[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for hlac0:ACM56606.1

[Show Plain Result]


## Summary of Sequence Search
    1::266
    1::266     e-105  70%  266 aa  IF2A_HALMA RecName: Full=Translation initiation factor 2 subunit
    1::266     9e-95  62%  267 aa  IF2A_HALSA RecName: Full=Translation initiation factor 2 subunit
    1::266     9e-95  62%  267 aa  IF2A_HALS3 RecName: Full=Translation initiation factor 2 subunit
    8::265     1e-54  43%  267 aa  IF2A_ARCFU RecName: Full=Translation initiation factor 2 subunit
    4::262     9e-48  39%  265 aa  IF2A_METS3 RecName: Full=Translation initiation factor 2 subunit
    8::263     1e-47  38%  266 aa  IF2A_METJA RecName: Full=Translation initiation factor 2 subunit
    8::257     6e-47  40%  260 aa  IF2A_METST RecName: Full=Translation initiation factor 2 subunit
   11::230     5e-46  44%  262 aa  IF2A_METTH RecName: Full=Translation initiation factor 2 subunit
    9::237     4e-45  45%  267 aa  IF2A_METKA RecName: Full=Translation initiation factor 2 subunit
    4::240     6e-41  40%  275 aa  IF2A_THEON RecName: Full=Translation initiation factor 2 subunit
    4::240     5e-40  38%  275 aa  IF2A_PYRKO RecName: Full=Translation initiation factor 2 subunit
    8::240     9e-40  40%  273 aa  IF2A_THEGJ RecName: Full=Translation initiation factor 2 subunit
    7::231     9e-40  41%  254 aa  IF2A_THEAC RecName: Full=Translation initiation factor 2 subunit
    8::240     6e-39  39%  275 aa  IF2A_PYRHO RecName: Full=Translation initiation factor 2 subunit
    8::240     2e-36  37%  275 aa  IF2A_PYRFU RecName: Full=Translation initiation factor 2 subunit
    7::231     3e-36  40%  254 aa  IF2A_THEVO RecName: Full=Translation initiation factor 2 subunit
    8::240     2e-34  37%  275 aa  IF2A_PYRAB RecName: Full=Translation initiation factor 2 subunit
    9::242     1e-23  33%  267 aa  IF2A_STAMF RecName: Full=Translation initiation factor 2 subunit
    9::235     2e-23  31%  267 aa  IF2A_HYPBU RecName: Full=Translation initiation factor 2 subunit
   19::253     2e-22  32%  277 aa  IF2A_AERPE RecName: Full=Translation initiation factor 2 subunit
    9::228     2e-20  27%  263 aa  IF2A_SULTO RecName: Full=Translation initiation factor 2 subunit
    8::237     2e-20  27%  265 aa  IF2A_PYRAE RecName: Full=Translation initiation factor 2 subunit
    9::243     6e-20  26%  266 aa  IF2A_SULIY RecName: Full=Translation initiation factor 2 subunit
    9::243     6e-20  26%  266 aa  IF2A_SULIN RecName: Full=Translation initiation factor 2 subunit
    9::243     6e-20  26%  266 aa  IF2A_SULIM RecName: Full=Translation initiation factor 2 subunit
    9::243     6e-20  26%  266 aa  IF2A_SULIK RecName: Full=Translation initiation factor 2 subunit
    9::243     6e-20  26%  266 aa  IF2A_SULIA RecName: Full=Translation initiation factor 2 subunit
    9::243     8e-20  26%  266 aa  IF2A_SULSO RecName: Full=Translation initiation factor 2 subunit
    9::243     8e-20  25%  266 aa  IF2A_SULIL RecName: Full=Translation initiation factor 2 subunit
  621::698     1e-13  46%  703 aa  PNP_HAHCH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::698     7e-13  46%  707 aa  PNP_CHRSD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  639::722     2e-12  43%  722 aa  PNP_MARAV RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::697     3e-12  45%  698 aa  PNP_LEPIN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::697     3e-12  45%  698 aa  PNP_LEPIC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::703     6e-12  43%  716 aa  PNP_HAMD5 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  271::376     8e-12  34%  382 aa  RS1H_BACSU RecName: Full=30S ribosomal protein S1 homolog;
  620::694     8e-12  47%  696 aa  PNP_LEPBL RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::694     8e-12  47%  696 aa  PNP_LEPBJ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::699     8e-12  51%  815 aa  PNP_ACIBL RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::697     1e-11  46%  702 aa  PNP_MARMS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
    6::77      1e-11  44%  130 aa  GS13_BACSU RecName: Full=General stress protein 13;       
  621::693     2e-11  49%  701 aa  PNP_PSEU5 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::694     2e-11  49%  702 aa  PNP_AZOVD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::699     2e-11  46%  806 aa  PNP_ACIC5 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::693     3e-11  43%  703 aa  PNP_PSEA6 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::693     4e-11  44%  698 aa  PNP_PSYIN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::696     4e-11  45%  708 aa  PNP_PSEHT RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::693     4e-11  49%  701 aa  PNP_PSEAE RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::693     4e-11  49%  701 aa  PNP_PSEAB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::693     4e-11  49%  701 aa  PNP_PSEA8 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::693     4e-11  49%  701 aa  PNP_PSEA7 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::695     6e-11  45%  700 aa  PNP_XYLFT RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::695     6e-11  45%  700 aa  PNP_XYLFM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::695     6e-11  45%  700 aa  PNP_XYLFA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::695     6e-11  45%  700 aa  PNP_XYLF2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::693     6e-11  48%  701 aa  PNP_PSEPW RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::693     6e-11  48%  701 aa  PNP_PSEPU RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::693     6e-11  48%  701 aa  PNP_PSEPK RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::693     6e-11  48%  701 aa  PNP_PSEPG RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::693     6e-11  48%  701 aa  PNP_PSEPF RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::693     6e-11  48%  701 aa  PNP_PSEP1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::693     6e-11  48%  701 aa  PNP_PSEFS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::695     6e-11  48%  703 aa  PNP_PSEF5 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::693     6e-11  48%  701 aa  PNP_PSEE4 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::693     6e-11  48%  701 aa  PNP_PSE14 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  561::634     6e-11  42%  635 aa  ISPH_CLOTE RecName: Full=4-hydroxy-3-methylbut-2-enyl diphosphate
