-47  38%  347 aa  NUOH_BRUMB RecName: Full=NADH-quinone oxidoreductase subunit H;    
   35::343     3e-47  38%  347 aa  NUOH_BRUC2 RecName: Full=NADH-quinone oxidoreductase subunit H;    
   35::343     3e-47  38%  347 aa  NUOH_BRUAB RecName: Full=NADH-quinone oxidoreductase subunit H;    
   35::343     3e-47  38%  347 aa  NUOH_BRUA2 RecName: Full=NADH-quinone oxidoreductase subunit H;    
   51::341     3e-47  36%  358 aa  NUOH_BACFR RecName: Full=NADH-quinone oxidoreductase subunit H;    
   51::341     3e-47  36%  358 aa  NUOH_BACFN RecName: Full=NADH-quinone oxidoreductase subunit H;    
   22::329     3e-47  39%  340 aa  NUOH_ANAPZ RecName: Full=NADH-quinone oxidoreductase subunit H;    
   50::351     3e-47  38%  366 aa  NU1C_NANDO RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1,
   51::348     3e-47  38%  360 aa  NU1C_CAPBU RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1,
   48::350     3e-47  39%  362 aa  NU1C_AGRST RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1,
   34::320     3e-47  37%  325 aa  NUOH_EDWI9 RecName: Full=NADH-quinone oxidoreductase subunit H;    
   24::356     3e-47  38%  359 aa  NUOH_CHLP8 RecName: Full=NADH-quinone oxidoreductase subunit H;    
   46::329     3e-47  37%  355 aa  NUOH_BURVG RecName: Full=NADH-quinone oxidoreductase subunit H;    
   33::328     3e-47  36%  328 aa  NUOH1_SYMTH RecName: Full=NADH-quinone oxidoreductase subunit H 1; 
    1::313     3e-47  35%  319 aa  NUOH1_RHOP5 RecName: Full=NADH-quinone oxidoreductase subunit H 1; 
   49::345     3e-47  40%  363 aa  NU1C_HELAN RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1,
   50::348     4e-47  35%  358 aa  NUOH_NEIM0 RecName: Full=NADH-quinone oxidoreductase subunit H;    
   31::332     4e-47  37%  340 aa  NUOH_LEGPA RecName: Full=NADH-quinone oxidoreductase subunit H;    
   28::328     4e-47  37%  336 aa  NUOH_FRATM RecName: Full=NADH-quinone oxidoreductase subunit H;    
   46::329     4e-47  38%  355 aa  NUOH_BURCJ RecName: Full=NADH-quinone oxidoreductase subunit H;    
   46::329     4e-47  37%  355 aa  NUOH_BURCH RecName: Full=NADH-quinone oxidoreductase subunit H;    
   46::329     4e-47  37%  355 aa  NUOH_BURCC RecName: Full=NADH-quinone oxidoreductase subunit H;    
   46::329     4e-47  37%  355 aa  NUOH_BURCA RecName: Full=NADH-quinone oxidoreductase subunit H;    
   13::319     6e-47  38%  339 aa  NUOH_RICAE RecName: Full=NADH-quinone oxidoreductase subunit H;    
   31::332     6e-47  36%  340 aa  NUOH_LEGPC RecName: Full=NADH-quinone oxidoreductase subunit H;    
   46::329     6e-47  37%  355 aa  NUOH_BURS3 RecName: Full=NADH-quinone oxidoreductase subunit H;    
   20::362     6e-47  35%  369 aa  NU1C_HUPLU RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1,
   50::345     7e-47  36%  358 aa  NUOH_NEIMA RecName: Full=NADH-quinone oxidoreductase subunit H;    
   28::328     7e-47  37%  336 aa  NUOH_FRATW RecName: Full=NADH-quinone oxidoreductase subunit H;    
   28::328     7e-47  37%  336 aa  NUOH_FRATT RecName: Full=NADH-quinone oxidoreductase subunit H;    
   28::328     7e-47  37%  336 aa  NUOH_FRATO RecName: Full=NADH-quinone oxidoreductase subunit H;    
   28::328     7e-47  37%  336 aa  NUOH_FRATN RecName: Full=NADH-quinone oxidoreductase subunit H;    
   28::328     7e-47  37%  336 aa  NUOH_FRATH RecName: Full=NADH-quinone oxidoreductase subunit H;    
   28::328     7e-47  37%  336 aa  NUOH_FRATF RecName: Full=NADH-quinone oxidoreductase subunit H;    
   28::328     7e-47  37%  336 aa  NUOH_FRAT1 RecName: Full=NADH-quinone oxidoreductase subunit H;    
   52::361     7e-47  40%  368 aa  NU1C_PHYPA RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1,
   51::348     7e-47  38%  360 aa  NU1C_LOBMA RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1,
   51::348     7e-47  38%  360 aa  NU1C_LEPVR RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1,
   51::348     7e-47  38%  360 aa  NU1C_CRUWA RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1,
   53::353     7e-47  37%  365 aa  NU1C_ACOCL RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1,
   38::341     1e-46  37%  347 aa  NUOH1_RHIME RecName: Full=NADH-quinone oxidoreductase subunit H 1; 
   51::348     1e-46  38%  360 aa  NU1C_NASOF RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1,
   51::348     1e-46  38%  360 aa  NU1C_BARVE RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1,
   43::350     1e-46  35%  467 aa  NUOH_STRCO RecName: Full=NADH-quinone oxidoreductase subunit H;    
   14::319     1e-46  37%  339 aa  NUOH_RICTY RecName: Full=NADH-quinone oxidoreductase subunit H;    
   34::318     1e-46  34%  331 aa  NUOH_PSEAE RecName: Full=NADH-quinone oxidoreductase subunit H;    
   34::318     1e-46  34%  331 aa  NUOH_PSEAB RecName: Full=NADH-quinone oxidoreductase subunit H;    
   34::318     1e-46  34%  331 aa  NUOH_PSEA8 RecName: Full=NADH-quinone oxidoreductase subunit H;    
   40::333     1e-46  39%  367 aa  NUOH_EHRCR RecName: Full=NADH-quinone oxidoreductase subunit H;    
   38::342     1e-46  36%  348 aa  NUOH_BARBK RecName: Full=NADH-quinone oxidoreductase subunit H;    
   11::348     1e-46  35%  363 aa  NU1C_PIPCE RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1,
   34::318     2e-46  34%  331 aa  NUOH_PSEA7 RecName: Full=NADH-quinone oxidoreductase subunit H;    
   30::320     2e-46  38%  332 aa  NUOH_PELUB RecName: Full=NADH-quinone oxidoreductase subunit H;    
   47::347     2e-46  35%  357 aa  NUOH_HERAR RecName: Full=NADH-quinone oxidoreductase subunit H;    
   46::329     2e-46  37%  355 aa  NUOH_BURM1 RecName: Full=NADH-quinone oxidoreductase subunit H;    
   50::356     2e-46  38%  368 aa  NU1C_MARPO RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1,
   49::342     2e-46  38%  363 aa  NU1C_CALFG RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1,
    4::323     2e-46  35%  349 aa  NUOH_CHRVO RecName: Full=NADH-quinone oxidoreductase subunit H;    
    1::320     3e-46  36%  345 aa  NUOH_SALRD RecName: Full=NADH-quinone oxidoreductase subunit H;    
   30::344     3e-46  35%  346 aa  NUOH_LEPBL RecName: Full=NADH-quinone oxidoreductase subunit H;    
   30::344     3e-46  35%  346 aa  NUOH_LEPBJ RecName: Full=NADH-quinone oxidoreductase subunit H;    
   11::328     3e-46  35%  345 aa  NUOH1_RHOS4 RecName: Full=NADH-quinone oxidoreductase subunit H 1; 
    7::324     3e-46  35%  341 aa  NUOH1_RHOS1 RecName: Full=NADH-quinone oxidoreductase subunit H 1; 
   51::352     3e-46  38%  360 aa  NU1C_AETGR RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1,
   51::363     3e-46  37%  371 aa  NU1C_ADICA RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1,
   39::320     4e-46  40%  323 aa  NU1M_DICCI RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   48::350     4e-46  39%  362 aa  NU1C_SORBI RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1,
   34::351     4e-46  36%  363 aa  NU1C_PHAVU RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1,
   50::348     5e-46  34%  358 aa  NUOH_NEIMB RecName: Full=NADH-quinone oxidoreductase subunit H;    
   50::362     5e-46  37%  372 aa  NU1C_PROMM RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1; 
   50::362     5e-46  37%  372 aa  NU1C_PROM3 RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1; 
   48::346     6e-46  34%  359 aa  NUOH_POLNA RecName: Full=NADH-quinone oxidoreductase subunit H;    
   50::348     6e-46  35%  358 aa  NUOH_NEIG1 RecName: Full=NADH-quinone oxidoreductase subunit H;    
   33::380     6e-46  37%  385 aa  NUOH_BDEBA RecName: Full=NADH-quinone oxidoreductase subunit H;    
   51::345     6e-46  37%  360 aa  NU1C_DRANE RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1,
   51::352     6e-46  38%  360 aa  NU1C_AETCO RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1,
   28::328     8e-46  36%  336 aa  NUOH_FRAP2 RecName: Full=NADH-quinone oxidoreductase subunit H;    
    8::368     8e-46  36%  394 aa  NUOH2_SYMTH RecName: Full=NADH-quinone oxidoreductase subunit H 2; 
    2::311     1e-45  37%  316 aa  NUOH_METCA RecName: Full=NADH-quinone oxidoreductase subunit H;    
   33::314     1e-45  39%  317 aa  NU1M_DICDI RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   34::303     1e-45  38%  325 aa  NUOH_SODGM RecName: Full=NADH-quinone oxidoreductase subunit H;    
   36::343     1e-45  36%  441 aa  NUOH_SACEN RecName: Full=NADH-quinone oxidoreductase subunit H;    
   36::320     1e-45  35%  324 aa  NUOH_ERWCT RecName: Full=NADH-quinone oxidoreductase subunit H;    
   49::352     1e-45  36%  364 aa  NU1C_ILLOL RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1,
   13::319     2e-45  38%  339 aa  NUOH_RICAH RecName: Full=NADH-quinone oxidoreductase subunit H;    
   51::349     2e-45  36%  355 aa  NUOH_AZOPC RecName: Full=NADH-quinone oxidoreductase subunit H;    
   51::351     2e-45  37%  363 aa  NU1C_RANMC RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1,
   50::360     2e-45  39%  372 aa  NU1C_PROMT RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1; 
   21::322     2e-45  37%  348 aa  FPOH_METAC RecName: Full=F(420)H(2) oxidoreductase subunit
   34::351     2e-45  33%  440 aa  NUOH_PROAC RecName: Full=NADH-quinone oxidoreductase subunit H;    
   51::351     2e-45  38%  363 aa  NU1C_ZYGCR RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1,
   49::345     2e-45  41%  363 aa  NU1C_LIRTU RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1,
   34::303     3e-45  38%  325 aa  NUOH_KLEP7 RecName: Full=NADH-quinone oxidoreductase subunit H;    
   34::303     3e-45  38%  325 aa  NUOH_KLEP3 RecName: Full=NADH-quinone oxidoreductase subunit H;    
   41::334     3e-45  39%  369 aa  NUOH_EHRCJ RecName: Full=NADH-quinone oxidoreductase subunit H;    
   38::342     3e-45  36%  348 aa  NUOH_BART1 RecName: Full=NADH-quinone oxidoreductase subunit H;    
    1::318     4e-45  36%  345 aa  NUOH_ROSDO RecName: Full=NADH-quinone oxidoreductase subunit H;    
   29::322     4e-45  36%  350 aa  NUOH_FLAJ1 RecName: Full=NADH-quinone oxidoreductase subunit H;    
   27::319     4e-45  36%  326 aa  NU1M_CHOCR RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   51::345     4e-45  37%  363 aa  NU1C_OENEH RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1,
   52::355     4e-45  38%  367 aa  NU1C_MESVI RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1,
   49::351     4e-45  37%  363 aa  NU1C_AMBTC RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1,
   34::303     5e-45  37%  325 aa  NUOH_YERPS RecName: Full=NADH-quinone oxidoreductase subunit H;    
   34::303     5e-45  37%  325 aa  NUOH_YERPP RecName: Full=NADH-quinone oxidoreductase subunit H;    
   34::303     5e-45  37%  325 aa  NUOH_YERPN RecName: Full=NADH-quinone oxidoreductase subunit H;    
   34::303     5e-45  37%  325 aa  NUOH_YERPG RecName: Full=NADH-quinone oxidoreductase subunit H;    
   34::303     5e-45  37%  325 aa  NUOH_YERPE RecName: Full=NADH-quinone oxidoreductase subunit H;    
   34::303     5e-45  37%  325 aa  NUOH_YERPB RecName: Full=NADH-quinone oxidoreductase subunit H;    
   34::303     5e-45  37%  325 aa  NUOH_YERPA RecName: Full=NADH-quinone oxidoreductase subunit H;    
   34::303     5e-45  37%  325 aa  NUOH_YERP3 RecName: Full=NADH-quinone oxidoreductase subunit H;    
   34::303     5e-45  37%  325 aa  NUOH_YERE8 RecName: Full=NADH-quinone oxidoreductase subunit H;    
   43::350     5e-45  35%  454 aa  NUOH_STRAW RecName: Full=NADH-quinone oxidoreductase subunit H;    
   35::328     5e-45  35%  345 aa  NUOH_PARDP RecName: Full=NADH-quinone oxidoreductase subunit H;    
   32::332     5e-45  38%  340 aa  NUOH_COXB2 RecName: Full=NADH-quinone oxidoreductase subunit H;    
   36::308     5e-45  35%  329 aa  NUOH_AZOVD RecName: Full=NADH-quinone oxidoreductase subunit H;    
   45::336     5e-45  37%  344 aa  NU1M_CYACA RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   50::360     5e-45  38%  372 aa  NU1C_PROM1 RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1; 
   34::303     7e-45  38%  325 aa  NUOH_ENT38 RecName: Full=NADH-quinone oxidoreductase subunit H;    
   33::332     7e-45  37%  390 aa  NUOH_DEIDV RecName: Full=NADH-quinone oxidoreductase subunit H;    
   32::332     7e-45  38%  340 aa  NUOH_COXBU RecName: Full=NADH-quinone oxidoreductase subunit H;    
   32::332     7e-45  38%  340 aa  NUOH_COXBR RecName: Full=NADH-quinone oxidoreductase subunit H;    
   32::332     7e-45  38%  340 aa  NUOH_COXBN RecName: Full=NADH-quinone oxidoreductase subunit H;    
   32::332     7e-45  38%  340 aa  NUOH_COXB1 RecName: Full=NADH-quinone oxidoreductase subunit H;    
   33::318     7e-45  37%  331 aa  NU1M_OENBE RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   43::348     9e-45  37%  356 aa  NUOH_BRASB RecName: Full=NADH-quinone oxidoreductase subunit H;    
    6::330     1e-44  34%  330 aa  NUOH_NITSB RecName: Full=NADH-quinone oxidoreductase subunit H;    
   32::347     1e-44  35%  357 aa  NUOH_JANMA RecName: Full=NADH-quinone oxidoreductase subunit H;    
   40::354     1e-44  36%  364 aa  NUOH_HYPNA RecName: Full=NADH-quinone oxidoreductase subunit H;    
    1::330     1e-44  36%  332 aa  NUOH_HELHP RecName: Full=NADH-quinone oxidoreductase subunit H;    
    6::349     1e-44  34%  366 aa  NUOH2_NITMU RecName: Full=NADH-quinone oxidoreductase subunit H 2; 
   34::303     2e-44  37%  325 aa  NUOH_YERPY RecName: Full=NADH-quinone oxidoreductase subunit H;    
   43::353     2e-44  36%  364 aa  NUOH_PHEZH RecName: Full=NADH-quinone oxidoreductase subunit H;    
   36::341     2e-44  35%  347 aa  NUOH_AGRVS RecName: Full=NADH-quinone oxidoreductase subunit H;    
   18::351     2e-44  35%  363 aa  NU1C_SOYBN RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1,
   27::312     2e-44  37%  325 aa  NU1M_ARATH RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   18::346     3e-44  32%  359 aa  NUOH_POLSJ RecName: Full=NADH-quinone oxidoreductase subunit H;    
   30::326     3e-44  35%  328 aa  NUOH2_RHIME RecName: Full=NADH-quinone oxidoreductase subunit H 2; 
   53::347     3e-44  39%  373 aa  NU1C_SYNPX RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1; 
   35::328     3e-44  34%  345 aa  NQO8_PARDE RecName: Full=NADH-quinone oxidoreductase subunit 8;    
   12::317     3e-44  35%  322 aa  NUOH_AERHH RecName: Full=NADH-quinone oxidoreductase subunit H;    
   12::317     6e-44  35%  322 aa  NUOH_AERS4 RecName: Full=NADH-quinone oxidoreductase subunit H;    
   36::311     6e-44  38%  334 aa  NU1M_METSE RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   51::339     8e-44  37%  449 aa  NUOH_FRAAA RecName: Full=NADH-quinone oxidoreductase subunit H;    
    4::330     1e-43  37%  348 aa  NUOH_SPHWW RecName: Full=NADH-quinone oxidoreductase subunit H;    
   19::330     1e-43  38%  348 aa  NUOH_ERYLH RecName: Full=NADH-quinone oxidoreductase subunit H;    
   51::358     1e-43  35%  371 aa  NU1C_PSINU RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1,
   35::328     1e-43  34%  345 aa  NUOH_RHOCA RecName: Full=NADH-quinone oxidoreductase subunit H;    
   43::348     1e-43  37%  356 aa  NUOH_NITHX RecName: Full=NADH-quinone oxidoreductase subunit H;    
   31::353     1e-43  35%  354 aa  NUOH2_ACIBL RecName: Full=NADH-quinone oxidoreductase subunit H 2; 
   27::312     1e-43  37%  325 aa  NU1M_WHEAT RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   33::355     2e-43  36%  452 aa  NUOH_THEFY RecName: Full=NADH-quinone oxidoreductase subunit H;    
    1::318     2e-43  34%  345 aa  NUOH_SILPO RecName: Full=NADH-quinone oxidoreductase subunit H;    
   34::303     2e-43  36%  325 aa  NUOH_SERP5 RecName: Full=NADH-quinone oxidoreductase subunit H;    
   18::351     2e-43  34%  363 aa  NU1C_PLAOC RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1,
    1::326     3e-43  34%  345 aa  NUOH_SILST RecName: Full=NADH-quinone oxidoreductase subunit H;    
   58::344     4e-43  34%  354 aa  NUOH_METPP RecName: Full=NADH-quinone oxidoreductase subunit H;    
   36::341     4e-43  35%  347 aa  NUOH_MESSB RecName: Full=NADH-quinone oxidoreductase subunit H;    
   43::331     4e-43  37%  356 aa  NUOH_BRASO RecName: Full=NADH-quinone oxidoreductase subunit H;    
   53::347     4e-43  38%  373 aa  NU1C_SYNS9 RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1; 
   14::331     5e-43  34%  331 aa  NUOH_RUBXD RecName: Full=NADH-quinone oxidoreductase subunit H;    
   18::323     5e-43  37%  347 aa  NUOH_NOVAD RecName: Full=NADH-quinone oxidoreductase subunit H;    
   36::333     6e-43  36%  341 aa  NUOH2_RHOP2 RecName: Full=NADH-quinone oxidoreductase subunit H 2; 
    8::392     6e-43  36%  397 aa  NUOH1_SOLUE RecName: Full=NADH-quinone oxidoreductase subunit H 1; 
   12::317     8e-43  35%  322 aa  NUOH_SHEON RecName: Full=NADH-quinone oxidoreductase subunit H;    
   36::333     8e-43  35%  341 aa  NUOH2_RHOP5 RecName: Full=NADH-quinone oxidoreductase subunit H 2; 
   12::330     1e-42  35%  341 aa  NUOH_WOLTR RecName: Full=NADH-quinone oxidoreductase subunit H;    
   34::303     1e-42  37%  325 aa  NUOH_PHOLL RecName: Full=NADH-quinone oxidoreductase subunit H;    
   36::327     1e-42  35%  346 aa  NUOH_JANSC RecName: Full=NADH-quinone oxidoreductase subunit H;    
   15::317     1e-42  34%  321 aa  NUOH_BAUCH RecName: Full=NADH-quinone oxidoreductase subunit H;    
   33::321     1e-42  36%  397 aa  NUOH_DEIRA RecName: Full=NADH-quinone oxidoreductase subunit H;    
   33::326     1e-42  36%  331 aa  NUOH2_SYNFM RecName: Full=NADH-quinone oxidoreductase subunit H 2; 
   25::330     2e-42  35%  341 aa  NUOH_WOLPM RecName: Full=NADH-quinone oxidoreductase subunit H;    
   25::347     2e-42  32%  360 aa  NUOH_RHOFD RecName: Full=NADH-quinone oxidoreductase subunit H;    
   34::303     2e-42  37%  325 aa  NUOH_ERWT9 RecName: Full=NADH-quinone oxidoreductase subunit H;    
   29::318     2e-42  35%  331 aa  NU1M_USTMA RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   53::347     2e-42  39%  373 aa  NU1C_SYNSC RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1; 
   36::333     2e-42  35%  341 aa  NUOH2_RHOPS RecName: Full=NADH-quinone oxidoreductase subunit H 2; 
   50::345     2e-42  37%  372 aa  NU1C_TRIEI RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1; 
   46::348     2e-42  37%  363 aa  NU1C_CHAGL RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1,
   31::330     3e-42  35%  332 aa  NUOH_CAMJD RecName: Full=NADH-quinone oxidoreductase subunit H;    
   36::341     3e-42  35%  347 aa  NUOH1_RHIEC RecName: Full=NADH-quinone oxidoreductase subunit H 1; 