  621::695     8e-11  45%  704 aa  PNP_XANOR RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::695     8e-11  45%  704 aa  PNP_XANOP RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::695     8e-11  45%  704 aa  PNP_XANOM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::695     8e-11  45%  704 aa  PNP_XANCP RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::695     8e-11  45%  704 aa  PNP_XANCB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::695     8e-11  45%  704 aa  PNP_XANC8 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::695     8e-11  45%  704 aa  PNP_XANC5 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::695     8e-11  45%  704 aa  PNP_XANAC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::693     8e-11  47%  701 aa  PNP_PSEU2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::702     8e-11  40%  707 aa  PNP_PHOPR RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::698     1e-10  39%  698 aa  PNP_TREDE RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::694     1e-10  48%  702 aa  PNP_PSEMY RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  618::678     1e-10  49%  721 aa  PNP_DESOH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::696     1e-10  39%  696 aa  PNP_COXBU RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::696     1e-10  39%  696 aa  PNP_COXBR RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::696     1e-10  39%  696 aa  PNP_COXBN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::696     1e-10  39%  696 aa  PNP_COXB2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::696     1e-10  39%  696 aa  PNP_COXB1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::696     1e-10  43%  697 aa  PNP_ACIAD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  617::694     2e-10  44%  701 aa  PNP_SOLUE RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::690     2e-10  45%  708 aa  PNP_NITEU RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  625::690     3e-10  47%  692 aa  PNP_ACIF5 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::688     3e-10  47%  690 aa  PNP_ACIF2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::696     3e-10  43%  697 aa  PNP_ACIBY RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::696     3e-10  43%  697 aa  PNP_ACIBT RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::696     3e-10  43%  697 aa  PNP_ACIBS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::696     3e-10  43%  697 aa  PNP_ACIBC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::696     3e-10  43%  697 aa  PNP_ACIB5 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::696     3e-10  43%  697 aa  PNP_ACIB3 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
    4::98      4e-10  35%  128 aa  YABR_BACSU RecName: Full=Uncharacterized protein yabR;
  616::690     4e-10  43%  695 aa  PNP_CHLTR RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  616::690     4e-10  43%  695 aa  PNP_CHLTB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  616::690     4e-10  43%  695 aa  PNP_CHLTA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  616::690     4e-10  43%  695 aa  PNP_CHLT2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::696     4e-10  41%  697 aa  PNP_ALCBS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  212::289     7e-10  43% 1168 aa  PRP22_SCHPO RecName: Full=Pre-mRNA-splicing factor ATP-dependent
  622::693     7e-10  43%  707 aa  PNP_EDWI9 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  614::702     7e-10  40%  705 aa  PNP_CLONN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  569::642     7e-10  42%  642 aa  ISPH_CLOAB RecName: Full=4-hydroxy-3-methylbut-2-enyl diphosphate
   13::244     7e-10  23%  304 aa  IF2A_YEAST RecName: Full=Eukaryotic translation initiation factor 2
  211::305     7e-10  31% 1168 aa  DHX8_ARATH RecName: Full=Probable pre-mRNA-splicing factor
  194::263     9e-10  40%  393 aa  RS1_STAS1 RecName: Full=30S ribosomal protein S1;
  621::695     9e-10  41%  709 aa  PNP_VIBCM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::695     9e-10  41%  709 aa  PNP_VIBCH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::695     9e-10  41%  712 aa  PNP_VIBC3 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::690     9e-10  43%  699 aa  PNP_SHEAM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  626::705     9e-10  39%  705 aa  PNP_HALOH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  627::701     9e-10  43%  702 aa  PNP_HALHL RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::691     1e-09  46%  709 aa  PNP_VIBFM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::691     1e-09  46%  709 aa  PNP_VIBF1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  640::717     1e-09  41%  762 aa  PNP_SYMTH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::713     1e-09  35%  715 aa  PNP_RHILO RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::705     1e-09  38%  707 aa  PNP_POLSJ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::706     1e-09  40%  745 aa  PNP_METEP RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::706     1e-09  40%  745 aa  PNP_METC4 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::696     1e-09  40%  753 aa  PNP_DELAS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::692     1e-09  46%  709 aa  PNP_ALISL RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::691     1e-09  40%  707 aa  PNP_ACTSZ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::695     2e-09  41%  710 aa  PNP_VIBHB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  627::692     2e-09  45%  705 aa  PNP_TERTT RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::696     2e-09  42%  713 aa  PNP_OCHA4 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::693     2e-09  43%  706 aa  PNP_ERWCT RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::697     2e-09  42%  711 aa  PNP_ECO27 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::691     2e-09  41%  693 aa  PNP_DICNV RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  618::688     2e-09  49%  692 aa  PNP_DESPS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  617::695     2e-09  41%  695 aa  PNP_DESAH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  627::697     2e-09  44%  712 aa  PNP_BURP8 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::696     2e-09  41%  698 aa  PNP_ALHEH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::696     2e-09  41%  772 aa  PNP_VARPS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::714     2e-09  31%  714 aa  PNP_SILPO RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::698     2e-09  39%  714 aa  PNP_PASMU RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::692     2e-09  40%  695 aa  PNP_NITOC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::694     2e-09  42%  711 aa  PNP_KLEP3 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  624::695     2e-09  39%  697 aa  PNP_BLOFL RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::693     2e-09  41%  697 aa  PNP_BAUCH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::691     2e-09  44%  699 aa  PNP_AZOSE RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  629::700     2e-09  44%  721 aa  PNP_ANASK RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  629::700     2e-09  44%  721 aa  PNP_ANADE RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  629::700     2e-09  44%  721 aa  PNP_ANAD2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::700     3e-09  42%  745 aa  PNP_METPB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::707     3e-09  38%  708 aa  PNP_CLOK5 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::707     3e-09  38%  708 aa  PNP_CLOK1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  628::708     3e-09  40%  722 aa  PNP_CHRVO RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::691     3e-09  44%  699 aa  PNP_AZOSB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::690     3e-09  39%  695 aa  PNP_VESOH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  618::693     3e-09  38%  774 aa  PNP_SPHWW RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  639::702     3e-09  45%  722 aa  PNP_SACD2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::700     3e-09  38%  718 aa  PNP_NITWN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::697     3e-09  36%  700 aa  PNP_CLOTH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::702     3e-09  40%  702 aa  PNP_CLOPS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::702     3e-09  40%  702 aa  PNP_CLOPE RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::702     3e-09  40%  702 aa  PNP_CLOP1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  615::689     3e-09  40%  693 aa  PNP_CHLMU RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  616::689     3e-09  42%  694 aa  PNP_CHLAB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  629::690     3e-09  50%  710 aa  PNP_CELJU RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::696     3e-09  41%  714 aa  PNP_BRUSU RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::696     3e-09  41%  714 aa  PNP_BRUSI RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::696     3e-09  41%  714 aa  PNP_BRUO2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::696     3e-09  41%  714 aa  PNP_BRUME RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::696     3e-09  41%  714 aa  PNP_BRUMB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::696     3e-09  41%  714 aa  PNP_BRUC2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::696     3e-09  41%  714 aa  PNP_BRUAB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::696     3e-09  41%  714 aa  PNP_BRUA2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::696     3e-09  41%  714 aa  PNP_BRUA1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::692     3e-09  38%  715 aa  PNP_ACTPJ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::692     3e-09  38%  715 aa  PNP_ACTP7 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::692     3e-09  38%  715 aa  PNP_ACTP2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  316::420     5e-09  33%  429 aa  RS1_LEULA RecName: Full=40S ribosomal protein S1;
  619::690     5e-09  42%  699 aa  PNP_SHESW RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::690     5e-09  42%  699 aa  PNP_SHESR RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::690     5e-09  42%  699 aa  PNP_SHESM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::690     5e-09  42%  699 aa  PNP_SHESA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::690     5e-09  42%  699 aa  PNP_SHEPC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::690     5e-09  42%  699 aa  PNP_SHEON RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::690     5e-09  42%  699 aa  PNP_SHEB2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::690     5e-09  41%  695 aa  PNP_RUTMC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::711     5e-09  38%  717 aa  PNP_RHIME RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::712     5e-09  37%  712 aa  PNP_RHILW RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::710     5e-09  37%  715 aa  PNP_PHEZH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::689     5e-09  42%  701 aa  PNP_NITMU RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::702     5e-09  37%  709 aa  PNP_HAEIG RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::702     5e-09  37%  709 aa  PNP_HAEIE RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::702     5e-09  37%  709 aa  PNP_HAEI8 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::701     5e-09  38%  727 aa  PNP_DIAST RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::705     5e-09  36%  731 aa  PNP_BART1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::701     5e-09  38%  727 aa  PNP_ACISJ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::691     6e-09  42%  706 aa  PNP_VIBSL RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::695     