   29::321     4e-42  36%  328 aa  NU1M_MARPO RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   38::333     5e-42  35%  341 aa  NUOH1_RHOPA RecName: Full=NADH-quinone oxidoreductase subunit H 1; 
   36::341     7e-42  35%  347 aa  NUOH_RHIL3 RecName: Full=NADH-quinone oxidoreductase subunit H;    
   46::354     9e-42  34%  449 aa  NUOH_NOCSJ RecName: Full=NADH-quinone oxidoreductase subunit H;    
   46::349     9e-42  32%  366 aa  NUOH_NITEU RecName: Full=NADH-quinone oxidoreductase subunit H;    
   22::347     9e-42  32%  357 aa  NUOH_BORPE RecName: Full=NADH-quinone oxidoreductase subunit H;    
   22::347     9e-42  32%  357 aa  NUOH_BORPA RecName: Full=NADH-quinone oxidoreductase subunit H;    
   22::347     9e-42  32%  357 aa  NUOH_BORBR RecName: Full=NADH-quinone oxidoreductase subunit H;    
   52::346     9e-42  38%  372 aa  NU1C_SYNPW RecName: Full=NAD(P)H-quinone oxidoreductase subunit 1; 
   34::308     1e-41  35%  335 aa  NUOH_PSEFS RecName: Full=NADH-quinone oxidoreductase subunit H;    
   39::339     1e-41  34%  356 aa  NUOH_CAUCR RecName: Full=NADH-quinone oxidoreductase subunit H;    
   36::333     1e-41  35%  341 aa  NUOH1_RHOPB RecName: Full=NADH-quinone oxidoreductase subunit H 1; 
   36::341     2e-41  34%  347 aa  NUOH_RHILW RecName: Full=NADH-quinone oxidoreductase subunit H;    
   42::324     2e-41  34%  349 aa  NUOH_AZOSB RecName: Full=NADH-quinone oxidoreductase subunit H;    
   51::339     2e-41  35%  449 aa  NUOH_FRASC RecName: Full=NADH-quinone oxidoreductase subunit H;    
   19::359     3e-41  34%  363 aa  NUOH_XYLFT RecName: Full=NADH-quinone oxidoreductase subunit H;    
   19::359     3e-41  34%  363 aa  NUOH_XYLF2 RecName: Full=NADH-quinone oxidoreductase subunit H;    
   38::330     3e-41  36%  337 aa  NUOH_PARL1 RecName: Full=NADH-quinone oxidoreductase subunit H;    
   37::338     3e-41  34%  340 aa  NUOH2_RHIEC RecName: Full=NADH-quinone oxidoreductase subunit H 2; 
   19::359     4e-41  34%  363 aa  NUOH_XYLFM RecName: Full=NADH-quinone oxidoreductase subunit H;    
   30::344     4e-41  33%  346 aa  NUOH_LEPIN RecName: Full=NADH-quinone oxidoreductase subunit H;    
   30::344     4e-41  33%  346 aa  NUOH_LEPIC RecName: Full=NADH-quinone oxidoreductase subunit H;    
    8::330     4e-41  32%  331 aa  NUOH_CAMHC RecName: Full=NADH-quinone oxidoreductase subunit H;    
   47::347     4e-41  33%  357 aa  NUOH_BORPD RecName: Full=NADH-quinone oxidoreductase subunit H;    
   38::341     4e-41  35%  348 aa  NUOH_AGRT5 RecName: Full=NADH-quinone oxidoreductase subunit H;    
   20::360     4e-41  36%  365 aa  NUOH2_CYTH3 RecName: Full=NADH-quinone oxidoreductase subunit H 2; 
   19::359     5e-41  34%  363 aa  NUOH_XYLFA RecName: Full=NADH-quinone oxidoreductase subunit H;    
   33::318     6e-41  34%  389 aa  NUOH_DEIGD RecName: Full=NADH-quinone oxidoreductase subunit H;    
   47::347     6e-41  33%  357 aa  NUOH_BORA1 RecName: Full=NADH-quinone oxidoreductase subunit H;    
   20::333     6e-41  33%  358 aa  NUOH_ACISJ RecName: Full=NADH-quinone oxidoreductase subunit H;    
   24::299     8e-41  34%  318 aa  NU1M_BOVIN RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   36::341     1e-40  34%  347 aa  NUOH_AGRRK RecName: Full=NADH-quinone oxidoreductase subunit H;    
   24::299     1e-40  34%  318 aa  NU1M_BOSIN RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   28::315     2e-40  38%  337 aa  NUOH_HALHL RecName: Full=NADH-quinone oxidoreductase subunit H;    
    8::299     2e-40  35%  318 aa  NU1M_FELCA RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   12::291     2e-40  34%  303 aa  NU1M_CABUN RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   31::327     4e-40  35%  330 aa  NUOH_CAMC5 RecName: Full=NADH-quinone oxidoreductase subunit H;    
   42::347     4e-40  35%  355 aa  NUOH_BRAJA RecName: Full=NADH-quinone oxidoreductase subunit H;    
   35::333     4e-40  34%  358 aa  NUOH_ACIAC RecName: Full=NADH-quinone oxidoreductase subunit H;    
    9::303     4e-40  35%  318 aa  NU1M_TOLMA RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   24::299     4e-40  33%  318 aa  NU1M_RHIUN RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   24::299     4e-40  36%  318 aa  NU1M_EMBAL RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   50::347     5e-40  32%  360 aa  NUOH_VEREI RecName: Full=NADH-quinone oxidoreductase subunit H;    
   24::299     7e-40  34%  318 aa  NU1M_HALGR RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   34::317     9e-40  34%  330 aa  NUOH_PSEMY RecName: Full=NADH-quinone oxidoreductase subunit H;    
   43::339     1e-39  31%  349 aa  NUOH_DECAR RecName: Full=NADH-quinone oxidoreductase subunit H;    
    3::344     1e-39  34%  352 aa  NUOH_ANAMM RecName: Full=NADH-quinone oxidoreductase subunit H;    
   19::387     1e-39  39%  393 aa  NUOH2_SOLUE RecName: Full=NADH-quinone oxidoreductase subunit H 2; 
   40::339     1e-39  34%  356 aa  NUOH_MARMM RecName: Full=NADH-quinone oxidoreductase subunit H;    
    2::321     1e-39  32%  323 aa  NUOH_BLOPB RecName: Full=NADH-quinone oxidoreductase subunit H;    
   16::331     1e-39  33%  339 aa  NUOH_ALHEH RecName: Full=NADH-quinone oxidoreductase subunit H;    
   24::299     1e-39  34%  318 aa  NU1M_BALPH RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   27::312     2e-39  36%  325 aa  NU1M_PETHY RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   36::320     3e-39  34%  322 aa  NUOH_BUCBP RecName: Full=NADH-quinone oxidoreductase subunit H;    
   28::328     4e-39  35%  343 aa  NUOH_THIDA RecName: Full=NADH-quinone oxidoreductase subunit H;    
   46::329     4e-39  34%  354 aa  NUOH_BURP8 RecName: Full=NADH-quinone oxidoreductase subunit H;    
    1::313     6e-39  32%  319 aa  NUOH2_RHOPA RecName: Full=NADH-quinone oxidoreductase subunit H 2; 
   24::299     7e-39  33%  318 aa  NU1M_BOSMU RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   24::299     1e-38  34%  318 aa  NU1M_PHOVI RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
    9::299     1e-38  33%  318 aa  NU1M_HIPAM RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   35::330     1e-38  34%  365 aa  NQO8_THET8 RecName: Full=NADH-quinone oxidoreductase subunit 8;    
   31::310     1e-38  35%  332 aa  NUOH_CAMJR RecName: Full=NADH-quinone oxidoreductase subunit H;    
   31::310     1e-38  35%  332 aa  NUOH_CAMJJ RecName: Full=NADH-quinone oxidoreductase subunit H;    
   31::310     1e-38  35%  332 aa  NUOH_CAMJE RecName: Full=NADH-quinone oxidoreductase subunit H;    
   31::310     1e-38  35%  332 aa  NUOH_CAMJ8 RecName: Full=NADH-quinone oxidoreductase subunit H;    
   35::330     2e-38  34%  365 aa  NQO8_THET2 RecName: Full=NADH-quinone oxidoreductase subunit 8;    
   24::299     3e-38  34%  318 aa  NU1M_ELEMA RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   46::349     4e-38  31%  365 aa  NUOH_NITEC RecName: Full=NADH-quinone oxidoreductase subunit H;    
    9::303     4e-38  33%  318 aa  NU1M_PRIMA RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   15::327     5e-38  31%  329 aa  NUOH_WOLSU RecName: Full=NADH-quinone oxidoreductase subunit H;    
    1::296     6e-38  32%  319 aa  NUOH1_RHOP2 RecName: Full=NADH-quinone oxidoreductase subunit H 1; 
    8::299     6e-38  33%  318 aa  NU1M_TADIN RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   24::299     6e-38  33%  318 aa  NU1M_PIG RecName: Full=NADH-ubiquinone oxidoreductase chain 1;     
   29::320     8e-38  35%  346 aa  FPOH_METBF RecName: Full=F(420)H(2) oxidoreductase subunit
    5::299     1e-37  32%  318 aa  NU1M_SAGOE RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   35::330     1e-37  32%  344 aa  NUOH2_NITOC RecName: Full=NADH-quinone oxidoreductase subunit H 2; 
   23::299     1e-37  34%  318 aa  NU1M_MANTE RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   24::299     1e-37  32%  318 aa  NU1M_ATEPA RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   23::317     2e-37  31%  322 aa  NUOH_BLOFL RecName: Full=NADH-quinone oxidoreductase subunit H;    
   49::361     2e-37  35%  413 aa  NUOH_ANADE RecName: Full=NADH-quinone oxidoreductase subunit H;    
    9::299     2e-37  35%  318 aa  NU1M_NYCCO RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
    9::312     2e-37  33%  318 aa  NU1M_ZAEPI RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
    1::296     3e-37  31%  319 aa  NUOH1_RHOPS RecName: Full=NADH-quinone oxidoreductase subunit H 1; 
   13::411     4e-37  37%  426 aa  NUOH1_ACIBL RecName: Full=NADH-quinone oxidoreductase subunit H 1; 
    9::299     5e-37  32%  318 aa  NU1M_SHEEP RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
    7::302     5e-37  33%  318 aa  NU1M_MYRTR RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
    9::299     5e-37  33%  318 aa  NU1M_EUPSX RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   23::296     5e-37  33%  317 aa  NU1M_CANAL RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   36::320     7e-37  34%  322 aa  NUOH_BUCAP RecName: Full=NADH-quinone oxidoreductase subunit H;    
   24::299     7e-37  34%  318 aa  NU1M_BALMU RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   24::314     9e-37  31%  318 aa  NU1M_EPTNI RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   24::299     9e-37  33%  318 aa  NU1M_CANLU RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   24::299     9e-37  33%  318 aa  NU1M_CANFA RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   23::359     2e-36  31%  363 aa  NUOH_XANAC RecName: Full=NADH-quinone oxidoreductase subunit H;    
   24::299     3e-36  33%  318 aa  NU1M_RABIT RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   23::303     3e-36  33%  322 aa  NUOH_BUCAI RecName: Full=NADH-quinone oxidoreductase subunit H;    
   24::299     4e-36  33%  318 aa  NU1M_LONTH RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   24::299     4e-36  34%  318 aa  NU1M_HORSE RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   24::299     4e-36  32%  318 aa  NU1M_CERSI RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   75::359     6e-36  33%  363 aa  NUOH_XANC5 RecName: Full=NADH-quinone oxidoreductase subunit H;    
   36::328     6e-36  32%  333 aa  NUOH_GEOSW RecName: Full=NADH-quinone oxidoreductase subunit H;    
   24::299     6e-36  33%  318 aa  NU1M_LOXAF RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   23::299     6e-36  35%  318 aa  NU1M_LEMCA RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   24::299     6e-36  34%  318 aa  NU1M_EQUAS RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   23::359     8e-36  31%  363 aa  NUOH_XANOR RecName: Full=NADH-quinone oxidoreductase subunit H;    
   23::359     8e-36  31%  363 aa  NUOH_XANOP RecName: Full=NADH-quinone oxidoreductase subunit H;    
    9::299     8e-36  32%  318 aa  NU1M_CHODI RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   24::299     8e-36  33%  318 aa  NU1M_BRAVA RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   23::359     1e-35  32%  363 aa  NUOH_XANCP RecName: Full=NADH-quinone oxidoreductase subunit H;    
   23::359     1e-35  32%  363 aa  NUOH_XANCB RecName: Full=NADH-quinone oxidoreductase subunit H;    
   23::359     1e-35  32%  363 aa  NUOH_XANC8 RecName: Full=NADH-quinone oxidoreductase subunit H;    
   23::303     1e-35  32%  322 aa  NUOH_BUCAT RecName: Full=NADH-quinone oxidoreductase subunit H;    
   23::303     1e-35  32%  322 aa  NUOH_BUCA5 RecName: Full=NADH-quinone oxidoreductase subunit H;    
   18::291     1e-35  32%  301 aa  NU1M_NYCNO RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   30::320     2e-35  33%  324 aa  NU1M_DANRE RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   24::299     3e-35  32%  318 aa  NU1M_DASKA RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
    8::303     4e-35  31%  318 aa  NU1M_DASNO RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   24::299     5e-35  30%  318 aa  NU1M_PERGU RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   48::348     6e-35  31%  357 aa  NUOH_VESOH RecName: Full=NADH-quinone oxidoreductase subunit H;    
    9::299     8e-35  32%  318 aa  NU1M_HIPTE RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   24::299     1e-34  32%  318 aa  NU1M_MAMPR RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   24::299     1e-34  31%  318 aa  NU1M_PHACI RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   29::304     2e-34  30%  323 aa  NU1M_XENLA RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   13::307     2e-34  31%  323 aa  NU1M_LATCH RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
    9::344     3e-34  33%  354 aa  NUOH_THICR RecName: Full=NADH-quinone oxidoreductase subunit H;    
   30::351     3e-34  33%  369 aa  NU1M_ACACA RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   48::348     4e-34  31%  357 aa  NUOH_RUTMC RecName: Full=NADH-quinone oxidoreductase subunit H;    
   24::299     5e-34  33%  318 aa  NU1M_TAMSI RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
    3::299     5e-34  31%  318 aa  NU1M_SAGLE RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
    6::333     9e-34  32%  343 aa  NU1M_TRIRU RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
    8::299     9e-34  31%  318 aa  NU1M_DUGDU RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   28::305     1e-33  33%  324 aa  NU1M_RANCA RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
    8::314     2e-33  30%  318 aa  NU1M_MURSU RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   26::296     2e-33  33%  318 aa  NUOH2_RHOS4 RecName: Full=NADH-quinone oxidoreductase subunit H 2; 
   24::299     2e-33  34%  318 aa  NU1M_RAT RecName: Full=NADH-ubiquinone oxidoreductase chain 1;     
   26::296     3e-33  33%  318 aa  NUOH2_RHOS1 RecName: Full=NADH-quinone oxidoreductase subunit H 2; 
   24::299     3e-33  30%  318 aa  NU1M_TRIVU RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
    7::299     3e-33  31%  318 aa  NU1M_CYCDI RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
    9::302     8e-33  30%  318 aa  NU1M_PANTR RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   39::313     1e-32  33%  339 aa  NUOH_METFK RecName: Full=NADH-quinone oxidoreductase subunit H;    
   24::302     2e-32  32%  318 aa  NU1M_PAPHA RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   24::297     2e-32  30%  318 aa  NU1M_NYCVE RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
    9::299     2e-32  30%  318 aa  NU1M_CEBAP RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   24::299     2e-32  32%  318 aa  NU1M_COEFR RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   23::359     3e-32  30%  363 aa  NUOH_XANOM RecName: Full=NADH-quinone oxidoreductase subunit H;    
    9::299     4e-32  31%  318 aa  NU1M_HIPDI RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   24::299     5e-32  30%  318 aa  NU1M_DIDMA RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   30::305     5e-32  30%  324 aa  NU1M_CROLA RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   24::299     7e-32  31%  318 aa  NU1M_PHYEO RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   24::299     7e-32  32%  318 aa  NU1M_MOUSE RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   30::305     9e-32  32%  324 aa  NU1M_CARAU RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   14::313     1e-31  30%  324 aa  NU1M_SQUAC RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   28::308     1e-31  34%  321 aa  NU1M_VARBA RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   24::299     1e-31  30%  318 aa  NU1M_NOTTY RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   27::305     2e-31  32%  320 aa  NU1M_VARJO RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   30::305     2e-31  32%  324 aa  NU1M_CYPCA RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
    8::325     3e-31  32%  331 aa  NUOH_CAMC1 RecName: Full=NADH-quinone oxidoreductase subunit H;    
    8::314     3e-31  29%  318 aa  NU1M_MURFL RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   30::305     4e-31  32%  324 aa  NU1M_SCYCA RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   24::302     7e-31  29%  318 aa  NU1M_HYLLA RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   23::284     7e-31  33%  312 aa  NU1M_DEBHA RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   24::299     1e-30  30%  318 aa  NU1M_TAPME RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
    7::302     2e-30  30%  318 aa  NU1M_TAMTE RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   29::338     2e-30  33%  367 aa  NU1M_PODAN RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   31::306     2e-30  31%  324 aa  NU1M_COTCH RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   16::327     3e-30  29%  328 aa  NUOH_SULDN RecName: Full=NADH-quinone oxidoreductase subunit H;    
   26::305     4e-30  30%  321 aa  NU1M_PETMA RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   28::300     5e-30  31%  319 aa  NU1M_POLOR RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   24::299     6e-30  30%  318 aa  NU1M_VOMUR RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   24::299     6e-30  29%  318 aa  NU1M_PTEGI RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   28::288     8e-30  32%  312 aa  NU1M_DROSU RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   14::308     1e-29  30%  324 aa  NU1M_TETNG RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   12::303     1e-29  31%  322 aa  NU1M_PELSU RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   30::307     1e-29  29%  321 aa  NU1M_DINSE RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   28::306     2e-29  31%  321 aa  NU1M_VARDU RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   28::288     2e-29  31%  324 aa  NU1M_DROYA RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   27::305     5e-29  29%  305 aa  NU1M_MYTED RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   30::307     2e-28  29%  323 aa  NU1M_GADMO RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
    5::295     3e-28  31%  314 aa  NU1M_ANOQU RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
    1::302     3e-28  26%  318 aa  NU1M_MYXGL RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
    9::302     3e-28  30%  318 aa  NU1M_GORGO RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   25::308     5e-28  31%  318 aa  NU1M_VARRU RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   24::297     5e-28  29%  318 aa  NU1M_TACAC RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   27::304     5e-28  32%  308 aa  NU1M_LUMTE RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   24::299     6e-28  29%  318 aa  NU1M_SMIMA RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   25::313     8e-28  32%  341 aa  NU1M_YARLI RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   24::299     8e-28  29%  318 aa  NU1M_MACEU RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   30::358     1e-27  31%  371 aa  NU1M_NEUCR RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   31::306     2e-27  30%  324 aa  NU1M_COTJA RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   23::284     2e-27  32%  298 aa  NU1M_ARTSF RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   24::299     2e-27  29%  318 aa  NU1M_SMICR RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   30::305     3e-27  29%  324 aa  NU1M_STRCA RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   44::274     3e-27  36%  292 aa  NU1M_CHLRE RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   26::305     4e-27  30%  321 aa  NU1M_LAMFL RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   31::306     4e-27  29%  324 aa  NU1M_CHICK RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
  115::299     5e-27  35%  318 aa  NU1M_MONDO RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
    9::302     9e-27  28%  318 aa  NU1M_HUMAN RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   12::285     2e-26  29%  303 aa  NU1M_ZAGBR RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
  125::305     9e-26  35%  324 aa  NU1M_THYAR RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
  115::299     1e-25  33%  318 aa  NU1M_DIAYO RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
  119::297     2e-25  34%  318 aa  NU1M_ORNAN RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   24::302     2e-25  27%  318 aa  NU1M_PONAB RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   27::310     2e-25  31%  313 aa  NU1M_LOLBL RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
  125::297     3e-25  37%  324 aa  NU1M_SALSA RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   26::304     4e-25  30%  319 aa  NU1M_VARFL RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   24::290     4e-25  26%  310 aa  NU1M_DALCH RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   28::301     5e-25  30%  322 aa  NU1M_STRPU RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   24::302     1e-24  27%  318 aa  NU1M_PONPY RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
  119::313     2e-24  37%  323 aa  NU1M_PARLI RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   29::296     2e-24  30%  323 aa  NU1M_ONCMY RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   28::288     3e-24  28%  312 aa  NU1M_DROME RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
  115::299     4e-24  31%  318 aa  NU1M_MACRU RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   24::299     5e-24  27%  318 aa  NU1M_SARHA RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   28::294     7e-24  30%  313 aa  NU1M_AEDAE RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   30::295     3e-23  28%  313 aa  NU1M_LOCMI RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
    5::295     4e-23  29%  314 aa  NU1M_ANOGA RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   24::299     6e-23  27%  318 aa  NU1M_MACRO RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
    6::245     2e-22  29%  261 aa  NU1M_PARTE RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   26::323     8e-22  30%  351 aa  NU1M_PICCA RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   26::286     2e-21  28%  313 aa  NU1M_BRALA RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   26::286     2e-21  28%  313 aa  NU1M_BRAFL RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
  118::300     1e-20  29%  321 aa  NU1M_ALLMI RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   25::282     2e-20  26%  305 aa  NU1M_APILI RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   28::296     7e-18  25%  326 aa  NU1M_ASTPE RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   24::286     1e-17  27%  299 aa  NU1M_ALBCO RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
  100::286     9e-16  26%  313 aa  NU1M_RHISA RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   26::278     1e-14  26%  290 aa  NU1M_ASCSU RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   64::272     7e-13  28%  354 aa  NU1M_PECMA RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   35::222     7e-13  28%  291 aa  NU1M_CAEBR RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   35::222     2e-11  26%  291 aa  NU1M_CAEEL RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
  106::269     5e-11  33%  316 aa  NU1M_CITLA RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   28::308     9e-11  23%  324 aa  NU1M_PISOC RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   28::161     1e-10  28%  163 aa  NU1M_DROBF RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   28::161     2e-10  30%  163 aa  NU1M_DROTR RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   28::161     2e-10  30%  163 aa  NU1M_DROSS RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   28::161     2e-10  30%  163 aa  NU1M_DROPE RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   28::161     2e-10  30%  163 aa  NU1M_DROPB RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   28::161     2e-10  30%  163 aa  NU1M_DROOB RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   28::161     2e-10  30%  163 aa  NU1M_DROMI RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   28::161     2e-10  30%  163 aa  NU1M_DROMD RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   28::161     2e-10  30%  163 aa  NU1M_DROAZ RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   28::161     2e-10  30%  163 aa  NU1M_DROAM RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   28::161     2e-10  30%  163 aa  NU1M_DROAL RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   28::161     2e-10  30%  163 aa  NU1M_DROAI RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   28::161     4e-09  28%  163 aa  NU1M_DROGU RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
    1::84      3e-07  38%  130 aa  NU1M_ARTSA RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   33::217     8e-06  28%  307 aa  HYCD_ECOLI RecName: Full=Formate hydrogenlyase subunit 4;       
  206::270     3e-05  37%  313 aa  NU1M_LEITA RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
   26::95      2e-04  33%  127 aa  NU1M_ASTFO RecName: Full=NADH-ubiquinone oxidoreductase chain 1;   
    1::357

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxQLFPEFLVDTFGLPGVLGEVVASLIGAALVANIILAFSGIAGPWAKRKITAAFTDRIAVNRIGP
NUOH_DEHSC      -------------------------------------------------WLERRLIGRFQLRPGPNRAGP
NUOH_DEHE1      -------------------------------------------------WLERRFIGRFQLRPGPNRAGP
NUOH_RHOSR      -----------------------------VLGKALAIFVFLVLTPLLTILAERKVMAWMQMRVGPNRVGP
NUOH_MOOTA      -------------------------------------------------YLERKISAYMQQRIGPNRLGP
NUOH_MYCVP      ----------------------------------------LLLTVLAAILIERKVLGRMQLRFGPNRVGP
NUOH_MYCSS      ---------------------------------------------------ERKVLGRMQMRFGPNRVGP
NUOH_MYCSK      ---------------------------------------------------ERKVLGRMQMRFGPNRVGP
NUOH_MYCSJ      ---------------------------------------------------ERKVLGRMQMRFGPNRVGP
NU1C_PLEBO      ---------------------------------------------------ERKISAAAQQRIGPEFIGP
NUOH_MYCGI      ---------------------------------------------------ERKILGRMQLRLGPNRVGP
NUOH_BREBN      ---------------------------------------------------ERKVIGWMQLRIGPNRVGP
NUOHI_NOCFA     --------------------------------------------------AERKVVARMQMRVGPNRVGP
NUOH2_GEOMG     -------------------------------------------------YAERKIIGHMQVRLGPMRTGW
NU1C_CYAP4      -------------------------------------------------WLERKISAAAQQRIGPEYIGP
NUOH_MYCS2      -----------------------------MLAKAVAIFVFLLLTVLSAILIERKLLGRMQMRFGPNRVGP
NUOH_CARHZ      ----------------------------------------------------RKFGAWVQARLGPNRVGP
NU1C_SYNP6      -------------------------------------------------WLERKISAAVQQRIGPEYAGP
NU1C_SYNE7      -------------------------------------------------WLERKISAAVQQRIGPEYAGP
NU1C_ACAM1      -------------------------------------------------WLERKISAAAQQRIGPEYIGP
NU1C_SYNJB      -------------------------------------------------WLERKISAAAQQRIGPNMAGP
NU1C_PROMS      ---------------------------------------------------ERKISAAAQQRIGPEYAGA
NU1C_PROMP      ---------------------------------------------------ERKISAAAQQRIGPEYAGA
NU1C_SYNJA      -------------------------------------------------WLERKISAAAQQRIGPNMAGP
NU1C_PROM9      ---------------------------------------------------ERKISAAAQQRIGPEYAGA
NU1C_PROM2      ---------------------------------------------------ERKISAAAQQRIGPEYAGA
NU1C_PROM0      ---------------------------------------------------ERKISAAAQQRIGPEYAGA
NUOH1_GEOSL     -------------------------------------------------YAERKIIGHMQVRLGPMRTGW
NU1C_SYNY3      ----------------FGLPPGLAKLILMIIGATVGVLVVV--------WLERKISAAAQQRIGPEYAGP
NU1C_NOSP7      --------FIESLRD-LGIPA--GTAKAIWMPLPMILMLIGATVGVVATWLERKISASAQQRIGPEYQGP
NUOH_BACCR      -----------------------------------------------GILAERKVMGFMQGRIGPNQVGG
NUOH_BACC4      -----------------------------------------------GILAERKVMGFMQGRIGPNQVGG
NUOH_BACC2      -----------------------------------------------GILAERKVMGFMQGRIGPNQVGG
NUOH_BACCZ      -----------------------------------------------GILAERKVMGFMQGRIGPNQVGG
NUOH_BACCQ      -----------------------------------------------GILAERKVMGFMQGRIGPNQVGG
NUOH_BACC7      -----------------------------------------------GILAERKVMGFMQGRIGPNQVGG
NUOH_BACC3      -----------------------------------------------GILAERKVMGFMQGRIGPNQVGG
NUOH_BACC1      -----------------------------------------------GILAERKVMGFMQGRIGPNQVGG
NUOH_BACC0      -----------------------------------------------GILAERKVMGFMQGRIGPNQVGG
NUOH_BACAN      -----------------------------------------------GILAERKVMGFMQGRIGPNQVGG
NUOH_BACAH      -----------------------------------------------GILAERKVMGFMQGRIGPNQVGG
NUOH_BACAC      -----------------------------------------------GILAERKVMGFMQGRIGPNQVGG
NUOH_BACAA      -----------------------------------------------GILAERKVMGFMQGRIGPNQVGG
NU1C_CHLAT      -------------------------ILVVIVGATIGVLVIV--------WLERKISAGVQQRIGPEFAGP
NUOH_BACHK      -----------------------------------------------GILAERKVMGFMQGRIGPNQVGG
NUOH_BACWK      -----------------------------------------------GILAERKVMGFMQGRIGPNQVGG
NUOH_PELCD      --------------------------------------------------AERKILGRMQMRYGPNRVGW
NUOH_MAGSA      -------------------------------------------------YAERKVIGAMQLRKGPNVVGP
NUOH_ANOFW      -----------------------------------------------GILAERKVMGFMQGRIGPNQVGG
NU1C_NEPOL      -------------------------------------------------WLERKISAGVQQRVGPEYGGA
NU1C_MICAN      -----------------GLSGGLAKAIWMPLPMFLM--IIAATVGVVCVWLERKISAAVQQRIGPEYAGP
NU1C_ANASP      -------------------------------------------------WLERKISAAAQQRIGPEYIGP
NUOH2_GEOSL     ---------------------------------ALIFFVVLTLAAYL-VFAERRLLAWIQDRKGPNRVGP
NUOH_BACCN      -----------------------------------------------GILAERKVMGFMQGRVGPNQVGG
NUOH_DESPS      -------------------------------------------------WAERRGAAFIQRRLGPVENGP
NU1C_PROM5      ---------------------------------------------------ERKISAAAQQRIGPEYAGA
NUOH_PARUW      ---------------------MIDDLIIILIKSAVV--ILLLFTAAAYTFLERIVMARLQLRMGPVRVGP
NUOH_BACV8      ------------------LTSFMPEELAVLIECIVIGVIMLAYAVIAMIFMERKVCAAFQCRLGPMRVGP
NUOH_GEOKA      -----------------------------------------------GILAERKVMGFMQGRIGPNQVGG
NUOH1_SYNFM     --------------------------------------IILAFSQLNAVWLERKVAGRIQLRPGPMEVGP
NUOH_ACIC1      -------------------------------------------------WAERRVVARMQQRIGPNRVGP
NU1C_SYNP2      -------------------------------------------------WLERKISAAAQQRVGPEYAGP
NUOH_RHORT      -------------------------------------------------YAERKVIGAMQMRKGPNVVGP
NUOH1_NITMU     -------------------------------------------------WIERRLLGLWQDRYGPNRVGP
NU1C_CHAVU      -------------------------------------------------WLERKISAAVQQRIGPEYAGS
NQO8_RHOMR      --------------------------------AFLIINAMLLTASVL-VYAERKISGFIQHRLGPNRVGP
NUOH_PSEPW      -------------------------------------------------FVERRLLGWWQDRYGPNRVGP
NUOH_PSEPG      -------------------------------------------------FVERRLLGWWQDRYGPNRVGP
NUOH_RICCN      -------------------------IIIALKVVAITIPLILCVAYLT--YAERRVIGLMQLRRGPNVVGP
NUOH_CHRSD      ---------------------------------------------------ERRLLGLWQDRHGPNRVGP
NU1C_CYAA5      -------------------------------------------------WLERKISAAAQQRIGPEYAGP
NUOH_PSEPK      -------------------------------------------------FVERRLLGWWQDRYGPNRVGP
NUOH_PSEP1      -------------------------------------------------FVERRLLGWWQDRYGPNRVGP
NUOH_ACIAD      ---------------------------------------------------ERRLLAWWQDRYGPNRVGP
NUOH_CHLCH      -----------------------GLPVGLLIIAAIPLVFIALYALTYGVYGERKISAFMQDRLGPMEVGK
NUOH1_GEOMG     ------------------------DIAIHLAKIALIFFVVLTLAAYL-VFAERRILAWIQDRKGPNRVGP
NU1C_ANTFO      -------------------------------------------------WLERKISAGIQQRIGPEYAGP
NUOH_MAGSM      ----------------------LGETLWTLVWTILKIAVLIAFCVTYLTLAERRLIGFMQVRLGPNRVGV
NUOH_AQUAE      --------------------------------------IVIVFSLALGTWFERKLAGHIQNRLGPTVVGK
NUOH1_NITOC     -------------------------------------------------WIERRLLGFWQERYGPNRVGP
NUOH_PSEE4      -------------------------------------------------FVERRLLGWWQDRYGPNRVGP
NUOH_CHLPD      ----------------WGFP--LGLVILAAIPLVFIALYALTY----GVYGERKISAFMQDRLGPMEVGK
NU1C_JASNU      -------------------------------------------------WLEREISAGIQQRIGPEYAGP
NU1C_ANGEV      -------------------------------------------------WLERKISAGIQQRIGPEYAGP
NUOH_ACIBT      ---------------------------------------------------ERRLLAWWQDRYGPNRVGP
NU1C_GLOVI      ----------------------------------------------AAVWGERKWSGMMQQRMGPTIIGL
NUOH_PSYCK      ---------------------------------------------------ERRMLALWQDRYGPNRVGP
NU1C_MAIZE      ----------ELFKEIYGLIWIL-PIFALLLGITIEVLVIV--------WLEREISASIQQRIGPEYAGP
NUOH_PSYA2      ---------------------------------------------------ERRMLALWQDRYGPNRVGP
NUOH1_CYTH3     -----------------------------IVTAVFTISLVIA---MYSTYAERKVSALLQDRIGPNRAGP
NU1C_CYAP7      -------------------------------------------------WLERKISAAAQQRIGPEYAGP
NUOH_PSESM      -------------------------------------------------FVERRLLGWWQDRYGPNRVGP
NUOH_PSEF5      -------------------------------------------------FVERRLLGWWQDRYGPNRVGP
NUOH_PSEU2      ---------------------------------------------------ERRLLGWWQDRYGPNRVGP
NUOH_PSE14      ---------------------------------------------------ERRLLGWWQDRYGPNRVGP
NU1C_CYAP8      -------------------------------------------------WLERKISAAAQQRIGPEYAGP
NU1C_CUCSA      -------------------------------------------------WLEREISAGIQQRIGPEYAGP
NUOH_RALEH      -----------------GLLGAYWTPLWILIRAVIIVVPLLLCVAYLILW-ERKLIGWMHVRIGPNRVGP
NU1C_STAPU      -------------------------------------------------WLERKISAAVQQRIGPEYAGP
NUOH_RHOCS      ----------------YGVPGAI--IVAQIL--ALMVPILVSVAFLV--YAERKVLGLMQLRQGPNMVGP
NUOH_ORITI      -------------------------------------------------FAERKVIAYMQLRVGPSLAGP
NUOH_DINSH      -------------------PGIAVLIIAAVLGFVMVSLLFLVYGD-------RKIWAAVQMRRGPNVVGA
NUOH_DESHY      ---------------------------------------------------ERKIAGWGSQRPGPNRLGP
NU1C_LOTJA      ----------ESFKEVYGVLWVLAPILIIVLG--------ITISVLAIVWLEREISAGMQQRIGPEYAGP
NUOH_PELLD      -----------------GLP--LGLLVIAAIPLVFIALYALTY----GVYGERKISAFMQDRLGPMEVGK
NUOH_ORITB      -------------------------------------------------FAERKVIAYMQLRVGPSLAGP
NUOH_GRABC      ---------------------------------------------------ERKVLAAIGLRKGPNVVGP
NU1C_POPTR      -------------------------------------------------WLEREISAGIQQRIGPEYAGP
NUOH_PSEPF      -------------------------------------------------FVERRLLGWWQDRYGPNRVGP
NUOH_BACTN      ------------------------------VGVCIVA--LYAILAIVLIYMERKVCGFFQCRLGPNRVGK
NUOH_GEOTN      --------------------------------------------------AERKVMGFMQGRIGPNQVGG
NU1C_POPAL      -------------------------------------------------WLEREISAGIQQRIGPEYAGP
NU1C_ORYSJ      -------------------------------------------------WLEREISASIQQRIGPEYAGP
NU1C_ORYSI      -------------------------------------------------WLEREISASIQQRIGPEYAGP
NU1C_ORYSA      -------------------------------------------------WLEREISASIQQRIGPEYAGP
NU1C_ORYNI      -------------------------------------------------WLEREISASIQQRIGPEYAGP
NUOH_NITWN      ----------------------------------------------------RKIWAAVQIRRGPNVVGP
NUOH_LEPBP      -------------------------------GIKILSLFFVILTGVAYTLAERKFAGFIQDRPGPNRAGP
NUOH_LEPBA      -------------------------------GIKILSLFFVILTGVAYTLAERKFAGFIQDRPGPNRAGP
NU1C_TOBAC      -------------------------------------------------WLEREISAGIQQRIGPEYAGP
NU1C_SACOF      -------------------------------------------------WLEREISASIQQRIGPEYAGP
NU1C_SACHY      -------------------------------------------------WLEREISASIQQRIGPEYAGP
NUOH_RICPR      --------------------------VIALKVVAITIPLILCVAYLT--YAERRVIGLMQLRRGPNVVGP
NUOH_RALME      -----------------------------LIRAVLIVVPVLLCVAYLILW-ERKLIGWMHVRIGPNRVGP
NUOH_RALEJ      -----------------------------LIRAVLIVVPLLLCVAYLILW-ERKLIGWMHVRLGPNRVGP
NUOH_EHRRW      -------------------------------------------------YMERKVIAAIQLRQGPSVVGP
NUOH_EHRRG      -------------------------------------------------YMERKVIAAIQLRQGPSVVGP
NUOH_CUPTR      ---------------------------------------------------ERKLIGWMHVRIGPNRVGP
NUOH_RICCK      -------------------------IIIALKVVAITVPLILCVAYLT--YVERRVIGLMQLRRGPNVVGP
NUOH_FLAPJ      -------------------------------------------------WAERKVAAFLQDRVGPNRAGW
NU1C_CYCTA      ---------------------------------------------------ERKISAGIQQRIGPEYAGP
NUOH_RICB8      -------------------------IIIALKVVAITIPLILCVAYLT--YAERRVIGLMQLRCGPNVVGP
NUOH_RHILO      -------------------------------------------------YADRKIWAAVQLRRGPNVVGP
NUOH_MYCTU      ---------------------------------AIAVFVFLMLTVLVAILAERKLLGRMQLRPGPNRVGP
NUOH_MYCTA      ---------------------------------AIAVFVFLMLTVLVAILAERKLLGRMQLRPGPNRVGP
NUOH_MYCBT      ---------------------------------AIAVFVFLMLTVLVAILAERKLLGRMQLRPGPNRVGP
NUOH_MYCBP      ---------------------------------AIAVFVFLMLTVLVAILAERKLLGRMQLRPGPNRVGP