6e-09  39%  720 aa  PNP_TOLAT RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::690     6e-09  45%  711 aa  PNP_SHISS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::690     6e-09  45%  711 aa  PNP_SHIFL RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::690     6e-09  45%  711 aa  PNP_SHIF8 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::690     6e-09  45%  711 aa  PNP_SHIBS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::690     6e-09  45%  711 aa  PNP_SHIB3 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::693     6e-09  40%  698 aa  PNP_SHEDO RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::692     6e-09  42%  706 aa  PNP_RHOFD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  618::698     6e-09  41%  707 aa  PNP_RHOCS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::712     6e-09  37%  712 aa  PNP_RHIL3 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::690     6e-09  44%  717 aa  PNP_RALSO RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::692     6e-09  44%  724 aa  PNP_RALPJ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::691     6e-09  40%  709 aa  PNP_PHOLU RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::712     6e-09  34%  720 aa  PNP_NITHX RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::690     6e-09  39%  705 aa  PNP_NITEC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::691     6e-09  43%  722 aa  PNP_MYXXD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::702     6e-09  37%  709 aa  PNP_HAEIN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  618::689     6e-09  42%  697 aa  PNP_GEOSL RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::690     6e-09  45%  711 aa  PNP_ECOSE RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::690     6e-09  45%  711 aa  PNP_ECOLI RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::690     6e-09  45%  711 aa  PNP_ECOLC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::690     6e-09  45%  711 aa  PNP_ECOHS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::690     6e-09  45%  711 aa  PNP_ECODH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::690     6e-09  45%  711 aa  PNP_ECOBW RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::690     6e-09  45%  711 aa  PNP_ECO8A RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::690     6e-09  45%  711 aa  PNP_ECO7I RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::690     6e-09  45%  711 aa  PNP_ECO5E RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::690     6e-09  45%  711 aa  PNP_ECO57 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::690     6e-09  45%  711 aa  PNP_ECO55 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::690     6e-09  45%  711 aa  PNP_ECO24 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  627::697     6e-09  41%  716 aa  PNP_BURXL RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  627::697     6e-09  41%  713 aa  PNP_BURTA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  627::697     6e-09  41%  718 aa  PNP_BURPP RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  627::697     6e-09  41%  714 aa  PNP_BURCM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  627::697     6e-09  41%  714 aa  PNP_BURA4 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::690     6e-09  44%  693 aa  PNP_BUCBP RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::703     6e-09  39%  705 aa  PNP_BACLD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::690     8e-09  43%  705 aa  PNP_YERPY RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::690     8e-09  43%  704 aa  PNP_YERPS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::690     8e-09  43%  705 aa  PNP_YERPP RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::690     8e-09  43%  705 aa  PNP_YERPN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::690     8e-09  43%  705 aa  PNP_YERPG RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::690     8e-09  43%  705 aa  PNP_YERPE RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::690     8e-09  43%  704 aa  PNP_YERPB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::690     8e-09  43%  705 aa  PNP_YERPA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::690     8e-09  43%  705 aa  PNP_YERP3 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::681     8e-09  44%  708 aa  PNP_VIBVY RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::681     8e-09  44%  708 aa  PNP_VIBVU RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::690     8e-09  41%  698 aa  PNP_SHEFN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::712     8e-09  37%  712 aa  PNP_RHIEC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  627::699     8e-09  41%  700 aa  PNP_PSYA2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::696     8e-09  43%  751 aa  PNP_METPP RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  631::699     8e-09  41%  713 aa  PNP_HAES2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  631::699     8e-09  41%  713 aa  PNP_HAES1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::698     8e-09  41%  722 aa  PNP_GEOTN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::701     8e-09  37%  712 aa  PNP_GEOSW RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::693     8e-09  41%  723 aa  PNP_GEOKA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  616::689     8e-09  42%  694 aa  PNP_CHLCV RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  616::676     8e-09  46%  712 aa  PNP_BRAHW RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  629::697     8e-09  46%  722 aa  PNP_ANADF RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::695     8e-09  42%  710 aa  PNP_AGRRK RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  726::796     1e-08  41% 1874 aa  RRP5_BOVIN RecName: Full=Protein RRP5 homolog;AltName:
  617::692     1e-08  39%  748 aa  PNP_ZYMMO RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  628::699     1e-08  42%  705 aa  PNP_SYNAS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::690     1e-08  43%  705 aa  PNP_SERP5 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  629::691     1e-08  41%  712 aa  PNP_SALRD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::695     1e-08  42%  712 aa  PNP_RHIE6 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  627::699     1e-08  40%  700 aa  PNP_PSYCK RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::692     1e-08  41%  703 aa  PNP_POLNA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::691     1e-08  40%  709 aa  PNP_PHOLL RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::697     1e-08  42%  697 aa  PNP_PARUW RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::696     1e-08  39%  715 aa  PNP_MESSB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::692     1e-08  44%  701 aa  PNP_LARHH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  617::688     1e-08  40%  696 aa  PNP_GEOSM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  617::688     1e-08  40%  696 aa  PNP_GEOBB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::702     1e-08  35%  703 aa  PNP_CLOAB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  627::688     1e-08  42%  715 aa  PNP_BURVG RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  627::688     1e-08  42%  715 aa  PNP_BURS3 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  627::688     1e-08  42%  715 aa  PNP_BURM1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  625::686     1e-08  42%  713 aa  PNP_BURCJ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  627::688     1e-08  42%  715 aa  PNP_BURCH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  627::688     1e-08  42%  715 aa  PNP_BURCC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  627::688     1e-08  42%  715 aa  PNP_BURCA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  189::257     1e-08  39%  382 aa  RS1H_BACC1 RecName: Full=30S ribosomal protein S1 homolog;
  623::681     1e-08  44%  711 aa  PNP_VIBPA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::694     1e-08  36%  694 aa  PNP_THICR RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::690     1e-08  45%  711 aa  PNP_SHIDS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::690     1e-08  43%  711 aa  PNP_SALTY RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::690     1e-08  43%  711 aa  PNP_SALPK RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::690     1e-08  43%  711 aa  PNP_SALPC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::690     1e-08  43%  711 aa  PNP_SALPB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::690     1e-08  43%  711 aa  PNP_SALPA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::690     1e-08  43%  711 aa  PNP_SALG2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::690     1e-08  43%  711 aa  PNP_SALEP RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::690     1e-08  43%  711 aa  PNP_SALCH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::690     1e-08  43%  711 aa  PNP_SALAR RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::689     1e-08  41%  699 aa  PNP_PELCD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::690     1e-08  43%  706 aa  PNP_PECCP RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::690     1e-08  43%  711 aa  PNP_KLEP7 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::690     1e-08  45%  711 aa  PNP_ESCF3 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::690     1e-08  43%  710 aa  PNP_ERWT9 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  625::693     1e-08  43%  711 aa  PNP_ENTS8 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::690     1e-08  43%  711 aa  PNP_ENT38 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::690     1e-08  45%  711 aa  PNP_ECOUT RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::690     1e-08  45%  711 aa  PNP_ECOSM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::690     1e-08  45%  711 aa  PNP_ECOLU RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::690     1e-08  45%  711 aa  PNP_ECOL6 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::690     1e-08  45%  711 aa  PNP_ECOL5 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::690     1e-08  45%  711 aa  PNP_ECOK1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::690     1e-08  45%  711 aa  PNP_ECO81 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::690     1e-08  45%  711 aa  PNP_ECO45 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::691     1e-08  42%  715 aa  PNP_DECAR RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::690     1e-08  43%  711 aa  PNP_CITK8 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  616::689     1e-08  42%  694 aa  PNP_CHLFF RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::703     1e-08  36%  705 aa  PNP_BACSU RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::691     1e-08  41%  712 aa  PNP_BACC0 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::692     1e-08  41%  758 aa  PNP_ACIAC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  649::720     2e-08  35%  773 aa  YHGF_ECOLI RecName: Full=Protein yhgF;
  622::696     2e-08  39%  757 aa  PNP_VEREI RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  633::698     2e-08  41%  713 aa  PNP_THETH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  633::698     2e-08  41%  713 aa  PNP_THET2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::681     2e-08  47%  757 aa  PNP_SORC5 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::711     2e-08  31%  711 aa  PNP_SILST RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::690     2e-08  42%  700 aa  PNP_SHELP RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::692     2e-08  38%  725 aa  PNP_RALME RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::692     2e-08  38%  723 aa  PNP_RALEH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  625::701     2e-08  39%  704 aa  PNP_PSYWF RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  624::698     2e-08  33%  709 aa  PNP_PERMH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::696     2e-08  41%  767 aa  PNP_LEPCP RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  618::689     2e-08  40%  697 aa  PNP_GEOMG RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::692     2e-08  38%  723 aa  PNP_CUPTR RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::689     2e-08  44%  705 aa  PNP_COLP3 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::704     2e-08  39%  704 aa  PNP_CLOBB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::704     2e-08  39%  704 aa  PNP_CLOBA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  627::688     2e-08  42%  713 aa  PNP_BURPS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  627::688     2e-08  42%  713 aa  PNP_BURP6 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  627::688     2e-08  42%  713 aa  PNP_BURP1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  627::688     2e-08  42%  713 aa  PNP_BURP0 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  627::688     2e-08  42%  713 aa  PNP_BURMS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  627::688     2e-08  42%  713 aa  PNP_BURMA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  627::688     2e-08  42%  713 aa  PNP_BURM9 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  627::688     2e-08  42%  713 aa  PNP_BURM7 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::692     2e-08  38%  707 aa  PNP_BUCAP RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::706     2e-08  37%  714 aa  PNP_AGRVS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  294::367     2e-08  38%  481 aa  RS1_MYCTU RecName: Full=30S ribosomal protein S1;
  294::367     2e-08  38%  481 aa  RS1_MYCLE RecName: Full=30S ribosomal protein S1;
  355::475     2e-08  35%  566 aa  RS1_BUCBP RecName: Full=30S ribosomal protein S1;
 1236::1307    2e-08  36% 1690 aa  RRP5_SCHPO RecName: Full=rRNA biogenesis protein rrp5;AltName:
  622::713     2e-08  30%  716 aa  PNP_RHOSK RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::696     2e-08  41%  717 aa  PNP_RHISN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::690     2e-08  42%  709 aa  PNP_PROMH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::696     2e-08  36%  710 aa  PNP_MARMM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  626::694     2e-08  38%  712 aa  PNP_HAEDU RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  617::688     2e-08  40%  696 aa  PNP_GEOUR RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  617::688     2e-08  40%  696 aa  PNP_GEOSF RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::699     2e-08  38%  702 aa  PNP_ANOFW RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::695     2e-08  41%  713 aa  PNP_AGRT5 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  626::689     2e-08  44%  712 aa  PNP_AERHH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  191::265     3e-08  36%  561 aa  RS1_NEIMB RecName: Full=30S ribosomal protein S1;
  633::698     3e-08  41%  713 aa  PNP_THET8 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::696     3e-08  41%  714 aa  PNP_SINMW RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::688     3e-08  41%  700 aa  PNP_SHEB9 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::688     3e-08  41%  700 aa  PNP_SHEB8 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::688     3e-08  41%  700 aa  PNP_SHEB5 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  640::711     3e-08  33%  730 aa  PNP_OPITP RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::703     3e-08  37%  705 aa  PNP_OCEIH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::694     3e-08  39%  772 aa  PNP_NOVAD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::705     3e-08  35%  713 aa  PNP_HYPNA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  618::693     3e-08  39%  716 aa  PNP_GLUOX RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  624::704     3e-08  36%  704 aa  PNP_ENTFA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::701     3e-08  38%  701 aa  PNP_CLOB8 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::693     3e-08  39%  697 aa  PNP_BDEBA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::691     3e-08  38%  704 aa  PNP_BACHD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  728::798     4e-08  38% 1871 aa  RRP5_HUMAN RecName: Full=Protein RRP5 homolog;AltName:
  622::693     4e-08  40%  705 aa  PNP_SODGM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::691     4e-08  39%  722 aa  PNP_POLSQ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::691     4e-08  39%  722 aa  PNP_POLNS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::714     4e-08  32%  715 aa  PNP_PARDP RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  616::688     4e-08  40%  709 aa  PNP_HELMI RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::692     4e-08  44%  703 aa  PNP_GEOLS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  617::707     4e-08  36%  714 aa  PNP_FINM2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::704     4e-08  37%  705 aa  PNP_BACP2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::693     4e-08  40%  707 aa  PNP_BACA2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::698     5e-08  35%  700 aa  PNP_THEPX RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::698     5e-08  35%  700 aa  PNP_THEP3 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::695     5e-08  32%  707 aa  PNP_SULAA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::697     5e-08  34%  714 aa  PNP_RHOS5 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::697     5e-08  34%  716 aa  PNP_RHOS4 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::697     5e-08  34%  716 aa  PNP_RHOS1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  631::708     5e-08  39%  734 aa  PNP_PELTS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::698     5e-08  36%  711 aa  PNP_DINSH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
   13::235     5e-08  25%  306 aa  IF2A_SCHPO RecName: Full=Eukaryotic translation initiation factor 2
  286::369     5e-08  40% 1244 aa  DHX8_MOUSE RecName: Full=ATP-dependent RNA helicase DHX8;       
  262::345     5e-08  40% 1220 aa  DHX8_HUMAN RecName: Full=ATP-dependent RNA helicase DHX8;       