NUOH_MYCBO      ---------------------------------AIAVFVFLMLTVLVAILAERKLLGRMQLRPGPNRVGP
NU1C_SPIOL      -------------------------------------------------WLEREISASIQQRIGPEYAGP
NU1C_LACSA      -------------------------------------------------WLEREISAGIQQRIGPEYAGP
NUOH2_RHOPB     -----------------------------MIGMALTAIIIMVLLVVAGTWVERRVLGFVQERLGPNRVGP
NUOH_RICBR      -------------------------IIIALKVVAITIPLILCVAYLT--YAERRVIGLMQLRRGPNVVGP
NUOH_MYCUA      -----------------------------VVAKAIAIFVFLMLTVLVAILAERKLLGRMQLRPGPNRVGP
NUOH_BARQU      -------------------------------------------------YADRKIWAAVQLRRGPNVVGP
NUOH_BARHE      -------------------------------------------------YADRKIWAAVQLRRGPNVVGP
NUOH_AZOSE      ---------------------------------AIIAPLMLCVAYLT--LAERKVIGYMQVRIGPNRVGP
NU1C_HORVU      -------------------------------------------------WLEREISASIQQRIGPEYAGP
NU1C_WHEAT      -------------------------------------------------WLEREISASIQQRIGPEYAGP
NUOH_THERP      -------------------------------------------------WFERRVLARMQHRVGPNRTGP
NUOH_SPHAL      --------------------------LATVAGILLIAPLMLAVAMII--YADRKIWAAIALRRGPNVVGP
NUOH_RICFE      -------------------------IIIALKVVAITIPLILCVAYLT--YAERRVIGLMQLRRGPNVVGP
NUOH_HELAH      -------------------------IIETLIKILILVAVFSALGGFA-TYIERKVLAYFQRRLGPSYVGP
NUOH_BURXL      ---------------------------------------------------ERKLIGWMHVRLGPNRVGP
NU1C_VITVI      ----------EYLKEVYGIIWMLVPIFTPVLGITIGVLAIV--------WLEREISAGIQQRIGPEYAGP
NU1C_PELHO      -------------------------------------------------WLEREISAGIQQRIGPEYAGP
NUOH_CITK8      -------------------------------------------------FGERRLLGLFQNRYGPNRVGW
NUOH_HELPY      -------------------------IIETLIKILILVAVFSALGGFA-TYIERKVLAYFQRRLGPCYVGP
NU1C_MORIN      -------------------------------------------------WLEREISAGIQQRIGPEYAGP
NU1C_DRIGR      ----------ESLKEGYGLIGMLVPIFTPVSGITIGVLVIV--------WLEREISAGIQQRIGPEYAGP
NUOH_SALTY      -------------------------------------------------FGERRLLGLFQNRYGPNRVGW
NUOH_SALPC      -------------------------------------------------FGERRLLGLFQNRYGPNRVGW
NUOH_SALPB      -------------------------------------------------FGERRLLGLFQNRYGPNRVGW
NUOH_SALPA      -------------------------------------------------FGERRLLGLFQNRYGPNRVGW
NUOH_SALNS      -------------------------------------------------FGERRLLGLFQNRYGPNRVGW
NUOH_SALDC      -------------------------------------------------FGERRLLGLFQNRYGPNRVGW
NUOH_SALCH      -------------------------------------------------FGERRLLGLFQNRYGPNRVGW
NUOH_SALA4      -------------------------------------------------FGERRLLGLFQNRYGPNRVGW
NUOH_RICRS      -------------------------IIIALKVVAITIPLILCVAYLT--YAERRVIGLMQLRRGPNVVGP
NUOH_RICRO      -------------------------IIIALKVVAITIPLILCVAYLT--YAERRVIGLMQLRRGPNVVGP
NUOH_ESCF3      -------------------------------------------------FGERRLLGLFQNRYGPNRVGW
NUOH_ENTS8      -------------------------------------------------FGERRLLGLFQNRYGPNRVGW
NU1C_GOSBA      -------------------------------------------------WLEREISAGIQQRIGPEYAGP
NU1C_ATRBE      -------------------------------------------------WLEREISAGIQQRIGPEYAGP
NUOH_SHISS      -------------------------------------------------FGERRLLGLFQNRYGPNRVGW
NUOH_SHIDS      -------------------------------------------------FGERRLLGLFQNRYGPNRVGW
NUOH_SHIBS      -------------------------------------------------FGERRLLGLFQNRYGPNRVGW
NUOH_SHIB3      -------------------------------------------------FGERRLLGLFQNRYGPNRVGW
NUOH_SALTI      -------------------------------------------------FGERRLLGLFQNRYGPNRVGW
NUOH_SALAR      -------------------------------------------------FGERRLLGLFQNRYGPNRVGW
NUOH_LEGPL      -------------------------------------------------YAERKVIGYIQVRIGPNRVGL
NUOH_ECOUT      -------------------------------------------------FGERRLLGLFQNRYGPNRVGW
NUOH_ECOSM      -------------------------------------------------FGERRLLGLFQNRYGPNRVGW
NUOH_ECOSE      -------------------------------------------------FGERRLLGLFQNRYGPNRVGW
NUOH_ECOLU      -------------------------------------------------FGERRLLGLFQNRYGPNRVGW
NUOH_ECOLI      -------------------------------------------------FGERRLLGLFQNRYGPNRVGW
NUOH_ECOLC      -------------------------------------------------FGERRLLGLFQNRYGPNRVGW
NUOH_ECOL6      -------------------------------------------------FGERRLLGLFQNRYGPNRVGW
NUOH_ECOL5      -------------------------------------------------FGERRLLGLFQNRYGPNRVGW
NUOH_ECOK1      -------------------------------------------------FGERRLLGLFQNRYGPNRVGW
NUOH_ECOHS      -------------------------------------------------FGERRLLGLFQNRYGPNRVGW
NUOH_ECODH      -------------------------------------------------FGERRLLGLFQNRYGPNRVGW
NUOH_ECOBW      -------------------------------------------------FGERRLLGLFQNRYGPNRVGW
NUOH_ECO8A      -------------------------------------------------FGERRLLGLFQNRYGPNRVGW
NUOH_ECO81      -------------------------------------------------FGERRLLGLFQNRYGPNRVGW
NUOH_ECO7I      -------------------------------------------------FGERRLLGLFQNRYGPNRVGW
NUOH_ECO5E      -------------------------------------------------FGERRLLGLFQNRYGPNRVGW
NUOH_ECO57      -------------------------------------------------FGERRLLGLFQNRYGPNRVGW
NUOH_ECO55      -------------------------------------------------FGERRLLGLFQNRYGPNRVGW
NUOH_ECO45      -------------------------------------------------FGERRLLGLFQNRYGPNRVGW
NUOH_ECO27      -------------------------------------------------FGERRLLGLFQNRYGPNRVGW
NUOH_ECO24      -------------------------------------------------FGERRLLGLFQNRYGPNRVGW
NUOH_BURTA      ---------------------------------------------------ERKLIGWMHVRLGPNRVGP
NU1C_GOSHI      -------------------------------------------------WLEREISAGIQQRIGPEYAGP
FPOH_METMA      ---------PEFIVPF--VPWIRGTVGLVLVGAIFLG-------GMAAVWIERKLSADIQLRYGPSRVGK
NUOH_RALSO      ---------------------------------------------------ERKLIGWMHVRVGPNRVGP
NUOH_HELPS      -------------------------IIETLIKILILVAVFSALGGFA-TYIERKVLAYFQRRLGPCYVGP
NUOH_HELPJ      -------------------------IIETLIKILILVAVFSALGGFA-TYIERKVLAYFQRRLGPCYVGP
NUOH_HELP2      -------------------------IIETLIKILILVAVFSALGGFA-TYIERKVLAYFQRRLGPCYVGP
NUOH_BURPP      ---------------------------------------------------ERKLIGWMHVRLGPNRVGP
NU1C_SYNS3      ---------------------------------------------------ERKISAAVQQRVGPEYAGA
NU1C_SOLTU      -------------------------------------------------WLEREISAGIQQRIGPEYAGP
NU1C_SOLBU      -------------------------------------------------WLEREISAGIQQRIGPEYAGP
NU1C_NICTO      -------------------------------------------------WLEREISAGIQQRIGPEYAGP
NU1C_ARATH      ---------------------------------------------------EREISAGIQQRIGPEYAGP
NU1C_ANAVT      -------------------------------------------------WLERKISAAAQQRIGPEYIGP
NUOH_NEOSM      -------------------------------------------------YAERKVIAATQLRVGPDLVGP
NUOH_LEGPH      -------------------------------------------------YAERKVIGYIQVRIGPNRVGL
NUOH_BURPS      ---------------------------------------------------ERKLIGWMHVRLGPNRVGP
NUOH_BURP6      ---------------------------------------------------ERKLIGWMHVRLGPNRVGP
NUOH_BURP1      ---------------------------------------------------ERKLIGWMHVRLGPNRVGP
NUOH_BURP0      ---------------------------------------------------ERKLIGWMHVRLGPNRVGP
NUOH_BURMA      ---------------------------------------------------ERKLIGWMHVRLGPNRVGP
NU1C_THEEB      --------------------------------------IVATVGVLVAVWLERKISAAVQQRIGPEYIGP
NU1C_PROMA      -------------------------------------------------WLERKISAAAQQRIGPEYAGA
NU1C_NYMAL      ---------------------------------------------------ERKISAGIQRRIGPEYAGP
NU1C_COFAR      -------------------------------------------------WLEREISAGIQQRIGPEYAGP
NU1C_CITSI      ----------ESLQEVYGILWVLAPISIYVLAITIGVLVIV--------WLEREISAGIQQRIGPEYASP
NUOH_RICPU      -------------------------IIIALKVVAITTPLILCVAYLT--YAERRVIGLMQLRRGPNVVGP
NUOH_RALPJ      ---------------------------------------------------ERKLIGWMHVRLGPNRVGP
NUOH_PECCP      ------------------------------VGKAIVILLVVVTCGAFMSMGERRLLGLFQGRYGPNRVGW
NUOH_MYCPA      -----------------------------MLGKALAIFVFLMLNVLVAILLERKILGWMQLRPGPNRVGP
NUOH_HELPH      -------------------------IIETLIKILILVAVFSALGGFA-TYIERKVLAYFQRRLGPCYVGP
NUOH_HELPG      -------------------------IIETLIKILILVAVFSALGGFA-TYIERKVLAYFQRRLGPCYVGP
NU1C_PANGI      -------------------------------------------------WLEREISAGIQQRIGPEYAGP
NU1C_DAUCA      -------------------------------------------------WLEREISAGIQQRIGPEYAGP
NUOH_SHIFL      -------------------------------------------------FGERRLLGLFQNRYGPNRVGW
NUOH_SHIF8      -------------------------------------------------FGERRLLGLFQNRYGPNRVGW
NUOH_PSYWF      ---------------------------------------------------ERRMLALWQDRYGPNRVGP
NUOH_PROMH      ---------------------------------------------------ERRLLGLFQNRYGPNRVGY
NUOH_OCHA4      -------------------------------------------------YADRKIWAAVQLRRGPNVVGP
NUOH_MYCA1      -----------------------------VLGKALAIFVFLMLNVLVAILLERKILGWMQLRPGPNRVGP
NUOH_BRUO2      -------------------------------------------------YADRKIWAAVQLRRGPNVVGP
NU1C_SOLLC      -------------------------------------------------WLEREISAGIQQRIGPEYAGP
NU1C_OLIPU      ---------------------------------------------------EREISAGIQQRIGPEYAGP
NU1C_NUPAD      ---------------------------------------------------ERKISAGIQRRIGPEYAGP
NU1C_NICSY      -------------------------------------------------WLEREISAGIQQRIGPEYAGP
NU1C_EUCGG      -------------------------------------------------WLEREISAGIQQRIGPEYAGP
NU1C_ARAHI      ---------------------------------SLVLGIITGVLVIA--WIERELSAGIQQRIGPEYAGP
NUOH_NEIMF      ---------------------------------------------------ERKVIGFMQLRVGPNVTGP
NUOH_CHLTE      ------------------------------LGLVIVAAIPLVFIALYGVYGERKISAFMQDRLGPMEVGF
NUOH_BURCM      ---------------------------------------------------ERKLIGWMHVRLGPNRVGP
NUOH_BURA4      ---------------------------------------------------ERKLIGWMHVRLGPNRVGP
NUOH_BRUSU      -------------------------------------------------YADRKIWAAVQLRRGPNVVGP
NUOH_BRUSI      -------------------------------------------------YADRKIWAAVQLRRGPNVVGP
NUOH_BRUME      -------------------------------------------------YADRKIWAAVQLRRGPNVVGP
NUOH_BRUMB      -------------------------------------------------YADRKIWAAVQLRRGPNVVGP
NUOH_BRUC2      -------------------------------------------------YADRKIWAAVQLRRGPNVVGP
NUOH_BRUAB      -------------------------------------------------YADRKIWAAVQLRRGPNVVGP
NUOH_BRUA2      -------------------------------------------------YADRKIWAAVQLRRGPNVVGP
NUOH_BACFR      ---------------------------------------------------ERKVCGFFQCRLGPNRVGK
NUOH_BACFN      ---------------------------------------------------ERKVCGFFQCRLGPNRVGK
NUOH_ANAPZ      -------------------------------------------------YMERKVMAFMQLRHGPSVVGP
NU1C_NANDO      -------------------------------------------------WLERQISAGVQQRIGPEYAGP
NU1C_CAPBU      ---------------------------------------------------EREISAGIQQRIGPEYAGP
NU1C_AGRST      -------------------------------------------------WLEREISASIQQRIGPEYAGP
NUOH_EDWI9      -------------------------------------------------FGERRLLGLFQNRYGPSRVGW
NUOH_CHLP8      ------------------------------LGLVIIAAIPLVFIALYGVYGERKISAFMQDRLGPMEVGI
NUOH_BURVG      ---------------------------------------------------ERKLIGWMHVRLGPNRVGP
NUOH1_SYMTH     ----------------------------------------------------RKFLAYFAYRVGPVKVGP
NUOH1_RHOP5     ---------------------MIGMILTAIISTTLIMALLVA-AGVF-TWVERRLLAFVQERLGPNRVGP
NU1C_HELAN      -------------------------------------------------WLEREISAGIQQRIGPEYAGP
NUOH_NEIM0      ---------------------------------------------------ERKVIGFMQLRVGPNVTGP
NUOH_LEGPA      -------------------------------------------------YAERKVIGYIQVRIGPNRVGL
NUOH_FRATM      -------------------------------------------------YAERKVIGYMQDRIGPNRVGS
NUOH_BURCJ      ---------------------------------------------------ERKLIGWMHVRLGPNRVGP
NUOH_BURCH      ---------------------------------------------------ERKLIGWMHVRLGPNRVGP
NUOH_BURCC      ---------------------------------------------------ERKLIGWMHVRLGPNRVGP
NUOH_BURCA      ---------------------------------------------------ERKLIGWMHVRLGPNRVGP
NUOH_RICAE      -------------------------IIIALKVVAITIPLILCVAYLT--YAERRVIGLMQLRRGPNVVGP
NUOH_LEGPC      -------------------------------------------------YAERKVIGYIQVRIGPNRVGL
NUOH_BURS3      ---------------------------------------------------ERKLIGWMHVRLGPNRVGP
NU1C_HUPLU      -----------FPKDLFGFIWIITPILTYTLGVTIGISVIV--------WLERKISAGVQQRIGPEHAGP
NUOH_NEIMA      ---------------------------------------------------ERKVIGFMQLRVGPNVTGP
NUOH_FRATW      -------------------------------------------------YAERKVIGYMQDRIGPNRVGS
NUOH_FRATT      -------------------------------------------------YAERKVIGYMQDRIGPNRVGS
NUOH_FRATO      -------------------------------------------------YAERKVIGYMQDRIGPNRVGS
NUOH_FRATN      -------------------------------------------------YAERKVIGYMQDRIGPNRVGS
NUOH_FRATH      -------------------------------------------------YAERKVIGYMQDRIGPNRVGS
NUOH_FRATF      -------------------------------------------------YAERKVIGYMQDRIGPNRVGS
NUOH_FRAT1      -------------------------------------------------YAERKVIGYMQDRIGPNRVGS
NU1C_PHYPA      ---------------------------------------------------ERKISAGIQQRIGPEYAGP
NU1C_LOBMA      ---------------------------------------------------EREISAGIQQRIGPEYAGP
NU1C_LEPVR      ---------------------------------------------------EREISAGIQQRIGPEYAGP
NU1C_CRUWA      ---------------------------------------------------EREISAGIQQRIGPEYAGP
NU1C_ACOCL      ---------------------------------------------------EREISAGIQQRIGPEYAGP
NUOH1_RHIME     ----------------------------------------------------RKIWAAVQLRRGPNVVGP
NU1C_NASOF      ---------------------------------------------------EREISAGIQQRIGPEYAGP
NU1C_BARVE      ---------------------------------------------------EREISAGIQQRIGPEYAGP
NUOH_STRCO      ---------------------------------------------------ERKVVAWMQLRIGPNRHGP
NUOH_RICTY      --------------------------VIALKVVAITIPLILCVAYLT--YAERRVIGLMQLRRGPNVVGP
NUOH_PSEAE      -------------------------------------------------WVERRLLGLWQDRYGPNRVGP
NUOH_PSEAB      -------------------------------------------------WVERRLLGLWQDRYGPNRVGP
NUOH_PSEA8      -------------------------------------------------WVERRLLGLWQDRYGPNRVGP
NUOH_EHRCR      -------------------------------------------------YMERKVIAAIQLRQGPNVVGP
NUOH_BARBK      ----------------------------------------------------RKIWAAVQLRRGPNVVGP
NU1C_PIPCE      -------------INSFSRSESLKEVIGLIWMLVPILTLVLAITVLVIVWLERQISAGIQQRIGPEYAGP
NUOH_PSEA7      -------------------------------------------------WVERRLLGLWQDRYGPNRVGP
NUOH_PELUB      -------------------------------------------------WLDRRIWAFVQKRQGPNVVGP
NUOH_HERAR      ---------------------------------------------------ERKVIGWMHVRHGPNRTGP
NUOH_BURM1      ---------------------------------------------------ERKLIGWMHVRLGPNRVGP
NU1C_MARPO      -------------------------------------------------WLERKISAAIQQRIGPEYAGP
NU1C_CALFG      -------------------------------------------------WLEREISAGIQQRIGPEYAGP
NUOH_CHRVO      ------------------LQGILGTDAGLLVWTLLIIAIVLPMLGCVATLAERKVIGYMQIRIGPNRVGP
NUOH_SALRD      ---------------------MIPSMVWTALGAFLVINAMLLSASLL-VFAERRVSAFIQNRPGPNRVGP
NUOH_LEPBL      --------------------------------------------------AERKVAGFIQDRKGPNRAGI
NUOH_LEPBJ      --------------------------------------------------AERKVAGFIQDRKGPNRAGI
NUOH1_RHOS4     -------------------------IILTIAAQGLLVIAFVMISLLFLVYGDRKIWAAVQLRRGPNVVGA
NUOH1_RHOS1     -------------------------IILTIAAQGLLVIAFVMISLLFLVYGDRKIWAAVQLRRGPNVVGA
NU1C_AETGR      ---------------------------------------------------EREISARIQQRIGPEYAGA
NU1C_ADICA      -------------------------------------------------WLERKVSAGVQQRIGPEYAGP
NU1M_DICCI      ---------------------------------------------------ERKVMAAMQKRRGPNVVGF
NU1C_SORBI      -------------------------------------------------WLEREISASIQQRIGPEYAGP
NU1C_PHAVU      ----------------------------------LIFIVGITISVLAIVWLEREISAGIQQRIGPEYTGP
NUOH_NEIMB      ---------------------------------------------------ERKVIGFMQLRVGPNVTGP
NU1C_PROMM      -------------------------------------------------WLERKISAAVQQRIGPEYAGA
NU1C_PROM3      -------------------------------------------------WLERKISAAVQQRIGPEYAGA
NUOH_POLNA      -------------------------------------------------WERKAI--GFTQRVGPNRIGP
NUOH_NEIG1      ---------------------------------------------------ERKVIGFMQLRVGPNVTGP
NUOH_BDEBA      -------------------------------------------------WLERRGSAFIQDRLGPNRVGP
NU1C_DRANE      ---------------------------------------------------ERQISAGIQQRIGPEYAGP
NU1C_AETCO      ---------------------------------------------------EREISARIQQRIGPEYAGA
NUOH_FRAP2      -------------------------------------------------YAERKVIGYMQDRIGPNRVGS
NUOH2_SYMTH     ----------------------LSPTVQVWLGGVLKASLILVWGLILCLMLERKLSAWMQNRVGPWRVGL
NUOH_METCA      ---------------TVGSPAV---VIGILLSTVIVAAWLI--------WVERRMIGIWQDRLGPNRVGP
NU1M_DICDI      ---------------------------------------------------ERKVMAAMQKRRGPNVVGF
NUOH_SODGM      -------------------------------------------------FAERRLLGLFQNRYGPNRVGW
NUOH_SACEN      -------------------------------------------------WAERRVIGRMQHRPGPNRAGP
NUOH_ERWCT      ---------------------------------------------------ERRLLGLFQGRYGPNRVGW
NU1C_ILLOL      -------------------------------------------------WLEREISAGIQQRIGPEYAGP
NUOH_RICAH      -------------------------IIIALKVVAITIPLILCVAYLT--YAERRVIGLMQLRCGPNVVGP
NUOH_AZOPC      ---------------------------------------------------ERKVCAFFQCRLGPTRVGP
NU1C_RANMC      ---------------------------------------------------ERQISAGVQQRIGPEYAGP
NU1C_PROMT      -------------------------------------------------WLERKISAAAQQRIGPEYAGA
FPOH_METAC      -----------------------------VVGLVLVGAIFLGAMGAV--WLERKLSADIQFRYGPSRVGK
NUOH_PROAC      -------------------------------------------------WFERRVLAKMQNRIGMNSAWA
NU1C_ZYGCR      ---------------------------------------------------ERKISAAVQQRIGPEYAGP
NU1C_LIRTU      -------------------------------------------------WLEREISAGIQQRIGPEYAGP
NUOH_KLEP7      -------------------------------------------------FGERRLLGLFQNRYGPNRVGW
NUOH_KLEP3      -------------------------------------------------FGERRLLGLFQNRYGPNRVGW
NUOH_EHRCJ      -------------------------------------------------YMERKVIGAIQLRQGPNVVGP
NUOH_BART1      ----------------------------------------------------RKIWAAVQLRRGPNVVGP
NUOH_ROSDO      ------------MADFFTTPGILAQVLA-VIGFVMVSLLFLVYGD-------RKIWAAVQMRRGPNVVGT
NUOH_FLAJ1      -------------------------------------------------WAERKVAAFLQDRVGPNRAGW
NU1M_CHOCR      --------------------------------------------------AERKVMAAIQRRKGPNIVGV
NU1C_OENEH      ---------------------------------------------------EREISAGIQQRIGPEYAGP
NU1C_MESVI      ---------------------------------------------------ERKISAAVQQRIGPEYAGP
NU1C_AMBTC      -------------------------------------------------WLEREISAGIQQRIGPEYAGP
NUOH_YERPS      -------------------------------------------------FGERRLLGLFQNRYGPNRVGW
NUOH_YERPP      -------------------------------------------------FGERRLLGLFQNRYGPNRVGW
NUOH_YERPN      -------------------------------------------------FGERRLLGLFQNRYGPNRVGW
NUOH_YERPG      -------------------------------------------------FGERRLLGLFQNRYGPNRVGW
NUOH_YERPE      -------------------------------------------------FGERRLLGLFQNRYGPNRVGW
NUOH_YERPB      -------------------------------------------------FGERRLLGLFQNRYGPNRVGW
NUOH_YERPA      -------------------------------------------------FGERRLLGLFQNRYGPNRVGW
NUOH_YERP3      -------------------------------------------------FGERRLLGLFQNRYGPNRVGW
NUOH_YERE8      -------------------------------------------------FGERRLLGLFQNRYGPNRVGW
NUOH_STRAW      ---------------------------------------------------ERKVVAWMQLRIGPNRHGP
NUOH_PARDP      -------------------------------------------------YGDRKIWAAVQMRRGPNVVGP
NUOH_COXB2      --------------------------------------------------AERKVIGYMQSRVGPNRVGF
NUOH_AZOVD      ---------------------------------------------------ERRLLGLWQDRYGPNRVGP
NU1M_CYACA      ---------------------------------------------------ERKIIGSIQKRKGPNIVGI
NU1C_PROM1      -------------------------------------------------WLERKISAAAQQRIGPEYAGA
NUOH_ENT38      -------------------------------------------------FGERRLLGLFQNRYGPNRVGW
NUOH_DEIDV      ---------------------------------------------------ERKLLGRFQIRVGPNRVGP
NUOH_COXBU      --------------------------------------------------AERKVIGYMQSRVGPNRVGF
NUOH_COXBR      --------------------------------------------------AERKVIGYMQSRVGPNRVGF
NUOH_COXBN      --------------------------------------------------AERKVIGYMQSRVGPNRVGF
NUOH_COXB1      --------------------------------------------------AERKVIGYMQSRVGPNRVGF
NU1M_OENBE      ---------------------------------------------------ERKVMAFVQRRKGPDVVGS
NUOH_BRASB      ----------------------------------------------------RKIWAAVQIRRGPNVVGP
NUOH_NITSB      -------------------------VIATIIKILIVLGLFSALAGF-GTYVERKVLAFMQRRLGPMHVGP
NUOH_JANMA      -------------------------VVAPLMGA--VAYLTL--------W-ERKVIGWMHVRHGPNRTGP
NUOH_HYPNA      ----------------------------------------------------RKVWAGVMMRKGPNVVGP
NUOH_HELHP      ----------------------MSELTGGIIECILIIVVLLIFSALAGTYLERKVLGFFQRRIGPNYVGP
NUOH2_NITMU     ------QLFGDFFGPEWG-PALFLLVKNVLLIVAIVLPLMLAVAYLT--FAERKIIGYMQLRVGPNRVTF
NUOH_YERPY      -------------------------------------------------FGERRLLGLFQNRYGPNRVGW
NUOH_PHEZH      ----------------------------------------------------RKIWAGVQMRKGPNVVGP
NUOH_AGRVS      --------------------------------------------------ADRKIWAAVQLRRGPNVVGP
NU1C_SOYBN      ----------ESFKEIYGIIWVFAPILILILG--------ITISVLAIVWLEREISAGIQQRIGPEYTGP
NU1M_ARATH      ---------------------------------------------------ERKVMAFVQRRKGPDVVGS
NUOH_POLSJ      -------------------PATVWPVLWALIKIVCVLLPLMGCVAYLTLWERKAI--GFTQRFGPNRVGP
NUOH2_RHIME     -------------------------------------------------WLERKIAGHMQQRMGPMRVGW
NU1C_SYNPX      ---------------------------------------------------ERKISAAVQQRIGPEYAGA
NQO8_PARDE      -------------------------------------------------YGDRKIWAAVQMRRGPNVVGP
NUOH_AERHH      ------------------------------IGKALIVLVGIVGAGAFMSFIERRLLALWQDRYGPNRVGP
NUOH_AERS4      ------------------------------VGKALIVLVGIVGAGAFMSFIERRLLALWQDRYGPNRVGP
NU1M_METSE      --------------------------------------------------AERKVLGYMQARKGPNVVGV
NUOH_FRAAA      ---------------------------------------------------ERKVVAKMQQRVGPNRHGP
NUOH_SPHWW      ------------LFQSWGLPYDWAWFVSTIIGILVIAPLMLAVAMII--YADRKIWAAMALRRGPNVVGP
NUOH_ERYLH      ---------------------------ATIAGILLIAPVMLAVAMVI--YVDRKVLGAIMLRRGPNVVGP
NU1C_PSINU      -------------------------------------------------WLERKISAGMQQRMGPEYTGP
NUOH_RHOCA      -------------------------------------------------WGDRKIWAAVQMRKGPNVVGA
NUOH_NITHX      ----------------------------------------------------RKIWAAVQIRRGPNVVGP
NUOH2_ACIBL     -------------------------------------------------WLERKVVGRMQNRWGPTRVGP
NU1M_WHEAT      ---------------------------------------------------ERKVMAFVQRRKGPDVVGS
NUOH_THEFY      ---------------------------------ALAVFVFLMLCVLMMIMADRKVMGRMQQRHGPNRFGP
NUOH_SILPO      ------------MAEFFDTPGGIALIILAQV-LAVVAFVMISLLFLV--YGDRKIWAAVQMRRGPNVVGV
NUOH_SERP5      -------------------------------------------------FGERRLLGLFQNRYGPNRVGW
NU1C_PLAOC      ----------ESLKEAYGLIWLLVPIFTPVSGITIGVLVIV--------WLEREISAGIQQRIGPEYAGP
NUOH_SILST      ------------MAEFFNTPGGIAVIILAQT-LAVVAFVMISLLFLV--YGDRKIWAAVQMRRGPNVVGV
NUOH_METPP      -----------------------------------------------------------------NRVGP
NUOH_MESSB      --------------------------------------------------ADRKIWAAVQLRRGPNVVGP
NUOH_BRASO      ----------------------------------------------------RKIWAAVQIRRGPNVVGP
NU1C_SYNS9      ---------------------------------------------------ERKISAAVQQRVGPEYAGA
NUOH_RUBXD      -----------------------------LISSATVIFLVLNIAAVL-TLAERKVSAYIQLRYGPNRVGP
NUOH_NOVAD      --------------------------ISTIAGILLIAPLMLGVAMII--YADRKIWAAMALRRGPNVVGP
NUOH2_RHOP2     --------------------------------------------------ADRKIWAAVQIRRGPNVVGP
NUOH1_SOLUE     -------------------------IFISLVKAAVIFGVLMTTLAYL-QWVERKVIAHIQVRPGPYRVGP
NUOH_SHEON      ------------------------------IGKALIVLVGIVGAGAFMSFIERRLLALWQDRHGPNRVGP
NUOH2_RHOP5     --------------------------------------------------ADRKIWAAVQIRRGPNVVGP
NUOH_WOLTR      --------------------------------------IPLLFSVAYLVYFERKVIGAIQLRHGPSVVGP
NUOH_PHOLL      -------------------------------------------------FGERRLLGLFQNRYGPNRVGW
NUOH_JANSC      -------------------------------------------------YADRKIWAAVMMRKGPNVVGA
NUOH_BAUCH      ---------------------------------AIVTLLSVVTIGAYMSFFERRLLGLFQHRYGPNRVGW
NUOH_DEIRA      ---------------------------------------------------ERRLLGRIQLRPGPNRVGP
NUOH2_SYNFM     ---------------------------------------------------ERKFLARLQIRYGPNRAGK
NUOH_WOLPM      ---------------------------------------------------ERKVLAAIQLRHGPSVVGP
NUOH_RHOFD      -------------------------VVWALIKVTLVLMIVMGAVTYTTLW-ERRLLAWAQIRMGPNRVGP
NUOH_ERWT9      -------------------------------------------------FGERRLLGLFQNRYGPNRVGW
NU1M_USTMA      ---------------------------------------------------ERKVMGSMQRRIGPNVVGY
NU1C_SYNSC      ---------------------------------------------------ERKISAAVQQRIGPEYAGA
NUOH2_RHOPS     --------------------------------------------------ADRKIWAAVQLRRGPNVVGP
NU1C_TRIEI      -------------------------------------------------WLERKISAAAQQRIGPEFMGP
NU1C_CHAGL      -------------------------------------------------WLERKISAAVQQRIGPEYAGP
NUOH_CAMJD      -------------------------------------------------YAERKVLAYFQRRIGPDMVGP
NUOH1_RHIEC     --------------------------------------------------ADRKIWAAVQLRRGPNVVGP
NU1M_MARPO      --------------------------------------------------AERKVMASMQRRKGPNVVGI
NUOH1_RHOPA     ----------------------------------------------------RKIWAAVQIRRGPNVVGP
NUOH_RHIL3      --------------------------------------------------ADRKIWAAVQLRRGPNVVGP
NUOH_NOCSJ      -------------------------------------------------WFERRVVGRMQHRPGPNVNGP
NUOH_NITEU      -------------------------------------------------FAERKIIAYMQVRVGPNRVTF
NUOH_BORPE      -------------------------VVWSLVKIVVIAVPIILCVAYLTYW-ERKMIGAMHVRLGPTRVGF
NUOH_BORPA      -------------------------VVWSLVKIVVIAVPIILCVAYLTYW-ERKMIGAMHVRLGPTRVGF
NUOH_BORBR      -------------------------VVWSLVKIVVIAVPIILCVAYLTYW-ERKMIGAMHVRLGPTRVGF
NU1C_SYNPW      ---------------------------------------------------ERKISAAVQQRIGPEYAGA
NUOH_PSEFS      -------------------------------------------------FVERRLLGWWQDRYGPNRVGP
NUOH_CAUCR      ----------------------------------------------------RKIWAGVQMRKGPNVVGP
NUOH1_RHOPB     --------------------------------------------------ADRKIWAAVQIRRGPNVVGP
NUOH_RHILW      --------------------------------------------------ADRKIWAAVQLRRGPNVVGP
NUOH_AZOSB      --------------------------------------------------AERKVIGYMQVRIGPNRVGP
NUOH_FRASC      ---------------------------------------------------ERKVVAKMQQRVGPNRHGP
NUOH_XYLFT      ----------------FGDIGVVLWTVLKILMIAIPLIVSVAFYVV---W-ERKLIGWMHVRHGPMYVG-
NUOH_XYLF2      ----------------FGDIGVVLWTVLKILMIAIPLIVSVAFYVV---W-ERKLIGWMHVRHGPMYVG-
NUOH_PARL1      ----------------------------------------------------RKIWAAVQLRRGPNVVGA
NUOH2_RHIEC     -------------------------------------------------WLERKIAGHMQQRMGPMRVGW
NUOH_XYLFM      ----------------FGDIGVVLWTVLKILMIAIPLIVSVAFYVV---W-ERKLIGWMHVRHGPMYVG-
NUOH_LEPIN      --------------------------------------------------AERKVAGFIQDRKGPNRAGF
NUOH_LEPIC      --------------------------------------------------AERKVAGFIQDRKGPNRAGF
NUOH_CAMHC      -------------------------IVETIIKAVVILSVIATLAGL-GTYAERKVLAYMQRRVGPWMVGP
NUOH_BORPD      ---------------------------------------------------ERKMIGWMHVRLGPTRVGF
NUOH_AGRT5      ----------------------------------------------------RKVWAAVQLRRGPNVVGP
NUOH2_CYTH3     -------------------------------------------------WAERKVAAFIQDRLGPMEVGP
NUOH_XYLFA      ----------------FGDIGVVLWTVLKILMIAIPLIVSVAFYVV---W-ERKLIGWMHVRHGPMYVG-
NUOH_DEIGD      ---------------------------------------------------ERRLLARMQIRVGPNRVGP
NUOH_BORA1      ---------------------------------------------------ERKMIGWMHVRLGPNRVGF
NUOH_ACISJ      --------------------GAAWPVIWNLIKIICVVLPLLGAVAYLTLW-ERKLLGFMQVRFGPNRVGP
NU1M_BOVIN      ---------------------------------------------------ERKVLGYMQLRKGPNVVGP
NUOH_AGRRK      --------------------------------------------------ADRKIWAAVQLRRGPNVVGP
NU1M_BOSIN      ---------------------------------------------------ERKVLGYMQLRKGPNVVGP
NUOH_HALHL      -------------------------------------------------YVERRVIGHMQDRRGPNRVGP
NU1M_FELCA      ---------------------------------SLIIPILLAVAFLT--LVERKVLGYMQLRKGPNVVGP
NU1M_CABUN      ---------------------------------------------------ERKILGYMQLRKGPNIVGP
NUOH_CAMC5      -------------------------------------------------YAERKVLAYMQRRIGPDMVGP
NUOH_BRAJA      ----------------------------------------------------RKIWAAVQIRRGPNVVGP
NUOH_ACIAC      -------------------------IVAPLMGA--VAYLTL--------W-ERKLLGFMQVRHGPNRVGP
NU1M_TOLMA      ----------------------------------LIIPILLAMAFLT--LVERKILGYMQLRKGPNIVGP
NU1M_RHIUN      ---------------------------------------------------ERKVLGYMQLRKGPNIVGP
NU1M_EMBAL      ---------------------------------------------------ERKTLGYMQLRKGPNIVGP
NUOH_VEREI      ---------------------------------------------------ERKLLGFMQVRHGPNRVGP
NU1M_HALGR      ---------------------------------------------------ERKVLGYMQLRKGPNIVGP
NUOH_PSEMY      -------------------------------------------------FVERRLLGWWQDRYGPNRVGP
NUOH_DECAR      ---------------------------------------------------ERKVIGYMQVRIGPNRVGP
NUOH_ANAMM      ---------------------ILQRLMAQLLSSG--SSVFVMLSAIVGVYMERKVIAFMQLRHGPSVVGP
NUOH2_SOLUE     --------------------------------------IIAAFPLVAGVLVERKVLADFQVRLGPMRCGP
NUOH_MARMM      ----------------------------------------------------RKVWAAVQMRKGPNVVGA
NUOH_BLOPB      ----------------FGSSEIVTKHCVSEIFHAVIILLVVVACGAYMSFLERRLLALFQNRYGPNRVGW
NUOH_ALHEH      ---------------------------------ALVVPLMLAVAYLT--YAERRVIGAMQDRRGPNRVGY
NU1M_BALPH      ---------------------------------------------------ERKILGYMQFRKGPNIVGP
NU1M_PETHY      ---------------------------------------------------ERKVMAFVQRRKGPDVVGS
NUOH_BUCBP      ---------------------------------------------------ERRVLGLLQNRYGPNRVGW
NUOH_THIDA      ---------------------------------ALVVPLMLGVAYLT--YAERKIIGWMQVRIGPNRVGF
NUOH_BURP8      ---------------------------------------------------ERKLIGWMHVRLGPNRVGP
NUOH2_RHOPA     ---------------------MIGMIITATISVALIM-VLLVLAGTF-TWVERRLLGFVQERYGPNRVGP
NU1M_BOSMU      ---------------------------------------------------ERKVLGYMQLRKGPNVVGP
NU1M_PHOVI      ---------------------------------------------------ERKVLGYMQLRKGPNIVGP
NU1M_HIPAM      ----------------------------------LVAPILLAMAFLT--LVERKILGYMQLRKGPNIVGP
NQO8_THET8      ---------------------------------------------------ERRLLARFQVRMGPNRVGP
NUOH_CAMJR      -------------------------------------------------YAERKVLAYFQRRIGPDMVGP
NUOH_CAMJJ      -------------------------------------------------YAERKVLAYFQRRIGPDMVGP
NUOH_CAMJE      -------------------------------------------------YAERKVLAYFQRRIGPDMVGP
NUOH_CAMJ8      -------------------------------------------------YAERKVLAYFQRRIGPDMVGP
NQO8_THET2      ---------------------------------------------------ERRLLARFQVRMGPNRVGP
NU1M_ELEMA      ---------------------------------------------------ERKALGYMQLRKGPNVVGP
NUOH_NITEC      -------------------------------------------------FAERKIIAFMQVRVGPNRVTF
NU1M_PRIMA      ----------------------------------LIIPILLAMAFLT--LVERKILGYMQLRKGPNVVGP
NUOH_WOLSU      --------------------------------------VVAIFSALAGTYVERKVLAFMQRRLGPMHVGP
NUOH1_RHOP2     -------------------------MIGLIITAIISAVLIMALLVVAGTWVERRLLGFVQERYGPNRVGP
NU1M_TADIN      ---------------------------------SMIIPILLAVAFLT--LVERKILGYMQLRKGPNIVGP
NU1M_PIG        ---------------------------------------------------ERKVLGYMQLRKGPNVVGP
FPOH_METBF      ------------------------------------------FMGAMGAWLERKLSADIQTRMGPCRVGK
NU1M_SAGOE      ----------------------------NLLVVILSALVAMAFLTLT----ERKVLGYMQFRKGPNIVGP
NUOH2_NITOC     -------------------------------------------------FAERKIIGYMQGRIGPNRVGP
NU1M_MANTE      --------------------------------------------------AERKVLGYMQLRKGPNIVGP
NU1M_ATEPA      ---------------------------------------------------ERKILGYMQFRKGPNIVGP
NUOH_BLOFL      --------------------------------------LMVVMCGAYMSFVERRLLALFQNRYGPNRVGW
NUOH_ANADE      -------------------------------------------------WWEMRVSARMQSRIGYNRVGA
NU1M_NYCCO      ----------------------------------LVIPVMLAMAFLT--LLERKTLGYMQFRKGPNVVGP
NU1M_ZAEPI      ----------------------------------LVIPILLAMAFLT--LVERKILGYMQLRKGPNIVGP
NUOH1_RHOPS     -------------------------MIGLIITATISVTLIMVLLVVAGTWVERRLLGFVQERLGPNRVGP
NUOH1_ACIBL     -----------------GTPGEYGSYILVIFGVASVAVMLMTY-------LERKVLAHMQIRLGPMRVGP
NU1M_SHEEP      ----------------------------------LIIPILLAVAFLT--LVERKVLGYMQFRKGPNVVGP
NU1M_MYRTR      --------------------------------ACLIIPILLAVAFLT--LVERKTLGYMQVRKGPNIVGP
NU1M_EUPSX      ----------------------------------LVIPILLAMAFLT--LVERKILGYMQLRKGPNIVGP
NU1M_CANAL      --------------------------------------------------AERKTLGYMQRRVGPNAVGY
NUOH_BUCAP      ---------------------------------------------------ERKFLAFFQNRHGPNRVGW
NU1M_BALMU      ---------------------------------------------------ERKILGYMQFRKGPNIVGP
NU1M_EPTNI      ---------------------------------------------------ERKVLGYMQLRKGPNIVGP
NU1M_CANLU      ---------------------------------------------------ERKVLGYMQLRKGPNIVGP
NU1M_CANFA      ---------------------------------------------------ERKVLGYMQLRKGPNIVGP
NUOH_XANAC      -----------------------GAVLWSVLKILLIAVPVIVTVAFYVVW-ERKLIGWMHVRHGPMYVG-
NU1M_RABIT      ---------------------------------------------------ERKILGYMQLRKGPNIVGP
NUOH_BUCAI      --------------------------------------LLIVFSSAMLSIVERRLLAVFQNRYGPNRVGW
NU1M_LONTH      ---------------------------------------------------ERKILGYMQLRKGPNVVGP
NU1M_HORSE      ---------------------------------------------------ERKVLGYMQLRKGPNIVGP
NU1M_CERSI      ---------------------------------------------------ERKVLGYMQLRKGPNIVGP
NUOH_XANC5      ----------------------------------------------------------------------
NUOH_GEOSW      -----------------------------------------------GILAERKVMGFMQGRYGPNQVGG
NU1M_LOXAF      ---------------------------------------------------ERKALGYMQLRKGPNVVGP
NU1M_LEMCA      --------------------------------------------------AERKILGYMQLRKGPNVVGP
NU1M_EQUAS      ---------------------------------------------------ERKILGYMQLRKGPNIVGP
NUOH_XANOR      -----------------------GVVLWSVLKILLIAVPVIVSVAFYVVW-ERKLIGWMHVRHGPMYVG-
NUOH_XANOP      -----------------------GVVLWSVLKILLIAVPVIVSVAFYVVW-ERKLIGWMHVRHGPMYVG-
NU1M_CHODI      ----------------------------------LIIPILLAVAFLT--LVERKILGYMQFRKGPNIVGP
NU1M_BRAVA      ---------------------------------------------------ERKILGHMQLRKGPNTVGP
NUOH_XANCP      --------------------GVLLWTVLKILLIAVPVIVTVAFYVV---W-ERKLIGWMHVRHGPMYVG-
NUOH_XANCB      --------------------GVLLWTVLKILLIAVPVIVTVAFYVV---W-ERKLIGWMHVRHGPMYVG-
NUOH_XANC8      --------------------GVLLWTVLKILLIAVPVIVTVAFYVV---W-ERKLIGWMHVRHGPMYVG-
NUOH_BUCAT      --------------------------------------LLIVFSSAMLSIVERRLLAVFQNRYGPNRVGW
NUOH_BUCA5      --------------------------------------LLIVFSSAMLSIVERRLLAVFQNRYGPNRVGW
NU1M_NYCNO      ---------------------------------------------------ERKVLGYMQLRKGPNIVGP
NU1M_DANRE      ---------------------------------------------------ERKVLGYMQLRKGPNVMGP
NU1M_DASKA      ---------------------------------------------------ERKILGYMQLRKGPNIVGP
NU1M_DASNO      ---------------------------------SLIIPILLAVAFLT--LLERKILGYMQLRKGPNIVGP
NU1M_PERGU      ---------------------------------------------------ERKVLGYMQFRKGPNIVGP
NUOH_VESOH      -------------------------------------------------YAERKVIGYMQLRIGPNRVGP
NU1M_HIPTE      ----------------------------------MIVPILLAVAFLT--LVERKVLGYMQLRKGPNVVGP
NU1M_MAMPR      ---------------------------------------------------ERKALGYMQLRKGPNVVGP
NU1M_PHACI      ---------------------------------------------------ERKVLGYMQLRKGPNIVGP
NU1M_XENLA      ---------------------------------------------------ERKVLGYMQHRKGPNIVGP
NU1M_LATCH      ---------------------------------AVIIPILLAVAFLT--LIERKVLGYMQLRKGPNIVGP
NUOH_THICR      ------------------LSSFLFDWLAVLITLVLQAVAVILPVMITVAWAERKVIGYMQVRMGPNRVGP
NU1M_ACACA      ---------------------------------------------------ERKVLASIQKRKGPNWTGF
NUOH_RUTMC      -------------------------------------------------YAERKVIGYMQLRIGPNRVGP
NU1M_TAMSI      ---------------------------------------------------ERKMLGYMQLRKGPNIVGP