  619::693     7e-08  37%  706 aa  PNP_THIDA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::690     7e-08  42%  711 aa  PNP_SALTI RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::700     7e-08  39%  723 aa  PNP_LISMO RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::700     7e-08  39%  723 aa  PNP_LISMH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::700     7e-08  39%  723 aa  PNP_LISMF RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::700     7e-08  39%  723 aa  PNP_LISMC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  626::692     7e-08  39%  709 aa  PNP_HAEPS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::693     7e-08  39%  693 aa  PNP_BUCCC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  194::263     9e-08  34%  391 aa  RS1_STAAW RecName: Full=30S ribosomal protein S1;
  194::263     9e-08  34%  391 aa  RS1_STAAS RecName: Full=30S ribosomal protein S1;
  194::263     9e-08  34%  391 aa  RS1_STAAR RecName: Full=30S ribosomal protein S1;
  194::263     9e-08  34%  391 aa  RS1_STAAN RecName: Full=30S ribosomal protein S1;
  194::263     9e-08  34%  391 aa  RS1_STAAM RecName: Full=30S ribosomal protein S1;
  194::263     9e-08  34%  391 aa  RS1_STAAC RecName: Full=30S ribosomal protein S1;
  190::264     9e-08  36%  559 aa  RS1_PSEAE RecName: Full=30S ribosomal protein S1;
  622::692     9e-08  37%  728 aa  PNP_RALEJ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::691     9e-08  38%  707 aa  PNP_BUCAT RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::691     9e-08  38%  707 aa  PNP_BUCAI RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::691     9e-08  38%  707 aa  PNP_BUCA5 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::691     9e-08  39%  717 aa  PNP_BACWK RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::691     9e-08  39%  712 aa  PNP_BACHK RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::691     9e-08  39%  712 aa  PNP_BACCZ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::691     9e-08  39%  712 aa  PNP_BACCQ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::691     9e-08  39%  712 aa  PNP_BACC7 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::691     9e-08  39%  712 aa  PNP_BACC4 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::691     9e-08  39%  712 aa  PNP_BACC3 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::691     9e-08  39%  712 aa  PNP_BACC2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::691     9e-08  39%  712 aa  PNP_BACC1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::691     9e-08  39%  712 aa  PNP_BACAN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::691     9e-08  39%  712 aa  PNP_BACAH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::691     9e-08  39%  712 aa  PNP_BACAC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::691     9e-08  39%  712 aa  PNP_BACAA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  280::348     1e-07  39%  392 aa  RS1_STAHJ RecName: Full=30S ribosomal protein S1;
  290::365     1e-07  41%  568 aa  RS1_RICCN RecName: Full=30S ribosomal protein S1;
  621::695     1e-07  37%  771 aa  PNP_SPHAL RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  624::682     1e-07  44%  704 aa  PNP_SHESH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::697     1e-07  36%  711 aa  PNP_ROSDO RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  617::688     1e-07  40%  706 aa  PNP_PELPD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::700     1e-07  39%  723 aa  PNP_LISW6 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::700     1e-07  39%  723 aa  PNP_LISIN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  626::696     1e-07  39%  711 aa  PNP_JANMA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  626::696     1e-07  39%  710 aa  PNP_HERAR RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  625::699     1e-07  39%  769 aa  PNP_ERYLH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  625::697     1e-07  40%  718 aa  PNP_BORA1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::705     1e-07  36%  733 aa  PNP_BARBK RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::689     1e-07  40%  710 aa  PNP_BACCN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  477::564     1e-07  36%  827 aa  ISPH_FUSNN RecName: Full=4-hydroxy-3-methylbut-2-enyl diphosphate
  651::720     1e-07  34%  762 aa  Y568_HAEIN RecName: Full=Uncharacterized protein HI0568;
  290::365     1e-07  41%  568 aa  RS1_RICFE RecName: Full=30S ribosomal protein S1;
  479::570     1e-07  33%  580 aa  RS1_CHLPN RecName: Full=30S ribosomal protein S1;
  727::798     1e-07  39% 1862 aa  RRP5_MOUSE RecName: Full=Protein RRP5 homolog;AltName:
  624::690     1e-07  42%  706 aa  PNP_YEREN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  624::690     1e-07  42%  706 aa  PNP_YERE8 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::679     1e-07  44%  702 aa  PNP_SHEWM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  612::683     1e-07  41%  686 aa  PNP_RUBXD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  627::690     1e-07  42%  694 aa  PNP_CHLPN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  636::713     1e-07  42%  734 aa  PNP_CHLPB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  625::697     1e-07  40%  719 aa  PNP_BORPE RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  625::697     1e-07  40%  719 aa  PNP_BORPA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  625::697     1e-07  40%  719 aa  PNP_BORBR RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  293::368     2e-07  40%  572 aa  RS1_RICBR RecName: Full=30S ribosomal protein S1;
  626::697     2e-07  36%  710 aa  PNP_THEYD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  617::688     2e-07  36%  699 aa  PNP_SYNFM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::679     2e-07  44%  701 aa  PNP_SHEPW RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  624::682     2e-07  44%  704 aa  PNP_SHEPA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  624::682     2e-07  44%  704 aa  PNP_SHEHH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  618::686     2e-07  36%  720 aa  PNP_DEHSC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  618::686     2e-07  36%  720 aa  PNP_DEHSB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::690     2e-07  38%  705 aa  PNP_CLOTE RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  626::699     2e-07  37%  711 aa  PNP_BACV8 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  616::687     2e-07  36%  704 aa  PNP4_ALKMQ RecName: Full=Polyribonucleotide nucleotidyltransferase