NU1M_SAGLE      --------------------------MANLLLVILPALVAMAFLTLT----ERKVLGYMQFRKGPNIVGP
NU1M_TRIRU      ----------------------------SIIGSCLPALLIVAFLTIS----ERKTMASMQRRLGQNIVGY
NU1M_DUGDU      ---------------------------------SLIIPILLAVAFLT--LVERKTLGYMQLRKGPNVVGP
NU1M_RANCA      ---------------------------------------------------ERKILGYMQHRKGPNVVGP
NU1M_MURSU      ---------------------------------AMIVPVLLAVAFLT--LLERKVLGYMQLRKGPNIVGP
NUOH2_RHOS4     -------------------------------------------------WGERRLLGFLQERLGPNRVGP
NU1M_RAT        ---------------------------------------------------ERKILGYMQLRKGPNNEGP
NUOH2_RHOS1     -------------------------------------------------WGERRLLGFLQERLGPNRVGP
NU1M_TRIVU      ---------------------------------------------------ERKALGYMQFRKGPNIVGP
NU1M_CYCDI      --------------------------------SCLIIPILLAVAFLT--LVERKILGYMQLRKGPNIVGP
NU1M_PANTR      ----------------------------------LIVPILIAMAFLM--LTERKILGYMQLRKGPNIVGP
NUOH_METFK      --------------------------------------------------AERKVIGFMQVRMGPNRVGY
NU1M_PAPHA      ---------------------------------------------------ERKLLGYMQLRKGPNIVGP
NU1M_NYCVE      ---------------------------------------------------ERKFLGYMQLRKGPNIVGP
NU1M_CEBAP      -----------------------------LITPALIAMAFLTLM-------ERKILGYMQLRKGPNTVGP
NU1M_COEFR      ---------------------------------------------------ERKVLGYMQLRKGPNVVGP
NUOH_XANOM      -----------------------GVVLWSVLKILLIAVPVIVSVAFYVVW-ERKLIGWMHVRHGPMYVG-
NU1M_HIPDI      ----------------------------------MIVPILLAVAFLT--LVERKVLGYMQLRKGPNVVGP
NU1M_DIDMA      ---------------------------------------------------ERKVLGYMQFRKGPNVIGP
NU1M_CROLA      ---------------------------------------------------ERKVLGYMQLRKGPNIVGP
NU1M_PHYEO      ---------------------------------------------------ERKILGYMQLRKGPNVVGP
NU1M_MOUSE      ---------------------------------------------------ERKILGYMQLRKGPNIVGP
NU1M_CARAU      ---------------------------------------------------ERKVLGYMQLRKGPNVVGP
NU1M_SQUAC      ---------------------------------AYIVPILLATAFLT--LVERKILGYMQFRKGPNIVGP
NU1M_VARBA      ---------------------------------------------------ERKILGYMQHRKGPNITGP
NU1M_NOTTY      ---------------------------------------------------ERKVLGYMQFRKGPNVVGP
NU1M_VARJO      ---------------------------------------------------ERKILGYMQLRKGPNITGP
NU1M_CYPCA      ---------------------------------------------------ERKVLGYMQLRKGPNVVGP
NUOH_CAMC1      -------------------------VITTIVKAVVILAVMASLAGLA-TYAERKVLAYMQRRVGPDMVGP
NU1M_MURFL      ---------------------------------AMIIPVLLAVAFLT--LLERKVLGYMQLRKGPNIVGP
NU1M_SCYCA      ---------------------------------------------------ERKILGYMQFRKGPNIVGP
NU1M_HYLLA      ---------------------------------------------------ERKILGYTQLRKGPNIVGP
NU1M_DEBHA      --------------------------------------------------AERKTLGYMQRRVGPNAVGY
NU1M_TAPME      ---------------------------------------------------ERKVLGYMQLRKGPNIVGP
NU1M_TAMTE      --------------------------------ACLIVPILLAMAFLT--LVERKTLGYMQLRKGPNIVGP
NU1M_PODAN      --------------------------------------------------AERKTMASMQRRLGPNFVGY
NU1M_COTCH      ---------------------------------------------------ERKILSYMQARKGPNIVGP
NUOH_SULDN      --------------------------------------IVLIFSALAGTYFERKVLAFMQRRLGPVNVGP
NU1M_PETMA      ---------------------------------------------------ERKTLGYMQLRKGPNVVGF
NU1M_POLOR      ---------------------------------------------------ERKMLGYMQLRKGPNIVGP
NU1M_VOMUR      ---------------------------------------------------ERKVLGYMQFRKGPNIVGP
NU1M_PTEGI      ---------------------------------------------------ERKVLGYMQLRKGPNVVGP
NU1M_DROSU      ---------------------------------------------------ERKVLGYIQIRKGPNKVGL
NU1M_TETNG      ---------------------------------AFIVPVLLAVAFLT--LLERKVLGYMQLRKGPNIVGP
NU1M_PELSU      ---------------------------------AFILPILIAVSFFT--LVERKVISCMQPRKGPNITGP
NU1M_DINSE      ---------------------------------------------------ERKLLGYMQHRKGPNLVGP
NU1M_VARDU      ---------------------------------------------------ERKMLGYMQLRKGPNITGP
NU1M_DROYA      ---------------------------------------------------ERKVLGYIQIRKGPNKVGL
NU1M_MYTED      ---------------------------------------------------ERKILAIIMIRKGPSKVSY
NU1M_GADMO      ---------------------------------------------------ERKVLGYMQLRKGPNIVGP
NU1M_ANOQU      --------------------------IMPLIGSLLL--VICVMVGVAFTLLERKVLGYIQIRKGPNKVGF
NU1M_MYXGL      ---------------------MISQIISSFLTFVMIL-IAVAFLTLI----ERKVLGYMQLRKGPNIVGP
NU1M_GORGO      ----------------------------------LIVPILIAMAFLM--LTERKILGYMQLRKGPNVVGP
NU1M_VARRU      ---------------------------------------------------ERKILGYMQLRKGPNITGP
NU1M_TACAC      ---------------------------------------------------ERKILGYMQFRKGPNIVGP
NU1M_LUMTE      ---------------------------------------------------ERKFLGYFHLRKGPNKVGL
NU1M_SMIMA      ---------------------------------------------------ERKVLGYMQFRKGPNIVGP
NU1M_YARLI      --------------------------------------------------AERKTLAYMQRRLGPNFVGY
NU1M_MACEU      ---------------------------------------------------ERKDLGYMQFRKGPNIVGP
NU1M_NEUCR      --------------------------------------------------AERKTMASMQRRLGPNAVGY
NU1M_COTJA      ---------------------------------------------------ERKILSYMQARKGPNIVGP
NU1M_ARTSF      ---------------------------------------------------ERKILGYIQLRKGPNKVGF
NU1M_SMICR      ---------------------------------------------------ERKVLGYMQFRKGPNIVGP
NU1M_STRCA      ---------------------------------------------------ERKVLSYMQARKGPNIVGP
NU1M_CHLRE      ----------------------------------------------------------------------
NU1M_LAMFL      ---------------------------------------------------ERKTLGYMQLRKGPNVVGF
NU1M_CHICK      ---------------------------------------------------ERKILSYMQARKGPNIVGP
NU1M_MONDO      ----------------------------------------------------------------------
NU1M_HUMAN      ----------------------------------LIVPILIAMAFLM--LTERKILGYMQLRKGPNVVGP
NU1M_ZAGBR      ---------------------------------------------------ERKILGYMQFRKGPNIVGP
NU1M_THYAR      ----------------------------------------------------------------------
NU1M_DIAYO      ----------------------------------------------------------------------
NU1M_ORNAN      ----------------------------------------------------------------------
NU1M_PONAB      ---------------------------------------------------ERKILGHTQLRKGPNIVGP
NU1M_LOLBL      ---------------------------------------------------ERKGLGYFQLRKGPNKVGL
NU1M_SALSA      ----------------------------------------------------------------------
NU1M_VARFL      ---------------------------------------------------ERKMLGYMQLRKGPNITGP
NU1M_DALCH      ---------------------------------------------------ERKSLGYIQFRKGPNKVGY
NU1M_STRPU      ---------------------------------------------------ERKVLGYMQFRNGPNVVGP
NU1M_PONPY      ---------------------------------------------------ERKILGYTQLRKGPNIVGP
NU1M_PARLI      ----------------------------------------------------------------------
NU1M_ONCMY      ---------------------------------------------------ERKVLGYMQLRKGPNIVGP
NU1M_DROME      ---------------------------------------------------ERKVLGYIQIRKGPNKVGL
NU1M_MACRU      ----------------------------------------------------------------------
NU1M_SARHA      ---------------------------------------------------ERKVLGYMQFRKGPNMVGP
NU1M_AEDAE      ---------------------------------------------------ERKVLGYIQIRKGPNKVGF
NU1M_LOCMI      ---------------------------------------------------ERKVLGYIHIRKGPNKVGF
NU1M_ANOGA      --------------------------IMPLIGSLLL--VICVMVGVAFTLLERKVLGYIQIRKGPNKVGF
NU1M_MACRO      ---------------------------------------------------ERKVLGYMQFRKGPNIVGP
NU1M_PARTE      -------------------------IVLMLVVTLIIASITLL---------ERKLLSLVQRRVGPNFVGY
NU1M_PICCA      --------------------------------------------------AERKTLGYMQRRVGPNIVGY
NU1M_BRALA      ---------------------------------------------------ERKVIGYVQLRKGPNVVGP
NU1M_BRAFL      ---------------------------------------------------ERKVIGYVQLRKGPNVVGP
NU1M_ALLMI      ----------------------------------------------------------------------
NU1M_APILI      ---------------------------------------------------ERKILGYIQDRKGPNKIML
NU1M_ASTPE      ---------------------------------------------------ERKVLGYMQLRKGPNIVGP
NU1M_ALBCO      ---------------------------------------------------ERKVLSSMQIRKGPNKVGL
NU1M_RHISA      ----------------------------------------------------------------------
NU1M_ASCSU      ---------------------------------------------------ERHLLGGSQQRIGPNKVSF
NU1M_PECMA      ---------------------------------------------------ERKVLAASQVRKGPEMVGW
NU1M_CAEBR      -----------------------------------------------------------------NRLGP
NU1M_CAEEL      -----------------------------------------------------------------NRLGP
NU1M_CITLA      ----------------------------------------------------------------------
NU1M_PISOC      ---------------------------------------------------ERKVLGYMQLRKGPNIVGP
NU1M_DROBF      ---------------------------------------------------ERKVLGYIQIRKGPNKVGL
NU1M_DROTR      ---------------------------------------------------ERKVLGYIQIRKGPNKVGL
NU1M_DROSS      ---------------------------------------------------ERKVLGYIQIRKGPNKVGL
NU1M_DROPE      ---------------------------------------------------ERKVLGYIQIRKGPNKVGL
NU1M_DROPB      ---------------------------------------------------ERKVLGYIQIRKGPNKVGL
NU1M_DROOB      ---------------------------------------------------ERKVLGYIQIRKGPNKVGL
NU1M_DROMI      ---------------------------------------------------ERKVLGYIQIRKGPNKVGL
NU1M_DROMD      ---------------------------------------------------ERKVLGYIQIRKGPNKVGL
NU1M_DROAZ      ---------------------------------------------------ERKVLGYIQIRKGPNKVGL
NU1M_DROAM      ---------------------------------------------------ERKVLGYIQIRKGPNKVGL
NU1M_DROAL      ---------------------------------------------------ERKVLGYIQIRKGPNKVGL
NU1M_DROAI      ---------------------------------------------------ERKVLGYIQIRKGPNKVGL
NU1M_DROGU      ---------------------------------------------------ERKVLGYIQIRKGPNKVGL
NU1M_ARTSA      ----------------------------------------------------------------------
HYCD_ECOLI      -----------------------------------------------------------------NRRGP
NU1M_LEITA      ----------------------------------------------------------------------
NU1M_ASTFO      ---------------------------------------------------ERKMLGYMHVRKGPNNVGP


                         .         .         *         .         .         .         .:140
query           FGLLIIPAAAVQLLAKELIIPEGVDRPTWDIAPILLPASAMLGFSVIPMGQIGPLNIHLADPEVGLALVF
NUOH_DEHSC      FGLLQPIADAIKVLIKEDIIPSEADKGVFWLAPLVAFVPVMLMFAAIPFAD----GVMLVDLNIGILYIL
NUOH_DEHE1      FGLLQPIADAIKVLIKEDIIPTESDKGVFWLAPLVAFVPVMLMFAAIPFAD----GAMLVDLNIGILYIL
NUOH_RHOSR      RGMLQSLADGIKLALKEGIVPKGVDKPIYILAPVIAAVPAFMAFAVIPFGPAVSIFGHLTDLPVAVLYVL
NUOH_MOOTA      HGLLQSVADAVKLLGKEDIIPRGADRWVFIIAPVLIFIPATMLYAVIPFGK----GMVPADLNIGVFYFL
NUOH_MYCVP      HGLLQSLADGVKLALKEGLVPAGVDKWIYLAAPIISVIPAFMAFAVIPMG--GEVSVQLTDLPVAVLYIL
NUOH_MYCSS      KGLLQSLADGIKLALKEGITPAGVDKPVYLLAPVISVIPAFLAFAVIPMG--GEVSVQLTDLAVAVLYIL
NUOH_MYCSK      KGLLQSLADGIKLALKEGITPAGVDKPVYLLAPVISVIPAFLAFAVIPMG--GEVSVQLTDLAVAVLYIL
NUOH_MYCSJ      KGLLQSLADGIKLALKEGITPAGVDKPVYLLAPVISVIPAFLAFAVIPMG--GEVSVQLTDLAVAVLYIL
NU1C_PLEBO      LGVLAPLADGLKLVLKEDVVPAKADKLLFTLGPAIVVIPVFLSYLILPFGQ----NLQITDVGLGIFLWI
NUOH_MYCGI      RGLLQSLADGIKLALKEGLVPAGVDKWIYLAAPVISVIPAFMAFAVIPLGPEVSVFGHLTDLPVAVLYIL
NUOH_BREBN      LGLLQTVADVAKLLLKEDIRPQHADKALFTLAPILAYAPAFAVLAVMPFTD----SIRFADLGIGLLYYI
NUOHI_NOCFA     FGSLQSIADGVKMAFKEDLVPAIVDKPIYLLAPVVSVIPAFMAFAVIPLG--GEVSVQLTDMPVGVLYIL
NUOH2_GEOMG     HGLLQPIADGVKLFFKEEIIPSKADKFAFLIAPLIALVPAFIGFAVIPFGEVGPLQIQVVDLNVGVLYIL
NU1C_CYAP4      LGVLAPVADGLKLLFKEDIVPANADAALFTLGPILVVIPVFLSYLIVPFGQ----NLLISDLGIGVFLWI
NUOH_MYCS2      AGLLQSLADGIKLALKEGLVPAGVDKPIYLLAPVISVIPAFVAFSVIPLGGAVSVFGHLTDLPVAVLFIL
NUOH_CARHZ      RGIFQTVADTVKLFAKEIFIPNNVDRWPYLLAPVLIFTIPVMLFLVIPFGKMVPYDLNL-----GVLYLV
NU1C_SYNP6      LGVLQSAADGLKLILKEDIIPAKADAFLFTIGPALVVIPVFLSYLIVPFGQ----ELIITNVGAGVFLWI
NU1C_SYNE7      LGVLQSAADGLKLILKEDIIPAKADAFLFTIGPALVVIPVFLSYLIVPFGQ----ELIITNVGAGVFLWI
NU1C_ACAM1      LGILAPVADGIKLVFKEDIVPANTDPWLFTLGPILVVIPVFFSYLIVPFGQ----NILITDLGIGIFFWI
NU1C_SYNJB      QGVLIPIADGIKLLTKEDVLPILADPVLFTLGPILVFLPVFLCYLVVPFGQ----NLLISNIAIGVFFLI
NU1C_PROMS      LGVLQPIADGLKLLVKEDIIPAKADGILFTAGPILVLVPVILSWLIVPFGQ----NLLISNVGIGIFLWI
NU1C_PROMP      LGVLQPIADGLKLLVKEDIIPAKADSILFTAGPILVLVPVILSWLIVPFGQ----NLLISNVGIGIFLWI
NU1C_SYNJA      QGVLIPIADGIKLLTKEDVLPSLADPVLFTLGPILVFLPVFLCYLVVPFGQ----NLLISNIAIGVFFLI
NU1C_PROM9      LGVLQPIADGLKLLVKEDIIPAKADGILFTAGPILVLVPVILSWLIVPFGQ----NLLISNVGIGIFLWI
NU1C_PROM2      LGVLQPIADGLKLLVKEDIIPAKADGILFTAGPILVLVPVILSWLIVPFGQ----NLLISNVGIGIFLWI
NU1C_PROM0      LGVLQPIADGLKLLVKEDIIPAKADGILFTAGPILVLVPVILSWLIVPFGQ----NLLISNVGIGIFLWI
NUOH1_GEOSL     HGLLQPIADGLKLFFKEEIVPSQADKFAFLIAPIIALVPAFIGFAVIPFGETIPLQIQVVDMNVGVLYIL
NU1C_SYNY3      LGVLQPVADGIKLVFKEDVVPAKADPWXXXXXXXXXXXXXXXSYLIVPFGQ----NLVITDINVGIFLWI
NU1C_NOSP7      FGLLVPVADGLKLVFKEDIVPAKSDPWLFTLGPIIVVIPVFLSFLIVPFGQ----NIVISNVGMGVFLWI
NUOH_BACCR      FGLLQTVADVLKLLLKEDSIPKAADKPLFILAPVIAFAPAFMVLAVIPFTD----KFQFADIGVGLLYYX
NUOH_BACC4      FGLLQTVADVLKLLLKEDSIPKAADKPLFILAPVIAFAPAFMVLAVIPFTD----KFQFADIGVGLLYYX
NUOH_BACC2      FGLLQTVADVLKLLLKEDSIPKAADKPLFILAPVIAFAPAFMVLAVIPFTD----KFQFADIGVGLLYYX
NUOH_BACCZ      FGLLQTVADVLKLLLKEDSIPKAADKPLFILAPVIAFAPAFMVLAVIPFTD----KFQFADIGVGLLYYX
NUOH_BACCQ      FGLLQTVADVLKLLLKEDSIPKAADKPLFILAPVIAFAPAFMVLAVIPFTD----KFQFADIGVGLLYYX
NUOH_BACC7      FGLLQTVADVLKLLLKEDSIPKAADKPLFILAPVIAFAPAFMVLAVIPFTD----KFQFADIGVGLLYYX
NUOH_BACC3      FGLLQTVADVLKLLLKEDSIPKAADKPLFILAPVIAFAPAFMVLAVIPFTD----KFQFADIGVGLLYYX
NUOH_BACC1      FGLLQTVADVLKLLLKEDSIPKAADKPLFILAPVIAFAPAFMVLAVIPFTD----KFQFADIGVGLLYYX
NUOH_BACC0      FGLLQTVADVLKLLLKEDSIPKAADKPLFILAPVIAFAPAFMVLAVIPFTD----KFQFADIGVGLLYYX
NUOH_BACAN      FGLLQTVADVLKLLLKEDSIPKAADKPLFILAPVIAFAPAFMVLAVIPFTD----KFQFADIGVGLLYYX
NUOH_BACAH      FGLLQTVADVLKLLLKEDSIPKAADKPLFILAPVIAFAPAFMVLAVIPFTD----KFQFADIGVGLLYYX
NUOH_BACAC      FGLLQTVADVLKLLLKEDSIPKAADKPLFILAPVIAFAPAFMVLAVIPFTD----KFQFADIGVGLLYYX
NUOH_BACAA      FGLLQTVADVLKLLLKEDSIPKAADKPLFILAPVIAFAPAFMVLAVIPFTD----KFQFADIGVGLLYYX
NU1C_CHLAT      LGVLQPLADGLKLVFKEDIIPSKADIWLFTLGPALVVIPVFLAYLVVPFGH----DLVVADISLGVFFWI
NUOH_BACHK      FGLLQTVADVLKLLLKEDSIPKAADKPLFILAPVIAFAPAFMVLAVIPFTD----KFQFADIGVGLLYYX
NUOH_BACWK      FGLLQTVADVLKLLLKEDSIPKAADKPLFILAPVIAFAPAFMVLAVIPFTD----KFQFADIGVGLLYYX
NUOH_PELCD      GGMLQPLADLIKLLCKEDLIPQRADRWVFMLAPAISTITALLAFAVIPFG--APLQLFICDLNIGLLYLF
NUOH_MAGSA      FGLLQPMADGLKLFVKETVLPTSANRVVFVGAPMLTFFLALVAWAVIPFDK----GWVLADINVGVLYLF
NUOH_ANOFW      WGLLQTVADVLKLLLKEDTIPKAADRPLFILAPVIAFAPAFMVLAALPFTDA----LQFADIGVGLLYYI
NU1C_NEPOL      LGLLQPLADGLKLVFKEDVVPAKSDTWLFTLGPAVVVIPIFLAYLVVPFGQ----QLIIADLRIGIFFWI
NU1C_MICAN      LGVLQPVADGLKLVFKEDVVPAKADPWLFLFGPILVVMPVFVSYLIVPFGQ----NLLITDLNVGIFLWI
NU1C_ANASP      LGLLAPVADGLKLVFKEDIVPAQADPWLFTLGPILVVLPVFLSYLIVPFGQ----NIVITNVGTGIFLWI
NUOH2_GEOSL     FGLLQPLADLIKLLTKEDFRPAGADKWLFYLAPAMAAVPAILTFAVIPFGALGEIPLQVADLNVGLLFFL
NUOH_BACCN      FGLLQTVADVLKLLLKEDSIPKAADKXXXXXXXXXXXXXXXMVLAVIPFTS----QFQFADIGVGLLYYI
NUOH_DESPS      WGLLQPPVDGIKLMTKQLVIPGGVDKILFMVAPVLAMFPALMSFVTIPFSE----NIVAHNMDIGLLVIL
NU1C_PROM5      LGVLQPIADGLKLLVKEDIIPAKADSILFTTGPILVLVPVILSWLIVPFGQ----NLLISNVGIGIFLWI
NUOH_PARUW      FGLFQPLADGIKLLCKERFQPANVETFVYWLAPGISLFTALFIFVLIPFGGVVEIALQIADINVGVVFLL
NUOH_BACV8      QGTIQVFADVFKMLIKEIITIRHADKFLYNLAPYIVILASIMAFSCLPINK----GMEVLDFNVGIFFLL
NUOH_GEOKA      FGLLQTVADVLKLLLKEDTIPKAADRPLYVLAPIIAFVPSFMVLAVLPFTDA----FRFADIGVGLLYYI
NUOH1_SYNFM     HGLLQTIMDGIKLVGKELITPRSVDRKLFILAPVLVFMPVLVGFLVLPFGP----GLILRDMNVGILLIF
NUOH_ACIC1      FGLLQSLADGLKLALKEDIVPTLADKAVFILAPVISATPAFLAFAVIPFGPTVSINLQLTDLPVAVLFVL
NU1C_SYNP2      LGVLQPVADGLKLVFKEDVVPAKTDPWLFTLGPALVVIPVFLSYLIVPFGQ----NLVITDLNVGIFLWI
NUOH_RHORT      FGLLQPLADGVKLFLKETIIPTGANRAVFIIAPLMTFILALIAWAVIPFDA----GWVVADINVGVLYLF
NUOH1_NITMU     FGVLQIVADSIKLLTKEDWIPPFADRAVFVLAPXXXXXXXXXXXXXXPIAP----GIGVVDLNIGVLFFL
NU1C_CHAVU      LGIMQAIVDGVKLLIKEDIIPAQGDRWLFSIGPVLVVTPVILSYLVVPFGK----NIILSDIRLGIFFWI
NQO8_RHOMR      AGFLQPFADVVKLLFKEDIIPAQANRFIHALAPTIMVTIAMTVPALIPFAR----GVVIADIDVGVLAIL
NUOH_PSEPW      FGMFQIAADMLKMFFKEDWNPPFVDKMIFTLAPVVAMSALLIGFSIIPITP----GWGVADLNIGLLFFF
NUOH_PSEPG      FGMFQIAADMLKMFFKEDWNPPFVDKMIFTLAPVVAMSALLIGFSIIPITP----GWGVADLNIGLLFFF
NUOH_RICCN      FGLLQPIADAVKLLFKEPIIPTNSDKILFILAPMITFILSLIGWAVIPFAK----GVVLADINVGVLYIL
NUOH_CHRSD      FGVLQIVADMLKIVFKEDWIPPFADRGLFVLAPAIAMASLLLSFMVIPITP----SWGVADLHIGLLFFF
NU1C_CYAA5      LGVLQPVADGIKLVFKEDVIPAKADPWXXXXXXXXXXXXXXXXXXIVPFGQ----NLVITDLNVGIFFWI
NUOH_PSEPK      FGMFQIAADMLKMFFKEDWNPPFVDRVIFTLAPVVAMSALLIAFVVIPITPTWGV----ADLNIGLLFFF
NUOH_PSEP1      FGMFQIAADMLKMFFKEDWNPPFVDRVIFTLAPVVAMSALLIAFVVIPITPTWGV----ADLNIGLLFFF
NUOH_ACIAD      GGMFQIVADMLKIMFKEDWTPKFADKLTFRMAPAVAMATAVLSFIVIPVSP----TLGVADMSIGLLFFM
NUOH_CHLCH      WGILQTLADILKLLQKEDIVPLSADKFLFVIGPGVLFVGSFLAFAVLPFSPIG------ASLNVGLFYAV
NUOH1_GEOMG     FGLLQPLADLIKLLTKEDFRPAGADKWLFYXXXXXXXXXXXXTFAVIPFG--APLTLQVADLNVGLLFFL
NU1C_ANTFO      LGIIQALADGTKLLLKEDIIPSRGDALLFSIGPAIVVIPVLLSYLVIPFGH----NIILADLNIGVFFWI
NUOH_MAGSM      FGILQPLADAVKLFVKETMLPAKAHRTMFILAPILTFSTALVSWAVVPFSP----ELVLADVNVGVLFIL
NUOH_AQUAE      FGILQPLADALKLATKEVIIPRGADKPVYYAAVVMALVPSILLLTIIPFGRVGNTYIEIADVNIXXXXXX
NUOH1_NITOC     FGILQVVADAIKLLTKEDWVPPFADKLVFILAPTVVVIATLLAFAVIPFTPY----IGIIDLNIGLLFFL
NUOH_PSEE4      FGMFQIAADMLKMFFKEDWNPPFVDRMIFTLAPVVAMSALLIAFVVIP---ITPL-WGVADLNIGLLFFF
NUOH_CHLPD      WGILQTLADILKLLQKEDIVPAAADKFLFVVGPGILFVGSFLAFAVLPFSSIG------ANLNVGLFYAI
NU1C_JASNU      LGILQALADGTKLLFKENLFPSRGDTRLFTIGPSIAVISILLSYSVIPFGY----RLILGDLSIGVFLWI
NU1C_ANGEV      LGIIQALADGIKLLLKEDVIPARGDIWLFNVGPAIVVIPVFLSYLVIPFGK----HIILADLGIGVFFWI
NUOH_ACIBT      GGMFQIVADMLKIMFKEDWTPKFADKLTFRLAPAVAMATAVLSFMVIPVSPA----LGVADMSIGLLFFM
NU1C_GLOVI      GGSIQGAADGVKLLVKEDIIPVKADPWLFTLGPAIVIIPVFFSYLVIPFGQ----GLVLSDITIGIFFII
NUOH_PSYCK      FGSLQLVADMLKIFFKEDWTPNFTDKFMFTLAPAVAMFTALASFAIIPISP----TLGVADWDIGILFFF
NU1C_MAIZE      LGLLQAIADGTKLLLKEDILPSRGDIPLFSIGPSIAVISILLSFLVIPLGY----RFVLADLSIGVFLWI
NUOH_PSYA2      FGSLQLVADMLKIFFKEDWTPNFTDKFMFTLAPAVAMFTALASFAIIPISP----TLGVADWDIGILFFF
NUOH1_CYTH3     FGLLQPLADGVKFFMKEEIIPSSANKALFILGPSIAMMTACLTGAVIPWGEIGQIALQVTDINIGVLYIF
NU1C_CYAP7      LGVLQPVADGLKLVFKEDVVPAKADPWXXXXXXXXXXXXXXXXXXIVPFGQ----NLVITDLNVGIFLWI
NUOH_PSESM      FGMFQIAADMLKMFFKEDWTPPFADKVIFTLAPVVAMSALLIAFAVIPITPTWGV----ADLNIGLLFFF
NUOH_PSEF5      FGMFQIAADMLKMFFKEDWTPPFADKVIFTLAPVVAMSALLIAFAIIPITPTWGV----ADLNIGLLFFF
NUOH_PSEU2      FGMFQIAADMLKMFFKEDWTPPFADKVIFTLAPVVAMSALLIAFAVIPITPTWGV----ADLNIGLLFFF
NUOH_PSE14      FGMFQIAADMLKMFFKEDWTPPFADKVIFTLAPVVAMSALLIAFAVIPITPTWGV----ADLNIGLLFFF
NU1C_CYAP8      LGVLQPVADGIKLVFKEDIIPAKADPWXXXXXXXXXXXXXXXXXXIVPFGQ----NLVITDLNVGIFLWI
NU1C_CUCSA      LGVLQALADGTKLLFKENLLPSRGDTRLFSIGPSIAVISILLSYSVIPFGY----RLVLADLPIGVFLWI
NUOH_RALEH      LGLLQPIADVLKLLLKEVMMPTQVSRGMYLIAPLMVLMPAVAVWAVIPF----QAEVVLADVNAGLLYVM
NU1C_STAPU      LGIIQALIDGLKLILKEDIIPSKGDNWLFTLGPAIVVIPIVLSYLVVPFGP----NLIVADIGIGIFFWI
NUOH_RHOCS      WGILQSFADALKMIGKETIIPAGANRIIFXXXXXXXXXXXXXXXXVIPFGE----GLVISDINVGILYLL
NUOH_ORITI      FGLLQPIADAVKLVFKEPIIPAKADRKLFIIAPIITFVLSLLGWSVIPIDHDIVLSIHIG----GILFIL
NUOH_DINSH      FGLLQTVADALKYVVKEVVVPAGADKPVFMLAPMTSFVLAMIAWAVIPFND----GWVLADINVAILYVF
NUOH_DESHY      RGWFQTIADALKLLGKEDLTPANADRIMFKIAPMFIFGIPILTLTIIPFGYA----MTVIDLELGVFFYL
NU1C_LOTJA      FGVLQALADGTKLLFKENLIPSRGDIRLFSIGPSISVISILITYLVIPFSY----NFVLSDLNIGVFLWI
NUOH_PELLD      WGILQTLADILKLLQKEDIVPTSADKFLFVIGPGVLFVGSFLAFAVLPFGPIG------ANLNVGLFYAI
NUOH_ORITB      FGLLQPIADAIKLVFKEPIIPAKADRKLFIIAPIITFVLSLLGWSVIPIDHDIVLSIHIG----GILFIL
NUOH_GRABC      WGMLQAFADAGKMLLKETIIPDGANKVLFILAPLLTFILAMIAWAVVPVND----GWAVANINVGVLYLF
NU1C_POPTR      FGVLQALADGTKLLFKENLFPSRGDTRLFSIGPSIAVISTLLSYSVIPFGY----HFVLADLNIGVFLWI
NUOH_PSEPF      FGMFQIAADMLKMFFKEDWTPPFADKVIFTLAPVVAMSALLIAFAIIPITPTWGV----ADLNIGLLFFF
NUOH_BACTN      WGSIQVICDVLKMLTKEIFTPKDADRFLYNLAPFMVIIASFLTFACIPFNK----GAEILNFNVGVFFLL
NUOH_GEOTN      LGLLQTVADVLKLLLKEDTIPKAADRPLYVLAPIIAFTPSFMVLAALPFTDA----FRFADIGVGLLYYI
NU1C_POPAL      FGVLQALADGTKLLFKENLFPSRGDTRLFSIGPSIAVISTLLSYSVIPFGY----HFVLADLNIGVFLWI
NU1C_ORYSJ      LGLLQAIADGTKLLFKEDILPSRGDIPLFSIGPSIAVISILLSFLVIPLGY----RFVLADLSIGVFLWI
NU1C_ORYSI      LGLLQAIADGTKLLFKEDILPSRGDIPLFSIGPSIAVISILLSFLVIPLGY----RFVLADLSIGVFLWI
NU1C_ORYSA      LGLLQAIADGTKLLFKEDILPSRGDIPLFSIGPSIAVISILLSFLVIPLGY----RFVLADLSIGVFLWI
NU1C_ORYNI      LGLLQAIADGTKLLFKEDILPSRGDIPLFSIGPSIAVISILLSFLVIPLGY----RFVLADLSIGVFLWI
NUOH_NITWN      WGLFQSFADLLKFVLKEPIIPSGANKGVFLLAPLVSCVLALAAWAVIPVN----LNWVIADINVGILYIF
NUOH_LEPBP      FGIFQPLADGIKFIAKEEIFPKNVSKGMYLLAPTISMTCAIMAWAVIPFGGTLPIDLQIANPDSGVLYML
NUOH_LEPBA      FGIFQPLADGIKFIAKEEIFPKNVSKGMYLLAPTISMTCAIMAWAVIPFGGTLPIDLQIANPDSGVLYML
NU1C_TOBAC      LGILQALADGTKLLLKENLIPSTGDTRLFSIGPSIAVISIFLSYSVIPFGD----HLVLADLSIGVFFWI
NU1C_SACOF      LGLLQAIADGTKLLLKEDILPSRGEIPLFSIGPSIAVISILLSFLVIPLGY----HFVLADLSIGVFLWI
NU1C_SACHY      LGLLQAIADGTKLLLKEDILPSRGEIPLFSIGPSIAVISILLSFLVIPLGY----HFVLADLSIGVFLWI
NUOH_RICPR      FGLLQPIADAVKLLFKEPIIPTDADKILFILAPIITFVLSLIGWAVIPFSS----GVVLADINVGVLYIL
NUOH_RALME      LGLLQPIADVLKLLLKEVMFPSQINRGMYLVAPLMVLMPAVAVWAVIPF----QAEVVMADINAGLLYVM
NUOH_RALEJ      LGLLQPIADVLKLLLKEVMTPTHVSKGMYLIAPLMVLMPAVAIWAVIPF----QAEVVMADVNAGLLYVM
NUOH_EHRRW      FGLLQPFADAIKLIIKEPIIPFKANKLCFLIAPVITFTLALLGWAVIPFGSIVP-NV-IANINIGVLYIL
NUOH_EHRRG      FGLLQPFADAIKLIIKEPIIPFKANKLCFLIAPVITFTLALLGWAVIPFGSIVP-NV-IANINIGVLYIL
NUOH_CUPTR      LGLLQPIADVLKLLLKEVMMPTQVSRGMYLIAPLMVLMPAVAIWAVIPF----QAEVVMADVNAGLLYVM
NUOH_RICCK      FGLLQPIADAVKLLFKEPIIPTNSDRILFILAPMITFILSLIGWAVVPFAK----GLVLADINVGVLYIL
NUOH_FLAPJ      GGLLQPLADGLKLFSKEEFEPNTPNKFLFVVGPAIAMSTALMTSAVIPWGD----KLHLTDIDNALLYIF
NU1C_CYCTA      LGILQALADGIKLLLKEDIIPSRGDLWLFSIGPAIVVIPILSSYLVIPFGR----HIVLADLSIGVFFRI
NUOH_RICB8      FGLLQPIADAVKLLFKEPIIPTNADKILFVLAPMITFILSLIGWAVIPFAK----GVVLADINVGVLYIL
NUOH_RHILO      WGTLQAFADLLKFVFKEPVIPSGANKGVFLLAPLVSAVLAISAWAVIPVNQ----GWAIANVNVGILYVF
NUOH_MYCTU      KGALQSLADGIKLALKESITPGGIDRFVYFVAPIIXXXXXXXGPEVSVFGHRTPLQI--TDLPVAVLFIL
NUOH_MYCTA      KGALQSLADGIKLALKESITPGGIDRFVYFVAPIIXXXXXXXGPEVSVFGHRTPLQI--TDLPVAVLFIL
NUOH_MYCBT      KGALQSLADGIKLALKESITPGGIDRFVYFVAPIIXXXXXXXGPEVSVFGHRTPLQI--TDLPVAVLFIL
NUOH_MYCBP      KGALQSLADGIKLALKESITPGGIDRFVYFVAPIIXXXXXXXGPEVSVFGHRTPLQI--TDLPVAVLFIL
NUOH_MYCBO      KGALQSLADGIKLALKESITPGGIDRFVYFVAPIIXXXXXXXGPEVSVFGHRTPLQI--TDLPVAVLFIL
NU1C_SPIOL      LGILQALADGTKLLFKENLLPSRGDTYLFSIGPSIAVISILLGYLIIPFGS----RLVLADLSIGVFLWI
NU1C_LACSA      LGILQALADGTKLLFKENLLPSRGDTRLFSIGPSIAVISILLSYLVIPFSY----HLVLADLSIGVFLWI
NUOH2_RHOPB     FGFLQWVADTVKILTKEDRPPPGADRVAYILAPMVAATPVLAGFGVVAFGD----GLALANIDVGVMFLL
NUOH_RICBR      FGLLQPIADAVKLLFKEPIIPTNADKILFVLAPMITFILSLIGWAVIPFAK----GVVLADINVGVLYIL
NUOH_MYCUA      KGSLQSLADGIKLALKESITPGGIDRFVYFVAPIISVXXXXXXXXXXXXGPVVSVFGHLTDLPVAVLFIL
NUOH_BARQU      WGLLQSFADLIKFVVKEPIIPAGANKGVFLLAPFVSATLALSTWAVIPVNE----GWEVAKINVGLLYIL
NUOH_BARHE      WGLLQSFADLIKFVVKEPIIPAGANKGVFLLAPFVSATLALSTWAVIPVNE----GWAVANINVGLLYIL
NUOH_AZOSE      KGLLQPIADGMKLLFKEIIVPTGASKGLFILGPILAIAPSLAAWAVVPFGE----GMVLADVNAGLLFLL
NU1C_HORVU      LGLLQAIADGTKLLFKEDILPSRGDISLFSIGPSIAVISVLLSFLVIPLGY----HFVLADLSIGVFLWI
NU1C_WHEAT      LGLLQAIADGTKLLFKEDILPSRGDISLFSIGPSIAVISVLLSFLVIPLGY----HFVLADLSIGVFLWI
NUOH_THERP      FGLLQPIADGIKLLAKEDIVPANADRLVFLVAPLLSFALAPLGAAVIPFGQLFGIEIPLADINVAVLYVL
NUOH_SPHAL      FGLLQSFADGLKVFLQETIIPSGANRGLFLIAPIITFTVALLAWAVIPFNS----GAVLADINVGLLYIL
NUOH_RICFE      FGLLQPIADAVKLLFKEPIIPTNSDKILFILAPMITFILSLIGWAVIPFAK----GVVLADINVGVLYIL
NUOH_HELAH      FGLLQVAADGIKLFTKEDIIPQGANKLIFTLAPIIAMVSAFVSMAPIPFFEIKPI---ISDINIGFLFFL
NUOH_BURXL      AGLLQPIADVLKLLLKEVIQPAQASRWIYMVAPIMVVVPAFAVWAVIPF-QAGAV---LGDINAGLLYAM
NU1C_VITVI      LGILQALADGTKLLFKENLLPSRGDTRLFSIGPSIAVISILLSYLIIPFGS----NLVLSDLNIGVFLWI
NU1C_PELHO      FGILQALADGTKLLLKENLLPSRGDSPLFSIGPSMAVISILLSYSVIPFSY----RLVLADLNVGVFLWI
NUOH_CITK8      GGSLQLVADMIKMFFKEDWIPKFSDRVIFTLAPMIAFTSLLLAFAIVP---VSPTWV-VADLNIGILFFL
NUOH_HELPY      FGLLQVAADGIKLFTKEDIIPQGANKFIFTLAPIIAMVSAFVSMAPIPFFEIKPL---ISDINIGFLFFL
NU1C_MORIN      LGVLQALADGAKLLFKENLFPSRGETRLFSIGPSIAVISILVSYSVVPFGS----HLVLVDLNIGVFLWI
NU1C_DRIGR      LGILQALADGTKLLFKEDLLPSRGDIRLFSIGPSIAVISILLSYSVIPFGY----RLVLADLSIGVFLWI
NUOH_SALTY      GGSLQLVADMIKMFFKEDWIPKFSDRVIFTLAPMIAFTSLLLSFAIVPVSP----NWVVADLNIGILFFL
NUOH_SALPC      GGSLQLVADMIKMFFKEDWIPKFSDRVIFTLAPMIAFTSLLLSFAIVPVSP----NWVVADLNIGILFFL
NUOH_SALPB      GGSLQLVADMIKMFFKEDWIPKFSDRVIFTLAPMIAFTSLLLSFAIVPVSP----NWVVADLNIGILFFL
NUOH_SALPA      GGSLQLVADMIKMFFKEDWIPKFSDRVIFTLAPMIAFTSLLLSFAIVPVSP----NWVVADLNIGILFFL
NUOH_SALNS      GGSLQLVADMIKMFFKEDWIPKFSDRVIFTLAPMIAFTSLLLSFAIVPVSP----NWVVADLNIGILFFL
NUOH_SALDC      GGSLQLVADMIKMFFKEDWIPKFSDRVIFTLAPMIAFTSLLLSFAIVPVSP----NWVVADLNIGILFFL
NUOH_SALCH      GGSLQLVADMIKMFFKEDWIPKFSDRVIFTLAPMIAFTSLLLSFAIVPVSP----NWVVADLNIGILFFL
NUOH_SALA4      GGSLQLVADMIKMFFKEDWIPKFSDRVIFTLAPMIAFTSLLLSFAIVPVSP----NWVVADLNIGILFFL
NUOH_RICRS      FGLLQPIADAVKLLFKEPIIPTNADKILFILAPMITFILSLIGWAVIPFAK----GVVLADINVGVLYIL
NUOH_RICRO      FGLLQPIADAVKLLFKEPIIPTNADKILFILAPMITFILSLIGWAVIPFAK----GVVLADINVGVLYIL
NUOH_ESCF3      GGSLQLVADMIKMFFKEDWIPKFSDRVIFTLAPMIAFTSLLLAFAIVPVSP----GWVVADLNIGILFFL
NUOH_ENTS8      GGSLQLVADMIKMFFKEDWIPRFSDRVIFTLAPMIAFTSLLLAFAIVP---VSPTWV-VADLNIGILFFL
NU1C_GOSBA      LGLLQALADGTKLLFKENILPSRGNTRLFSIGPAIAVISILLSFSVIPFSS----RLILADLNIGIFLWI
NU1C_ATRBE      LGILQALADGTKLLFKENLIPSTGDPRLFSIGPSIAVISIFLSYSVIPFGD----HLVLADLSIGVFLWI
NUOH_SHISS      GGSLQLVADMIKMFFKEDWIPKFSDRVIFTLAPMIAFTSLLLAFAIVPVSP----GWVVADLNIGILFFL
NUOH_SHIDS      GGSLQLVADMIKMFFKEDWIPKFSDRVIFTLAPMIAFTSLLLAFAIVPVSP----GWVVADLNIGILFFL
NUOH_SHIBS      GGSLQLVADMIKMFFKEDWIPKFSDRVIFTLAPMIAFTSLLLAFAIVPVSP----GWVVADLNIGILFFL
NUOH_SHIB3      GGSLQLVADMIKMFFKEDWIPKFSDRVIFTLAPMIAFTSLLLAFAIVPVSP----GWVVADLNIGILFFL
NUOH_SALTI      GGSLQLVADMIKMFFKEDWIPKFSDRVIFTLAPMIAFTSLLLSFAIVPVSP----NWVVADLNIGILFSL
NUOH_SALAR      GGSLQLVADMIKMFFKEDWVPKFSDRVIFTLAPMIAFTSLLLSFAIVPVSP----NWVVADLNIGILFFL
NUOH_LEGPL      KGLLQPFADLLKLITKEIIVPTRSNKYLFVIAPLFALVPSLVGWAVIPFQE----GVVLANINAGVLYLF
NUOH_ECOUT      GGSLQLVADMIKMFFKEDWIPKFSDRVIFTLAPMIAFTSLLLAFAIVPVSP----GWVVADLNIGILFFL
NUOH_ECOSM      GGSLQLVADMIKMFFKEDWIPKFSDRVIFTLAPMIAFTSLLLAFAIVPVSP----GWVVADLNIGILFFL
NUOH_ECOSE      GGSLQLVADMIKMFFKEDWIPKFSDRVIFTLAPMIAFTSLLLAFAIVPVSP----GWVVADLNIGILFFL
NUOH_ECOLU      GGSLQLVADMIKMFFKEDWIPKFSDRVIFTLAPMIAFTSLLLAFAIVPVSP----GWVVADLNIGILFFL
NUOH_ECOLI      GGSLQLVADMIKMFFKEDWIPKFSDRVIFTLAPMIAFTSLLLAFAIVPVSP----GWVVADLNIGILFFL
NUOH_ECOLC      GGSLQLVADMIKMFFKEDWIPKFSDRVIFTLAPMIAFTSLLLAFAIVPVSP----GWVVADLNIGILFFL
NUOH_ECOL6      GGSLQLVADMIKMFFKEDWIPKFSDRVIFTLAPMIAFTSLLLAFAIVPVSP----GWVVADLNIGILFFL
NUOH_ECOL5      GGSLQLVADMIKMFFKEDWIPKFSDRVIFTLAPMIAFTSLLLAFAIVPVSP----GWVVADLNIGILFFL
NUOH_ECOK1      GGSLQLVADMIKMFFKEDWIPKFSDRVIFTLAPMIAFTSLLLAFAIVPVSP----GWVVADLNIGILFFL
NUOH_ECOHS      GGSLQLVADMIKMFFKEDWIPKFSDRVIFTLAPMIAFTSLLLAFAIVPVSP----GWVVADLNIGILFFL
NUOH_ECODH      GGSLQLVADMIKMFFKEDWIPKFSDRVIFTLAPMIAFTSLLLAFAIVPVSP----GWVVADLNIGILFFL
NUOH_ECOBW      GGSLQLVADMIKMFFKEDWIPKFSDRVIFTLAPMIAFTSLLLAFAIVPVSP----GWVVADLNIGILFFL
NUOH_ECO8A      GGSLQLVADMIKMFFKEDWIPKFSDRVIFTLAPMIAFTSLLLAFAIVPVSP----GWVVADLNIGILFFL
NUOH_ECO81      GGSLQLVADMIKMFFKEDWIPKFSDRVIFTLAPMIAFTSLLLAFAIVPVSP----GWVVADLNIGILFFL
NUOH_ECO7I      GGSLQLVADMIKMFFKEDWIPKFSDRVIFTLAPMIAFTSLLLAFAIVPVSP----GWVVADLNIGILFFL
NUOH_ECO5E      GGSLQLVADMIKMFFKEDWIPKFSDRVIFTLAPMIAFTSLLLAFAIVPVSP----GWVVADLNIGILFFL
NUOH_ECO57      GGSLQLVADMIKMFFKEDWIPKFSDRVIFTLAPMIAFTSLLLAFAIVPVSP----GWVVADLNIGILFFL
NUOH_ECO55      GGSLQLVADMIKMFFKEDWIPKFSDRVIFTLAPMIAFTSLLLAFAIVPVSP----GWVVADLNIGILFFL
NUOH_ECO45      GGSLQLVADMIKMFFKEDWIPKFSDRVIFTLAPMIAFTSLLLAFAIVPVSP----GWVVADLNIGILFFL
NUOH_ECO27      GGSLQLVADMIKMFFKEDWIPKFSDRVIFTLAPMIAFTSLLLAFAIVPVSP----GWVVADLNIGILFFL
NUOH_ECO24      GGSLQLVADMIKMFFKEDWIPKFSDRVIFTLAPMIAFTSLLLAFAIVPVSP----GWVVADLNIGILFFL
NUOH_BURTA      AGLLQPIADVLKLLLKEVIHPTAASRWLYLIAPVMTVVPAFAVWAVIPF-QAGAV---LANINAGLLYAM
NU1C_GOSHI      LGILQALADGTKLLFKENILPSRGNTRLFSIGPAIAVISILLSFSVIPFSS----RLILADLNIGIFLWI
FPOH_METMA      FGLLQLVADAIKLFTKEDVRPGNADRFLYDNAPVFMLTSLFLMLVAIPVGAVGNLYLAVTEMDISILFIE
NUOH_RALSO      MGLLQPIADVLKLLLKEVMVPSAVSRGMYIIAPLMVLMPAVAIWAVVPF----QAEAVVSNINAGLLYVM
NUOH_HELPS      FGLLQVAADGIKLFTKEDIIPQGANKFIFTLAPIIAMVSAFVSMAPIPFFEIKPL---ISDINIGFLFFL
NUOH_HELPJ      FGLLQVAADGIKLFTKEDIIPQGANKFIFTLAPIIAMVSAFVSMAPIPFFEIKPL---ISDINIGFLFFL
NUOH_HELP2      FGLLQVAADGIKLFTKEDIIPQGANKFIFTLAPIIAMVSAFVSMAPIPFFEIKPL---ISDINIGFLFFL
NUOH_BURPP      AGLLQPIADVLKLLLKEVIQPAQASRWIYLIAPIMVVVPAFAVWAVIPF-QAGAV---LGDINAGLLYAM
NU1C_SYNS3      LGVLQPLADGLKLLVKEDIIPDRADSILFTLGXXXXXXXXXXXXXXXXFGQ----NLLISDVGVGIFLWI
NU1C_SOLTU      LGILQALADGTKLLLKENLIPSTGDTRLFSIGPSIAVISIFLSYSVIPFGD----HLVLADLSIGVFFWI
NU1C_SOLBU      LGILQALADGTKLLLKENLIPSTGDTRLFSIGPSIAVISIFLSYSVIPFGD----HLVLADLSIGVFFWI
NU1C_NICTO      LGILQALADGTKLLLKENLIPSTGDTRLFSIGPSIAVISIFLSYSVIPFGD----HLVLADLSIGVFFWI
NU1C_ARATH      LGILQALADGTKLLFKENLRPSRGNTPLFSIGPSIAVISILLSYSVIPFSN----HLVLADLNIGIFLWI
NU1C_ANAVT      LGLLAPVADGLKLVFKEDIVPAQADPWLFTLGPILVVLPVFLSYLIVPFGQ----NIVITNIGTGIFLWI
NUOH_NEOSM      FGLLQPIADAIKVLLKEIIIPNAASPKLFLFAPVIIFVLALVGWAVIPFGEIDGVEVPIANVNLGVMYLL
NUOH_LEGPH      KGLLQPFADLLKLITKEIIVPTRSNKYLFVIAPLFALVPSLVGWAVIPFQE----GIVLANINAGVLYLF
NUOH_BURPS      AGLLQPIADVLKLLLKEVIRPTAASRWLYLVAPVMTVVPAFAVWAVIPF-QAGAV---LANINAGLLYAM
NUOH_BURP6      AGLLQPIADVLKLLLKEVIRPTAASRWLYLVAPVMTVVPAFAVWAVIPF-QAGAV---LANINAGLLYAM
NUOH_BURP1      AGLLQPIADVLKLLLKEVIRPTAASRWLYLVAPVMTVVPAFAVWAVIPF-QAGAV---LANINAGLLYAM
NUOH_BURP0      AGLLQPIADVLKLLLKEVIRPTAASRWLYLVAPVMTVVPAFAVWAVIPF-QAGAV---LANINAGLLYAM
NUOH_BURMA      AGLLQPIADVLKLLLKEVIRPTAASRWLYLVAPVMTVVPAFAVWAVIPF-QAGAV---LANINAGLLYAM
NU1C_THEEB      LGILAPLADGLKLIFKEDVLPANSDRWLFTLGPAVVVIPVFLSYIIVPFGQ----NLLISNLAMGVFLWI
NU1C_PROMA      LGILQPMADGLKLLVKEDIIPDKADNLLFTLGXXXXXXXXXXXXXXXXFGQ----NLLISNVGIGIFLWI
NU1C_NYMAL      LGILQALADGVKLLFKEDLLPSRGDIRLFSVGPSVAVVSILLSYSVIPFGY----HLVLTDLSIGVFLWI
NU1C_COFAR      LGILQALADGTKLLFKENLLPSRGDARLFSIGPSIAVISILLSYSVIPFGY----RLVLADLTIGVFLWI
NU1C_CITSI      LGILQALADGTKLLFKENLLPSRGNSSLFSIGPSIAVIAILLSYSVIPFSY----NLVLADLNIGIFLWI
NUOH_RICPU      FGLLQPIADAVKLLFKEPIIPTNSDKILFILAPMITFILSLIGWAVIPFAK----GVVLADINVGVLYIL
NUOH_RALPJ      MGLLQPIADVLKLLLKEVMVPSAVSRGMYIIAPLMVLMPAVAIWAVIPF----QAEAMVSNINAGLLYVM
NUOH_PECCP      GGSLQLVADMIKMFFKEDWVPNFTDKVIFTLAPMIAFTSMLIAFAIVPITPTWGV----ADLNIGILFFL
NUOH_MYCPA      WGVLQSLADGIKLALKETITPGGVDKFVYFAAPVISXXXXXXXXXXXXXGPVVSVFGHLTDLPVAVLFIL
NUOH_HELPH      FGLLQVAADGIKLFTKEDIIPQGANKFIFTLAPIIAMVSAFVSMAPIPFFEIKPL---ISDINIGFLFFL
NUOH_HELPG      FGLLQVAADGIKLFTKEDIIPQGANKFIFTLAPIIAMVSAFVSMAPIPFFEIKPL---ISDINIGFLFFL
NU1C_PANGI      LGILQALADGTKLLFKENLLPSRGDTRLFSIGPSVAVTSILLSYLVIPFGY----HLVLADLSIGVFLWI
NU1C_DAUCA      LGILQALADGTKLLFKENLLPSRGDTRLFSIGPSIAVTSILLSYLVIPFGY----RLVLADVSIGVFLWI
NUOH_SHIFL      GGSLQLVADMIKMFFKEDWIPKFSDRVIFTLAPMIAFTSLLLAFAIVPVSP----GWVVADLNIGILFFL
NUOH_SHIF8      GGSLQLVADMIKMFFKEDWIPKFSDRVIFTLAPMIAFTSLLLAFAIVPVSP----GWVVADLNIGILFFL
NUOH_PSYWF      WGSLQLVADMLKIFFKEDWTPKFADKFMFILAPAVAMFTALASFAIIPVSPM----LGVADWNIGILFFF
NUOH_PROMH      AGSAQLIADMIKMFFKEDWIPKFADRFIFTIAPVIAFSSLLLSFAIVPVSSTWVV----ADLNIGILFFL
NUOH_OCHA4      WGLFQAFADLLKFVFKEPIIPSGANKGVFLLAPFVSAVLAMATWAVIPVNE----GWAIANINVGILYIF
NUOH_MYCA1      WGVLQSLADGIKLALKETITPGGVDKFVYFAAPVISXXXXXXXXXXXXXGPVVSVFGHLTDLPVAVLFIL
NUOH_BRUO2      WGLFQAFADLLKFVFKEPIIPSGANKGVFLLAPFISAVLAMATWAVIPVNE----SWAVANINVGILYIF
NU1C_SOLLC      LGILQALADGTKLLLKENLIPSTGDTRLFSIGPSIAVISIFLSYSVIPFGD----HLVLADLSIGVFFWI
NU1C_OLIPU      LGILQALADGTKLLFKENLRPSRGNTPLFSIGPSIAVISILLSYSVIPFSN----HLVLADLNIGIFLWI
NU1C_NUPAD      LGILQALADGVKLLFKEDLLPSRGDIRLFSVGPSIAVVSILLSYSVIPFGH----HLVLTDLSIGVSLWI
NU1C_NICSY      LGILQALADGTKLLLKENLIPSTGDTRLFSIGPSIAVISIFLSYSVIPFGD----HLVLADLSIGVFFWI
NU1C_EUCGG      LGILQALADGTKLIFKENLFPSRGDTRLFSIGPSIAVISILLSYSVIPFSY----HLVLSDLNIGVFLWI
NU1C_ARAHI      LGILQALADGTKLLFKEDLRPSRGNTPLFSIGPSIAVISILLSYSVIPFSN----HLVLADLNIGIFLWI
NUOH_NEIMF      WGLIQPFADVFKLLFKEVTRPKLSNKALFYIGPIMSLAPSFAAWAVIPFNE----EWVLTNINIGLLYIL
NUOH_CHLTE      WGLLQTLADILKLLQKEDIVPTVADKFLFVIGPGILFVGSFLAFAVLPFGPIG------ADLNVGLFYXX
NUOH_BURCM      AGLLQPIADVLKLLLKEVIQPSAASRWLYLIAPVMTVVPAFAVWAVIPF----QAEAVLANVNAGLLYAM
NUOH_BURA4      AGLLQPIADVLKLLLKEVIQPSAASRWLYLIAPVMTVVPAFAVWAVIPF----QAEAVLANVNAGLLYAM
NUOH_BRUSU      WGLFQAFADLLKFVFKEPIIPSGANKGVFLLAPFISAVLAMATWAVIPVNE----GWAVANINVGILYIF
NUOH_BRUSI      WGLFQAFADLLKFVFKEPIIPSGANKGVFLLAPFISAVLAMATWAVIPVNE----GWAVANINVGILYIF
NUOH_BRUME      WGLFQRFADLLKFVFKEPIIPSGANKGVFLLAPFIFAVLAMATWAVIPVNE----GWAVANINVGILYIF
NUOH_BRUMB      WGLFQAFADLLKFVFKEPIIPSGANKGVFLLAPFISAVLAMATWAVIPVNE----GWAVANINVGILYIF
NUOH_BRUC2      WGLFQAFADLLKFVFKEPIIPSGANKGVFLLAPFISAVLAMATWAVIPVNE----GWAVANINVGILYIF
NUOH_BRUAB      WGLFQAFADLLKFVFKEPIIPSGANKGVFLLAPFISAVLAMATWAVIPVNE----GWAVANINVGILYIF
NUOH_BRUA2      WGLFQAFADLLKFVFKEPIIPSGANKGVFLLAPFISAVLAMATWAVIPVNE----GWAVANINVGILYIF
NUOH_BACFR      WGSIQVLCDVLKMLTKEIIELKHSDKFLYNLAPFMVIIASFLTFSCLPISK----GLEVLDFNVGVFFLL
NUOH_BACFN      WGSIQVLCDVLKMLTKEIIELKHSDKFLYNLAPFMVIIASFLTFSCLPISK----GLEVLDFNVGVFFLL
NUOH_ANAPZ      WGLLQPFSDALKLLAKECIIPFKSRGWAFFAAPVITFALALAGWAVIPLGAVVVMPYVVADLNLGVLYVL
NU1C_NANDO      LGILQALADGTKLLFKEDLLPSRGDILLFSLGPSIAVISILLSYSVIPFGY----HLVLADLSIGVFLWI
NU1C_CAPBU      LGILQALADGIKLLFKENLRPSRGNTPLFSIGPSIAVISILLSYSVIPFSN----HLILADLNIGIFLWI
NU1C_AGRST      LGLLQAIADGTKLLLKEDILPSRGDIPLFSIGPSIAVISILLSFLVIPLGY----HFVLADLSIGVFLWI
NUOH_EDWI9      GGSLQLVADMIKMFFKEDWVPPFTDRLIFTLAPMIAFCSLLLSFAIVPVGWMG------ADLNIGILFFL
NUOH_CHLP8      WGLLQTLADILKLLQKEDIVPKLADKFLFVIGPGILFVGSFLAFAVLPFGPIG------ADLNVGLFYXX
NUOH_BURVG      AGLLQPIADVLKLLLKEVIQPSAASRWLYLVAPVMTVVPAFAVWAVIPF----QAQAVLANVNAGLLYAM
NUOH1_SYMTH     WGVLQPIADVIKMLFKEDIMPEQADPLIYRLAPVIAFFCALGVWVVIPWAPRGSWWSSMADPNAGVLVIL
NUOH1_RHOP5     FGFLQWVADTVKIIAKEDEIPPGADRVAYRXXXXXXXXXXXXGFGVVAFGE----NLALAEIDVGVMFLL
NU1C_HELAN      LGILQALADGTKLLFKENLLPSRGDTRLFSIGPSIAVISILLSYLVIPFGY----RLVLADLSIGVFLWI
NUOH_NEIM0      WGLIQPFADVFKLLFKEVTRPRLSNKALFYIGPIMSLAPSFAAWAVIPFNE----EWVLTNINIGLLYIL
NUOH_LEGPA      KGLLQPFADLLKLITKEIIVPTRSNKYLFVIAPLFALVPSLVGWAVIPFQE----GVVLANINAGVLYLF
NUOH_FRATM      FGLLQPIFDALKLFLKEIIVPTNSNRXXXXXXXXXXXXXXXXXWAVIPFSK----GVVLSDMNLGLLYIL
NUOH_BURCJ      GGLLQPIADVLKLLLKEVIQPTAASRWLYLIAPIMTVVPAFAVWAVIPF----QAEAVLANVNAGLLYAM
NUOH_BURCH      GGLLQPIADVLKLLLKEVIQPSAASRWLYLIAPVMTVVPAFAVWAVIPF----QAEAVLANVNAGLLYAM
NUOH_BURCC      GGLLQPIADVLKLLLKEVIQPSAASRWLYLIAPVMTVVPAFAVWAVIPF----QAEAVLANVNAGLLYAM
NUOH_BURCA      GGLLQPIADVLKLLLKEVIQPSAASRWLYLIAPVMTVVPAFAVWAVIPF----QAEAVLANVNAGLLYAM
NUOH_RICAE      FGLLQPIADAVKLLFKEPIIPTNSDKILFILAPMITFILSLIGWAVIPFAK----GVVLADINVGVLYIL
NUOH_LEGPC      KGLLQPFADLLKLITKEIIVPTRSNKYLFVIAPLFALVPSLVGWAVIPFQE----GVVLANINAGVLYLF
NUOH_BURS3      GGLLQPIADVLKLLLKEVIQPSAASRWLYLIAPVMTVVPAFAVWAVIPF----QAEAVLANVNAGLLYAM
NU1C_HUPLU      LGIIQALADGAKLLSKEDIIPSRGDSFLFNXXXXXXXXXXFLSYLVIPLGH----GIILADLDIGVFFWI
NUOH_NEIMA      WGLIQPFADVFKLLFKEVTRPRLSNKALFYIGPIMSLAPSFAAWAVIPFNE----EWVLTNINIGLLYIL
NUOH_FRATW      FGLLQPIFDALKLFLKEIIVPTNSNRXXXXXXXXXXXXXXXXXWAVIPFSK----GVVLSDMNLGLLYIL
NUOH_FRATT      FGLLQPIFDALKLFLKEIIVPTNSNRXXXXXXXXXXXXXXXXXWAVIPFSK----GVVLSDMNLGLLYIL
NUOH_FRATO      FGLLQPIFDALKLFLKEIIVPTNSNRXXXXXXXXXXXXXXXXXWAVIPFSK----GVVLSDMNLGLLYIL
NUOH_FRATN      FGLLQPIFDALKLFLKEIIVPTNSNRXXXXXXXXXXXXXXXXXWAVIPFSK----GVVLSDMNLGLLYIL
NUOH_FRATH      FGLLQPIFDALKLFLKEIIVPTNSNRXXXXXXXXXXXXXXXXXWAVIPFSK----GVVLSDMNLGLLYIL
NUOH_FRATF      FGLLQPIFDALKLFLKEIIVPTNSNRXXXXXXXXXXXXXXXXXWAVIPFSK----GVVLSDMNLGLLYIL
NUOH_FRAT1      FGLLQPIFDALKLFLKEIIVPTNSNRXXXXXXXXXXXXXXXXXWAVIPFSK----GVVLSDMNLGLLYIL
NU1C_PHYPA      LGIIQALADGFKLLLKEDIIPSKGDNWLFNIGPAIVVIPVFLSYLVIPFGH----NIILADLNIGVFFWI
NU1C_LOBMA      LGILQALADGTKLLFKEDLRPSRGNTPLFSIGPSIAVISILLSYSIIPFSN----HLVLADLNIGIFLWI
NU1C_LEPVR      LGILQALADGTKLLFKENLRPSRGNTPLFSIGPSIAVISILLSYSVIPFSN----HLVLADLNIGIFLWI
NU1C_CRUWA      LGILQALADGTKLLFKENLRPSRGNTPLFSIGPSIAVISILLSYSVIPFSN----HLVLADLNIGIFLWI
NU1C_ACOCL      LGILQALADGTKLLFKEDLLPSRGDISLFSLGPSIAVISTLLSYLVIPFGY----HLVLADLSIGVFLWI
NUOH1_RHIME     FGLFQSFADLLKFVFKEPVIPAGANKTIFLLAPLVSVTLALAAWAVIPLNA----NWVIANINVGILFVF
NU1C_NASOF      LGILQALADGTKLLFKENLRPSRGNPPLFSIGPSIAVISILLSYSVIPFSN----HLVLADLNIGIFLWI
NU1C_BARVE      LGILQALADGTKLLFKENLRPSRGNPPLFSIGPSIAVISILLSYSVIPFSN----HLVLADLNIGIFLWI
NUOH_STRCO      WGMLQSLADGIKLMLKEDVIVKRADKAVYVLAPIVAAIPAFMAIAVIPFGPAGNTAMQLTDLPIAMLFIL
NUOH_RICTY      FGLLQPIADAVKLLFKEPIIPTNADKILFILAPIITFVLSLIGWAVIPFAK----GVVLADINVGVLYIL
NUOH_PSEAE      FGAFQLGADMVKMFFKEDWTPPFADKMIFTLAPVIAMGALLVAFAIVPITPTWGV----ADLNIGILFFF
NUOH_PSEAB      FGAFQLGADMVKMFFKEDWTPPFADKMIFTLAPVIAMGALLVAFAIVPITPTWGV----ADLNIGILFFF
NUOH_PSEA8      FGAFQLGADMVKMFFKEDWTPPFADKMIFTLAPVIAMGALLVAFAIVPITPTWGV----ADLNIGILFFF
NUOH_EHRCR      FGLLQPFADAVKLIIKEHIIPFKSNKICFLIAPIITFTLALLGWAVIPFGADVIVNXXXXXXXXGVLYIL
NUOH_BARBK      WGLLQSFADLIKFVVKEPIIPSGANKGVFLLAPFVSATLALSAWAVVPVNE----GWEIASINVGLLYIL
NU1C_PIPCE      LGILQAIADGTKLLFKEDILPSRGDIRLFSIGPSIAVISIILSYSVIPFSY----HLVLADLGIGVFLWI
NUOH_PSEA7      FGAFQLGADMIKMFFKEDWTPPFADKMIFTLAPVIAMGALLVAFAIVPITPTWGV----ADLNIGILFFF
NUOH_PELUB      FGLLQSLADALKYIFKEVIIPSSSNKVIFILAPIVTMTLALVSWAVIPFSTTQVL----ADINVGVLYLF
NUOH_HERAR      AGLLQPIADALKLLLKEIVVPAKSSKALFVIAPIMTIMPALAAWAVIPFGP----EAALANVNAGLLFVM
NUOH_BURM1      AGLLQPIADVLKLLLKEVIQPTAASRWLYLIAPIMTVVPAFAVWAVIPF----QAEAVLANVNAGLLYAM
NU1C_MARPO      LGIIQALADGIKLFLKEDIVPAQGDVWLFNIGPILVLIPVFLSYLVIPF----EYNVILANFSIGVFFWI
NU1C_CALFG      LGILQALADGTKLLFKEDLLPSRGDIRLFSIGPSIAVISILLSYSVIPFGY----RLVLADLGIGVFLWI
NUOH_CHRVO      FGLLQPIADAVKLLMKEIILPTNSSKGLFLLAPVLSIGPALAAWAVIPFTD----KLVLANVNASLLYIL
NUOH_SALRD      LGLLQPFADVLKFVLKEDVQPAQSNKFIHSMAPVVMVVIAMTTASLIPFAE----GVVVADLNVGVIMLL
NUOH_LEPBL      WGLLQPLADGIKFLTKEEVFPTQVNKIMYLIAPAISMTCAIMAWSVVPLGGRIPLDLQIANPDTGILFLF
NUOH_LEPBJ      WGLLQPLADGIKFLTKEEVFPTQVNKIMYLIAPAISMTCAIMAWSVVPLGGRIPLDLQIANPDTGILFLF
NUOH1_RHOS4     FGLLQTVADAAKYIFKEVVVPAGVDRPVFFLAPLISFVLAVLAWAVIPFSP----GWVLSDINVAILFVF
NUOH1_RHOS1     FGLLQTVADAAKYIFKEVVVPAGVDRPVFFLAPLISFVLAVLAWAVIPFSP----GWVLSDINVAILFVF
NU1C_AETGR      LGILQALADGIKLLFKENLRPSIGNTTLFSIGPSIAVISILLSYSVIPFSN----HLVLADFNIGIFLWI
NU1C_ADICA      LGIIQSLADGIKLLLKEDIIPAKGNAWLFAAGPAVVVTPVFITYLVIPFGQ----HIILSDLGIGVFFWI
NU1M_DICCI      VGLLQPLADGLKLVLKETIIPIVADKIIYAIAPILTFTISIVLWSVIAVG----VQSVFASINSGVIFIL
NU1C_SORBI      LGLLQAIADGTKLLLKEDILPSRGEIPLFSIGPSIAVISVLLSFLVIPLGY----RFVLADLSIGVFLWI
NU1C_PHAVU      FGVLQALADGTKLLFKENLIPSRGDIRLFSFGPAXXXXXXXXXXXXXPFGY----NFVLSDLNIGVFLWI
NUOH_NEIMB      WGLIQPFADVFKLLFKEVTRPKLSNKALFYIGPIMSLAPSFAAWAVIPFNE----EWVLTNINIGLLYIL
NU1C_PROMM      LGVLQPMADGLKLLVKEDVIPVRADGXXXXXXXXXXXXXXXXXXXXXXFGQ----NLLISNVGIGIFLWI
NU1C_PROM3      LGVLQPMADGLKLLVKEDVIPVRADGXXXXXXXXXXXXXXXXXXXXXXFGQ----NLLISNVGIGIFLWI
NUOH_POLNA      FGLLQPIADALKLLTKEIIIPTAASKGLFILGPIMTIMPALAAWAVIPFGP----DVALANVNAGLLFIM
NUOH_NEIG1      RGLIQPFADVFKLLFKEVTRPKLSNKALFYIGPIMSLAPSFAAWAVIPFNE----EWVLTNINIGLLYIL
NUOH_BDEBA      LGLVQLLADAVKFLNKENFMPQTAKPFLYYAAPIFALIPGAVAFSAIPLSSPGPYTFLVQGYDIGVGIVF
NU1C_DRANE      LGILQALADGTKLLFKEDLRPSRGNTPLFSIGPSIAVISILLSYSVIPFSN----HLVLADLNIGIFLWI
NU1C_AETCO      LGILQALADGIKLLFKENLRPSRGNTTLFSIGPSLAVISILLSYSVIPFSN----HLVLADFNIGIFLWI
NUOH_FRAP2      FGLLQPIFDALKLFLKEIIVPTNSNRXXXXXXXXXXXXXXXXXWAVIPFSK----GVVLSDMNLGLLYIL
NUOH2_SYMTH     WGWIQPVADLIKLWVKEYIRPNNVDKWLYLIAPFIGFVSANLVWLIVPFGD----KLIATDFEIGIIFIA
NUOH_METCA      LGLGQVVADMVKIFFKEDWIPPFADKPVFVIAPAIVMVTMLLXXXXXXXXXXXXX----IDFNFGLLYFF
NU1M_DICDI      VGLLQPLADGLKLVLKETIIPIVADKLIYAIAPILTFTISIVLWSVIAVG----VQSVFASINSGVIFIL
NUOH_SODGM      GGSLQLLADVLKMMFKEDWIPPFADRGIFTLAPVIAFTSLLITFAIVP---VSPTWV-VADFNIGVLFFL
NUOH_SACEN      FGLLQSLADGLKLAFKEDIRPVLADKWVYFLAPVISATPALVAFSVIPIG--GEVSVFXXXXXXXXXXXX
NUOH_ERWCT      GGSLQLVADMIKMFFKEDWVPNFTDKVIFTLAPMIAFTSMLIAFAIVPITPTWGV----ADLNIGILFFL
NU1C_ILLOL      LGILQALADGTKLLFKEDLLPSRGDIRLFSVGPSIAVISILLSYSVIPFGY----RLIIADISIGVFLWI
NUOH_RICAH      FGLLQPIADAVKLLFKEPIIPINADKILFILAPMITFILSLIGWAVIPFSK----GVVLADINVGVLYIL
NUOH_AZOPC      WGIFQSVADMIKILLKELIRINKVDVCLFHLATYIVIIASICTFGAIPFDK----GLHVVDFNIGVFYLL
NU1C_RANMC      LGILQALADGTKLLFKEDLLPSRGDIYLFSIGPSIAVIAILLSYLVIPFGY----HLVLADLSIGVFLWI
NU1C_PROMT      LGILQPMADGLKLLVKEDIIPARADSVLFTVGXXXXXXXXXXXXXXXXFGQ----NLLISNVGIGIFLWI
FPOH_METAC      FGLLQLVADAIKLFTKEDMRPRNADRLLFDNAPIFMMSSVFLMLVAIPVGAINGVEYPLAVTEMDISVLY
NUOH_PROAC      GGVFQAVGDGLKLIFKEMLTPKGADKIVFNLAPVIAGIACFASWSVIPLGQVSMFGLQITDVPVAVLFIL
NU1C_ZYGCR      LGTIQALADGLKLILKEDIIPSRADKWLFALGPAIVVIPVLLSFLVIPFNH----QLIVADISIGMFFWI
NU1C_LIRTU      LGILQALADGTKLLFKEDLLPSRGDIRLFSIGPSIAVISILLSYSVIPFGY----RLVLADLSIGVFLWI
NUOH_KLEP7      GGSLQLVADMIKMFFKEDWIPRFSDRVIFTLAPVIAFTSLLLAFAIVP---VSPTWV-VADLNIGILFFL
NUOH_KLEP3      GGSLQLVADMIKMFFKEDWIPRFSDRVIFTLAPVIAFTSLLLAFAIVP---VSPTWV-VADLNIGILFFL
NUOH_EHRCJ      FGLLQPFADAVKLIIKEHIIPFKSNKICFLIAPIITFTLALLGWAVIPFGADVIVNXXXXXXXXXXLYIL
NUOH_BART1      WGLLQSFADLIKFVVKEPIIPAGANKGVFLLAPFVSATLALSTWAVIPVSE----GWEVAKINVGLLYIL
NUOH_ROSDO      FGLLQTVADALKYVVKEVVVPAGADKTVFMLAPMTSFVLALLAWAVIPFND----GWVLSDINVAILFVF
NUOH_FLAJ1      GGLLQPLADGMKLFSKEEFFPNTPNRFLFVVGPAIAMSTALMTSAVIPWGDRLHLDIILQATDVNIALLY
NU1M_CHOCR      FGLLQPLADGLKLFVKETILPSSANIIIFILAPILTFLLALVSWCVIPLGE----GMVYSDINIGVLYIL
NU1C_OENEH      MGILQALADGIKLIFKENLLPSRGDTRLFSIGPSIAVISILLSYSVIPFSS----HLVLSDLNIGVFLWI
NU1C_MESVI      LGVLQPLADGLKLAFKEDIIPSKGDVLLFTLGPAIVVIPIFLSYLIVPFGE----NLIVSNINLGIFFWI
NU1C_AMBTC      LGILQAIADGTKLLFKEDLLPSRGDIRLFSIGPXXXXXXXXXXXXXXPFGY----RLVLADLSIGVSLWI
NUOH_YERPS      GGSLQLVADMIKMFFKEDWVPRFSDRAIFTLAPVIAFTSLLLSFAIVPVSPTWAV----ADLNIGILFFL
NUOH_YERPP      GGSLQLVADMIKMFFKEDWVPRFSDRAIFTLAPVIAFTSLLLSFAIVPVSPTWAV----ADLNIGILFFL
NUOH_YERPN      GGSLQLVADMIKMFFKEDWVPRFSDRAIFTLAPVIAFTSLLLSFAIVPVSPTWAV----ADLNIGILFFL
NUOH_YERPG      GGSLQLVADMIKMFFKEDWVPRFSDRAIFTLAPVIAFTSLLLSFAIVPVSPTWAV----ADLNIGILFFL
NUOH_YERPE      GGSLQLVADMIKMFFKEDWVPRFSDRAIFTLAPVIAFTSLLLSFAIVPVSPTWAV----ADLNIGILFFL
NUOH_YERPB      GGSLQLVADMIKMFFKEDWVPRFSDRAIFTLAPVIAFTSLLLSFAIVPVSPTWAV----ADLNIGILFFL
NUOH_YERPA      GGSLQLVADMIKMFFKEDWVPRFSDRAIFTLAPVIAFTSLLLSFAIVPVSPTWAV----ADLNIGILFFL
NUOH_YERP3      GGSLQLVADMIKMFFKEDWVPRFSDRAIFTLAPVIAFTSLLLSFAIVPVSPTWAV----ADLNIGILFFL
NUOH_YERE8      GGSLQLVADMIKMFFKEDWVPRFSDRAIFTLAPVIAFTSLLLSFAIVPVSPTWAV----ADLNIGILFFL
NUOH_STRAW      WGMLQSLADGIKLMLKEDLIVKRADKVVYVLAPIVAAIPAFMAIAVIPFGPADNTAMQLTDLPIAMLYIL
NUOH_PARDP      WGLLQTFADALKYIVKEIVIPAGADKFVYFLAPFLSMMLALFAFVVIPFDE----GWVMANINVGILFIF
NUOH_COXB2      RGLAQPIADIFKLLLKEVIIPTASSRYLYLIAPILSLVPALAAWAVIPFAQ----GWMLANVNAGLLFLF
NUOH_AZOVD      FGMFQLGADMLKMFFKEDWTPPFADRLIFTLAPIVAMSALLMAFAVVPVTPTWGV----ADLNIGLLFFF
NU1M_CYACA      FGLLQPIADGLKLLLKETSLPNSANIFIFIIAPILTFFLALCAWAIMPFNEIN----FYSNLNIGILYLL
NU1C_PROM1      LGILQPMADGLKLLVKEDIIPARADSVLFTVGXXXXXXXXXXXXXXXXFGQ----NLLISNVGIGIFLWI
NUOH_ENT38      GGSLQLVADMIKMFFKEDWIPKFSDRVIFTLAPMIAFTSLLLAFAIVP---VSPTWV-VADLNIGILFFL
NUOH_DEIDV      MGLLQPAADAIKSIFKEDLQVTLADKLVYTLAPIIAIGMALTAFGGIPAGPEGSLNPWVYNLDAGVLALL
NUOH_COXBU      RGLAQPIADIFKLLLKEVIIPTASSRYLYLIAPILSLVPALAAWAVIPFAQ----GWVLANVNAGLLFLF
NUOH_COXBR      RGLAQPIADIFKLLLKEVIIPTASSRYLYLIAPILSLVPALAAWAVIPFAQ----GWVLANVNAGLLFLF
NUOH_COXBN      RGLAQPIADIFKLLLKEVIIPTASSRYLYLIAPILSLVPALAAWAVIPFAQ----GWVLANVNAGLLFLF
NUOH_COXB1      RGLAQPIADIFKLLLKEVIIPTASSRYLYLIAPILSLVPALAAWAVIPFAQ----GWVLANVNAGLLFLF
NU1M_OENBE      FGLLQPLADGLKLILKEPISPSSANFSLFRMAPVATFMLSLVAWAVVPFDY----GMVLSDLNIGLLYLF
NUOH_BRASB      WGLFQSFADLLKFVLKEPIIPAGANKGVFLLAPLVSCVLALAAWAVIPTN----LGWAIADINVGXXXXX
NUOH_NITSB      YGLLQVLADGIKLFTKEDFIPQGAVRPVFMIAPVIXXXXXXXGYTVKPI---------ISDINVGLLFVL
NUOH_JANMA      AGLLQPIADGVKLLLKEIVVPAKSSKALFVIAPIMTIMPALAAWAVIPFG---PETV-LADVNAGLLFVM
NUOH_HYPNA      FGLLQSFADFGKFLLKEIVIPAGANKAVFILAPILTCTLAFVTWAAIPVGTATGTSWVIANLNVGVLYLF
NUOH_HELHP      YGLLQVVADGIKLFAKEDIIPQNAIKPIFILAPXXXXXXXXXGYVVRPI---------IADINVGILFVL
NUOH2_NITMU     FGIPWLGADAVKAVMKEIIIPSGANKVLFVLAPILTFAPALAAWAVIPFSP----DVVLADINAGLLYIL
NUOH_YERPY      GGSLQLVADMIKMFFKEDWVPRFSDRAIFTLAPVIAFTSLLLSFAIVPVSPTWAV----ADLNIGILFFL
NUOH_PHEZH      FGLLQSFADFLKFVLKEIVIPSGADKTVFLLAPLISFTLAFAAWAVIPLAP----GWVVSDINVGILYLF
NUOH_AGRVS      WGLFQSFADLLKFVFKEPIIPAGANKXXXXXXXXXXXXXXXXXXXXIPLNQ----GWVIANINVGILYVF
NU1C_SOYBN      FGVLQALADGTKLLFKENLIPSRGDIRLFXXXXXXXXXXXXXXXXXXXFGY----NFVLSDLNIGVFLWI
NU1M_ARATH      FGLLQPLADGLKLILKEPISPSSANFFLFRMAPVATFMLSLVAWAVVPFDY----GMVLSDLNIGLLYLF
NUOH_POLSJ      FGLLQPIADALKLLTKEIIMPTAASKGLFVLGPIMTIMPALAAWAVIPFGP----DIALSNINAGLLFLM
NUOH2_RHIME     HGLLQPVADGIKLLTKEDHIPAEADRFLFKLAPILALAPPFVVFAAIPFGESNEITLYISNLNVALLFVF
NU1C_SYNPX      LGVLQPLADGLKLLVKEDIIPARADSLLFTXXXXXXXXXXXXXXXXXXFGQ----NLLISNVGVGIFLWI
NQO8_PARDE      WGLLQTFADALKYIVKEIVIPAGADKFVYFLAPFLSMMLALFAFVVIPFDE----GWVMANINVGILFIF
NUOH_AERHH      FGLLQLAADMIKMFFKEDWIPPFADRRIFVLXXXXXXXXXXXXXXVVPITPTWGV----ADLNVXXXXXX
NUOH_AERS4      FGLLQLAADMIKMFFKEDWIPPFADRRXXXXXXXXXXXXXXXXXXVVPLTPTWGV----ADLNVXXXXXX
NU1M_METSE      YGLLQPLADGIKLFTKELVIPHYANLFIYVAAPVLSFTLALIAWGVIPYDK----GVVISDLKIGILFTL
NUOH_FRAAA      KGWLQSLADGAKLMLKEDLIPALADKPIFILAPILSAVPAFLAFAVIPFGPEVSITLQLADLPVSVLYML
NUOH_SPHWW      WGLLQSFADGAKVFLQETIIPAAANKGLFLLAPIITFTVALIVWAVIPFAP----GVVLADINIGLLYVL
NUOH_ERYLH      FGLLQSFADGLKVFLQETIIPSAANKGIFLLAPIVTFVVALVAWAVIPFGD----GMVLADINVGLLYVL
NU1C_PSINU      LGILQTLMDGIKLLLKEDIVPAKGNTWLFNLGPAIVVIPVFLSYLVIPFGQ----KMILSDLGIGVFFWI
NUOH_RHOCA      FGLLQSVADAAKYVFKEIVVPAGVDKPVYFXXXXXXXXXXXXXXXXXPFNE----GWVMADINVAVLFVF
NUOH_NITHX      WGLLQSFADLLKFVLKEPIIPSGSNKGVFLLAPLVTCVLALAAWAVIPVN----LNWVISDINVGILYIF
NUOH2_ACIBL     FGLLQPLADGLKFILKEDLLPPHVNKPLYIXXXXXXXXXXXXSISIVPFG--GTLTIHITTPNIGLLIIL
NU1M_WHEAT      FGLLQPLADGLKLILKEPISPSSANFFLFRMAPVATFMLSLVAWAVVPFDY----GMVLSDLNIGLLYLF
NUOH_THEFY      WGLLQSLADGVKLSLKEDLIPRTVDKVIYXXXXXXXXXXXXXXXSVIPVGPEVTMRLQXXXXXXXXXXXX
NUOH_SILPO      YGLLQSVADALKYVVKEVVIPAGADRTVFILAPMTSFVLAMIAWAVIPFND----GWVLSDINVAILYVF
NUOH_SERP5      GGSLQLVADMIKMFFKEDWVPKFSDRVIFTLAPMIAFTSLLLAFAIVPVSPTWAVS----DLNIGILFFL
NU1C_PLAOC      LGILQALADGTKLLFKEDLLPSRGDTRLFXXXXXXXXXXXXXXXXXXPFGY----RLVLADLSIGVFLWI
NUOH_SILST      YGLLQTVADALKYVVKEVVIPAGSDRTVFILAPLTSFVLAMIAWAVIPFNDTWVLS----DINVAILYVF
NUOH_METPP      WGLLTPIADAVKLIFKEIILPTAANKGLFLLGPVMTIMPALAAWVVVPFGP----EVALANINAGLLFLM
NUOH_MESSB      WGLFQAFADLFKFVFKEPVIPSGANKGXXXXXXXXXXXXXXXXXXXIPVSE----GWAIANINVGILYVF
NUOH_BRASO      FGLFQSFADLLKFVLKEPIIPAGANKGVFLLAPLVSCVLALAAWAVIPTN----LGWAIADINVGXXXXX
NU1C_SYNS9      LGVLQPLADGLKLLVKEDIIPARADSILFTXXXXXXXXXXXXXXXXXXFGQ----NLLISNVGVGIFLWI
NUOH_RUBXD      RGLLQPAADVVKLFIKENVSPGRADRWVXXXXXXXXXXXXXXVWLVIPFGP----GMVVADLNIGLVYFF
NUOH_NOVAD      LGLLQSFADGLKVFLQETIIPTAANKGLFLIAPIITFTVALMAWAVIPFNS----GAVLANINVGLLYVL
NUOH2_RHOP2     WGLLQSFADLLKMILKEPMIPSGANKGVFLLAPLVTCVLALSAWAVIPVSA----GWVIADINVGVLYIL
NUOH1_SOLUE     HGLLQPLADVIKLITKEDLVPPYVNKPLYLAAPFLAITMALLSISVIPFGHIGPVTMQMTDLNIGVLFIL
NUOH_SHEON      FGLFQLLADMIKMFFKEDWIPPFADRRXXXXXXXXXXXXXXXXXXVVPITPTWGV----ADLNVXXXXXX
NUOH2_RHOP5     WGLLQSFADLLKMVLKEPTIPSGANKGVFLLAPLVSCVLALAAWAVIPVDA----GWMIADINVGVLYIL
NUOH_WOLTR      FGLLQPFADAIKLLVKEPIIPFRANTILFIMAPMLTFILALIVWAVIPFGQIVIPKV-IANVNIGVLYVL
NUOH_PHOLL      GGSLQIVADMIKMFFKEDWVPRFADRMIFTLAPVIGFVSLLLAFAIVP---ITPTWM-AADLNIGILFFM
NUOH_JANSC      FGLLQSFADFLKYIVKEIVVPAGADRAVYFLAPIVSLVMALIAWAVIPFND----GWVLSSLNVAVLYVF
NUOH_BAUCH      GGSLQLLADTIKILFKEDWIPPFADRIIFTLAPIIAFTSLLLVFAIMPISP----NWVVIELNIGILFFL
NUOH_DEIRA      MGLLQPLADAIKSIFKEDVTVTLADKLVYTLAPILAIGMALTAFGGIPAGPPGSL--FGTDPDAGILALL
NUOH2_SYNFM     FGLLQPIADIVKMVAKEDTVPEGAERTIFMXXXXXXXXXXXXXXXXIPFGKDVTLPLVVADLNVGLLYFF
NUOH_WOLPM      FGLLQPFADAIKLLIKEPIIPFRASTILFIMAPMLTFILALIAWAVIPFGQQVIIPKVIANINVGVLYVL
NUOH_RHOFD      WGLLQPIADAMKLMTKEVLRPAAAEKFLFYLGPVMTVMPAMAAWAVIPFGP----DIALANINAGLLFLM
NUOH_ERWT9      GGSLQLVADMIKMFFKEDWIPPFTDRVIFTLAPMIAFTSLLLAMAIVPVTSMG------ADLNIGLLFFL
NU1M_USTMA      YALLQPFADALKLVIKEQVIPSQATKSLFFLAPMVTLIFSLLGWGVIPLGP----GLALSDFSLGILYSL
NU1C_SYNSC      LGVLQPLADGLKLLVKEDIIPARADSXXXXXXXXXXXXXXXXXXXXXXFGQ----NLLISNVGVGIFLWI
NUOH2_RHOPS     WGLLQSFADLLKFVVKEPTVPSGANKGVFLLAPLVTCVLALAAWAVIPVNA----GWVIADINVGVLYIL
NU1C_TRIEI      LGTLAPLADGLKLLFKEDVVPAKADPLLFTLGPVIVAVPVFLSYLVVPFGQ----NLVITDLGVAIFLWI
NU1C_CHAGL      LGMIQALADGLKLVLKEDIIPAKGDPWLFSVGPAXXXXXXXXXXXXXXXGH----ELILANLGVGILFWI
NUOH_CAMJD      FGLIQLVADMIKLFTKEDIIPSNSQKFIFAIAPLISAICAFVSLAAIPMGRV--IQPIVADINVALLFVI
NUOH1_RHIEC     FGLFQSFADLLKFVFKEPIIPAGANKXXXXXXXXXXXXXXXSTWAVVPLAD----GWVIANINVGILYIF
NU1M_MARPO      LGLLQPLADGLKLMIKEPILPSSANIFIFLMAPVLTFTLALCAWAVIPFDY----GMVFSDLNIGVLYLF
NUOH1_RHOPA     WGLLQSFADLLKFVLKEPTIPDGANKGLFLLAPLVTCVLALAAWAVIPVNA----GWVIADINVGVLYIL
NUOH_RHIL3      FGLFQSFADLLKFVFKEPIIPAGANKXXXXXXXXXXXXXXXSTWAVVPLAD----GWVIANINVGILYIF
NUOH_NOCSJ      FGLLQSLADALKLIFKEGIIPKAADKAVYLIAPVIAVIPSFITFSVIPFGPEVTIPLQLTDMPVAVLFVM
NUOH_NITEU      FDIPWLRADAVKAIMKEIIIPTGANKFLFLLAPVLAIGPALAAWAVVPFSP----ELVLADINAGLLYIL
NUOH_BORPE      KGLLQPFADVFKLLTKEVVVPSAANKVLFVVAPVVTLMPALAAWAVVPFGP----EVVLANVNAGLLYIM
NUOH_BORPA      KGLLQPFADVFKLLTKEVVVPSAANKVLFVVAPVVTLMPALAAWAVVPFGP----EVVLANVNAGLLYIM
NUOH_BORBR      KGLLQPFADVFKLLTKEVVVPSAANKVLFVVAPVVTLMPALAAWAVVPFGP----EVVLANVNAGLLYIM
NU1C_SYNPW      LGVLQPLADGLKLLVKEDIIPARADGXXXXXXXXXXXXXXXXXXXXXXFGQ----NLLISNVGVGIFLWI
NUOH_PSEFS      FGMFQIAADMLKMFFKEDWTPPFADKVIFTLAPVVAMSALLIAFAVIPITPTWGV----ADLNIGLLFFF
NUOH_CAUCR      FGLLQSFADFFKFVLKEIVIPAGADKVVFILAPLISLILAFVGWAVVPFAP----GWVVSNLNVGILYLL
NUOH1_RHOPB     WGLLQSFADLLKFVFKEPMIPSGANKGVFLLAPLVSCVLALAAWAVIPVNA----GWVIADINVGVLYIL
NUOH_RHILW      FGLFQSFADLLKFVFKEPIIPAGANKXXXXXXXXXXXXXXXSTWAVVPLAD----GWVIANINVGILYIF
NUOH_AZOSB      FGLLQPIADGVKLLLKEIIFPSSASKGLFIVGPILALAPSLVAWAVVPFDD----GLVLANVNAGLLFLL
NUOH_FRASC      RGWLQSLADGAKLMLKEDLIPVLADKPIFILAPIVSAVPAFLAFAVIPFGPEVSITLQLADLPXXXXXXX
NUOH_XYLFT      MGLFQAFADVFKLLFKEVLYPSKAHKAIFVIAPLLTLAPSFAAWAVVPFDT----KLVLSNANVGLLYLL
NUOH_XYLF2      MGLFQAFADVFKLLFKEVLYPSKAHKAIFVIAPLLTLAPSFAAWAVVPFDT----KLVLSNANVGLLYLL
NUOH_PARL1      FGLLQSFADLLKFVFKEIVIPAGANKGIFXXXXXXXXXXXXSGWAVIPLDA----RMVIADINVGILYIF
NUOH2_RHIEC     HGLLQPVADGIKLLTKEDHIPAEADRFLFKLAPILALAPPFVVFVAIPFGETTEITLYLSNMNVALLXXX
NUOH_XYLFM      MGLFQAFADVFKLLFKEVLYPSKAHKVIFVIAPLLTLAPSFAAWAVVPFDT----KLVLSNANVGLLYLL
NUOH_LEPIN      WGLLQPLADGIKFLTKEEVFPVQVNKVMYLIAPAISMTCAIMAWSVVPLGGQIPLDLQIANPDTGILFLF
NUOH_LEPIC      WGLLQPLADGIKFLTKEEVFPVQVNKVMYLIAPAISMTCAIMAWSVVPLGGQIPLDLQIANPDTGILFLF
NUOH_CAMHC      AGVLQIVADMIKLFTKEDTMPSGANRFIFLIAPIISASCAFVAMSVIPFLPEFEIFGHLSDVNIGILFLL
NUOH_BORPD      RGLLQPFADVFKLLTKEVVVPTQANKILFVVAPVVTLMPALAAWAVVPFGP----EVVLANVNAGLLYVM
NUOH_AGRT5      FGLFQSFADLLKFILKEPVIPAGANKXXXXXXXXXXXXXXXXXXXXIPFAD----GWVVANINVGILYIF
NUOH2_CYTH3     YGMLQTIADLIKLLQKEDIIATGANRFLFRLAPVLIFTAIFAGFATLPFAP----DLIGSKADVGVFFMI
NUOH_XYLFA      MGLFQAFADVFKLLFKEVLYPSKAHKAIFVIAPLLTLAPSFAAWAVVPFDT----KLVLSNANVGLLYLL
NUOH_DEIGD      LGLLQPLADAIKSIFKEDLRVTLADKLVYTLAPIVAIGMALTAFGGIPAGP--PKSLFGTDPDAGILALL
NUOH_BORA1      KGLLQPFADVFKLLTKEVVVPSQANKILFIVAPVVTLMPALAAWAVVPFGP----EAVLANVNAGLLYVM
NUOH_ACISJ      FGLLQPIADALKLLTKELIQPAAAAKGLFYLGPVMAIMPALGAWAVIPFGP----DXXXXXXXXXXXXXX
NU1M_BOVIN      YGLLQPIADAIKLFIKEPLRPATSSASMFILAPIMALGLALTMW--IPL----PMPYPLINMNLGVLFML
NUOH_AGRRK      FGLFQSFADLLKFMVKEPIIPAGANKXXXXXXXXXXXXXXXSTWAVVPVAN----GWVIANINVGILYIL
NU1M_BOSIN      YGLLQPIADAIKLFIKEPLRPATSSASMFILAPIMALGLALTMW--IPL----PMPYPLINMNLGVLFML
NUOH_HALHL      RGLLQPIADALKLLFKEITIPTYASRTLFXXXXXXXXXXXXXXWAVIPFDD----GLVVADINAGLLYIL
NU1M_FELCA      YGLLQPIADAVKLFTKEPLRPLTSSMLMFIMAPILALTLALTMW--IPL----PMPYPLINMNLGVLFML
NU1M_CABUN      YGLLQPIADAIKLFIKEPLRPLTSSKPMFILAPTLAFSLALSLWIPVPMPH------PLINLNLGVLFIL
NUOH_CAMC5      VGVLQIVADMIKLFTKEDIVPANANRXXXXXXXXXXXXXXXXXXXXXXXXXEFELFGHLADINVGVLYVM
NUOH_BRAJA      WGLLQSFADLLKFVLKEPIIPAGANKGVFLLAPLVSCVLALAAWAVIPTN----LGWVISDINVGXXXXX
NUOH_ACIAC      FGLLQPLADGLKLLTKEIIQPAAASKGLFVLGPVMAIMPALAAWVAIPFGP----DXXXXXXXXXXXXIM
NU1M_TOLMA      YGLLQPIADAIKLFIKEPLRPLTSSKLMFTLAPMLAFSLALSMW--IPMPMPHPL-IHL---NLGVLFIL
NU1M_RHIUN      YGLLQPIADAIKLFTKEPLQPSTSSTSMFIIAPIMALTLALTMWVPLPMPH------PLINMNLGVLFML
NU1M_EMBAL      HGLLQPIADAIKLFTKEPLRPLTSSTSMFIMAPILALSLALTMWTPLPMPY------PLINMNLGVLFIL
NUOH_VEREI      WGLLQPIADALKLLTKEIIQPTAASRGLFVLGPVMAIMPALAAWVVIPFGP----DXXXXXXXXXXXXXX
NU1M_HALGR      YGLLQPIADAVKLFTKEPLRPLTSSTTMFIMAPILALTLALTMWVPLPMPY------PLINMNLGVLFML
NUOH_PSEMY      FGMFQIAADMIKMFFKEDWTPPFADRFIF----VXXXXXXXXXXXXXXXXXXXTPTWGVADLNIGILFFF
NUOH_DECAR      WGLIQPIADGLKLLMKEIIVPSGANKGIFXXXXXXXXXXXXXXXXXXXFTD----SLVLANIDASLLYIM
NUOH_ANAMM      FGLLQPFADALKLVTKESIVPLQSRNFAFFIAPVITFTLALSGWAVIPLGASTTIPASIANINLGVLYIF
NUOH2_SOLUE     HGLLQPIADALKLLLKEDIIPTDSDKAIFWFAPCISTITGLVAFAVIPFAR----KIYVADVNVGLLVIS
NUOH_MARMM      FGLLQSFADFFKFVFKEIVVPAGADRSXXXXXXXXXXXXXFVTWAVVPAAP----GWVIADLNVGILYLF
NUOH_BLOPB      HGSLQLCADLIKVMFKEDWIPPFSDRIVFVLAPVIAFISSLMSILIIPFT---PTWI-IWDCNIGILFFL
NUOH_ALHEH      QGLLQPIADALKLVMKEISIPSNANRVLFXXXXXXXXXXXXXXXXXXPVAE----GWAIADINAGLLYIL
NU1M_BALPH      HGLLQPFADAIKLFTKEPLRPATSSTTMFIIAPVLALTLALTMWSPLPMPY------PLINMNLGVLFML
NU1M_PETHY      FGLLQPLADGLKLILKEPISPSSANFSLFRMAPVATFMLSLVARAVVPFDY----GMVLSDPNIGLLYLF
NUOH_BUCBP      QGTLQVVADMIKLFFKEDWIPTFSKKITFLIAPILAFISLLLVITIIPLSP----SIVIVNLDIGVLFFL
NUOH_THIDA      QGLLQPIADAVKLLMKEIIIPSGASRXXXXXXXXXXXXXXXXXXXXXXFSD----GLVLADINAGLLYVM
NUOH_BURP8      AGLLQPIADVLKLLLKEVIQPTQASR--WXXXXXXXXXXXXXXXXXXXXXQAGAV---LGDINAGLLYAI
NUOH2_RHOPA     FGSLQWVADTVKILTKEDRPPPGADKLLYIXXXXXXXXXXXXGFGVVAIGD----GWALSSVDVXXXXXX
NU1M_BOSMU      YGLLQPIADAIKLFIKEPL------RPATSSTSMFXXXXXXXXXXXXTMWIPLPMPHPLINMNLGVLFML
NU1M_PHOVI      YGLLQPIADAVKLFTKEPLRPLTSSTTMFIMAPIXXXXXXXTMWVPLPMPY------PLINMNLGVLFML
NU1M_HIPAM      YGLLQPFADAIKLFTKEPL------RPSTSSVSMFXXXXXXXXXXXXXMWIPLPMPYPLINMNLGVLFML
NQO8_THET8      FGLLQPLADAIKSIFKEDIVVAQADRFLFVLAPLISVVFALLAFGLIPFGPPGPWVINL---DLGILYLF
NUOH_CAMJR      FGLIQLVADMIKLFTKEDIIPSNSQKFIFAIAPLISAICAFVSLAAIPMGKV--IQPIVADINVALLFVI
NUOH_CAMJJ      FGLIQLVADMIKLFTKEDIIPSNSQKFIFAIAPLISAICAFVSLAAIPMGRV--IQPIVADINVALLFVI
NUOH_CAMJE      FGLIQLVADMIKLFTKEDIIPSNSQKFIFAIAPLISAICAFVSLAAIPMGRV--IQPIVADINVALLFVI
NUOH_CAMJ8      FGLIQLVADMIKLFTKEDIIPSNSQKFIFAIAPLISAICAFVSLAAIPMGRV--IQPIVADINVALLFVI
NQO8_THET2      FGLLQPLADAIKSIFKEDIVVAQADRFLFVLAPLISVVFALLAFGLIPFGPPGPWVINL---DLGILYLF
NU1M_ELEMA      YGLLQPIADAIKLFTKEPIYPQTSSKFLFTVAPILALTLALTVWAPLPMPY------PXXXXXXXXXXXX
NUOH_NITEC      FGIPWLGADAVKAIMKEIIIPTGANKXXXXXXXXXXXXXXXXXWAVVPFSP----ELVLADINAALLYIL
NU1M_PRIMA      YGLLQPIADAIKLFIKEPLRPLTSSKTMFILAPTLAFSLALSMW--IPM----PMPHPLVNLNLGVLFIL
NUOH_WOLSU      YGVLQILADGIKLFTKEDIVPVGANQTIFKIAPVISAATAFIAMSAVPFFPEFELFGHIADINVGILFVL
NUOH1_RHOP2     FGSLQWVADTVKILTKEDRPPPGADKLTYILAPAIAATPVLAGFGVVAFGD----GLVLAPVDXXXXXXX
NU1M_TADIN      HGLLQPIADAIKLFTKEPLQPLTSSTTMFIMAPILALTLALTMW--IPL----PMPYPLINMNLGILFML
NU1M_PIG        YGLLQPIADALKLFTKEPL------RPATSSISMFXXXXXXXXXXXXTMWVPLPMPYPLINMNLGVLFML
FPOH_METBF      YGLLQLVADAIKLFTKEDLKPLNADSLLFNNANIFMLGSVFLMLVALPVGAINGVEYPLAVTQMDISVLY
NU1M_SAGOE      YGTLQPIADAMKLFTKEXXXXXXXXXXXYLIAPTLALSISLLLWTPLPMPY------PLMNFNLGLLFIL
NUOH2_NITOC     RGWLQPIADTVKLLLKEIIIPASANRXXXXXXXXXXXXXXXXXXXXXXFDA----HLVLADINAALLYIL
NU1M_MANTE      WGLLQPIADAVKLFTKEPLRPLTSSXXXXXXXXXXXXXXXXXXWMPLPMPY------PLINMNLGVLFML
NU1M_ATEPA      YGMLQPIADAMKLFMKEPLLPTTSASTLYMTAPTLALSIALLMWSPLPMPH------PLINFNLGLLFML
NUOH_BLOFL      NGSLQLLADLIKIMFKEDWIPPFSDRYIFVLAPAI---AFIISLMIIPVIPFTPSSVIL-HCNVGVLFFL
NUOH_ANADE      AGFFQWIADAVKLLLKEDLIPADADRLLFRAAPYXXXXXXXXXXXXXXXGE----SLIAADLNVGIFYIT
NU1M_NYCCO      NGLLQPFADAMKLFIKEPLQPLTSSTSLYIIAPTLALSIALIMWTPLPIPY--PLNINL-----GVLFIL
NU1M_ZAEPI      YGLLQPIADAIKLFIKEPLRPLTSSKXXXXXXXXXXXXXXXXXW--IPM----PMPHSLINLNLGVLFIL
NUOH1_RHOPS     FGSLQWIADTVKILTKEDRPPPGADKFAYIXXXXXXXXXXXXGFGVIEFGD----GLSLAAVDVGVLFLI
NUOH1_ACIBL     HGLLQPIADALK