  290::365     3e-07  41%  568 aa  RS1_RICTY RecName: Full=30S ribosomal protein S1;
  290::365     3e-07  41%  568 aa  RS1_RICPR RecName: Full=30S ribosomal protein S1;
  199::271     3e-07  32%  565 aa  RS1_RHOPA RecName: Full=30S ribosomal protein S1;AltName:
  186::258     3e-07  34%  551 aa  RS1_COXBU RecName: Full=30S ribosomal protein S1;
  618::696     3e-07  39%  703 aa  PNP_SYNWW RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  626::697     3e-07  36%  718 aa  PNP_NATTJ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::679     3e-07  39%  716 aa  PNP_IDILO RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  632::710     3e-07  39%  741 aa  PNP_DESAP RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::703     3e-07  39%  703 aa  PNP_CLOD6 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  636::721     3e-07  37%  728 aa  PNP_CHLCH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::711     3e-07  35%  733 aa  PNP_BARQU RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::703     3e-07  35%  733 aa  PNP_BARHE RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  280::348     3e-07  38%  392 aa  RS1_STAEQ RecName: Full=30S ribosomal protein S1;
 1265::1336    3e-07  36% 1729 aa  RRP5_YEAST RecName: Full=rRNA biogenesis protein RRP5;AltName:
  625::698     3e-07  36%  743 aa  PNP_PORGI RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  625::698     3e-07  36%  743 aa  PNP_PORG3 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::697     3e-07  31%  736 aa  PNP_ORITI RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  625::701     3e-07  31%  740 aa  PNP_ORITB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  632::700     3e-07  36%  757 aa  PNP_NEOSM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::692     3e-07  38%  706 aa  PNP_NEIMF RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::693     3e-07  38%  707 aa  PNP_NEIMB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::692     3e-07  38%  706 aa  PNP_NEIMA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::692     3e-07  38%  706 aa  PNP_NEIM0 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::692     3e-07  38%  706 aa  PNP_NEIG2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::693     3e-07  38%  707 aa  PNP_NEIG1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  629::700     3e-07  35%  755 aa  PNP_CHLSY RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  629::700     3e-07  35%  755 aa  PNP_CHLAD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  629::700     3e-07  35%  755 aa  PNP_CHLAA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::701     3e-07  34%  712 aa  PNP_CAUCR RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::701     3e-07  34%  712 aa  PNP_CAUCN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  625::695     3e-07  39%  719 aa  PNP_BORPD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  626::707     3e-07  31%  719 aa  PNP_AZOPC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  669::739     4e-07  34%  791 aa  TEX_BORPE RecName: Full=Protein tex;
  620::692     4e-07  41%  696 aa  PNP_LEPBP RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::692     4e-07  41%  696 aa  PNP_LEPBA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  633::691     4e-07  41%  718 aa  PNP_CYAP7 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::691     4e-07  38%  712 aa  PNP_BACCR RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  636::697     6e-07  41%  732 aa  PNP_PROVI RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  625::702     6e-07  36%  727 aa  PNP_DESHY RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  625::702     6e-07  36%  723 aa  PNP_DESHD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  636::721     6e-07  38%  732 aa  PNP_CHLPD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::701     6e-07  34%  716 aa  PNP_CAUSK RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  627::701     6e-07  37%  838 aa  PNP_ANAPZ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  631::698     7e-07  35%  717 aa  PNP_TRIEI RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  629::696     7e-07  32%  747 aa  PNP_ROSS1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  629::696     7e-07  32%  746 aa  PNP_ROSCS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  617::690     7e-07  39%  690 aa  PNP_PELUB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::698     7e-07  32%  729 aa  PNP_LEGPL RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  633::691     7e-07  39%  718 aa  PNP_CYAP8 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  190::264     1e-06  33%  557 aa  RS1_SHIFL RecName: Full=30S ribosomal protein S1;
   85::159     1e-06  33%  378 aa  RS1_PROSP RecName: Full=30S ribosomal protein S1;Flags: Fragment;
  287::361     1e-06  35%  556 aa  RS1_HELPY RecName: Full=30S ribosomal protein S1;
  190::264     1e-06  33%  557 aa  RS1_ECOLI RecName: Full=30S ribosomal protein S1;
  190::264     1e-06  33%  557 aa  RS1_ECOL6 RecName: Full=30S ribosomal protein S1;
  190::264     1e-06  33%  557 aa  RS1_ECO57 RecName: Full=30S ribosomal protein S1;
  628::686     1e-06  42%  702 aa  PNP_SPICI RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::728     1e-06  33%  744 aa  PNP_RICBR RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::728     1e-06  33%  744 aa  PNP_RICB8 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  626::699     1e-06  37%  746 aa  PNP_PARD8 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  651::728     1e-06  38%  732 aa  PNP_NITSB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::698     1e-06  32%  729 aa  PNP_LEGPH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::698     1e-06  32%  729 aa  PNP_LEGPC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  631::703     1e-06  37%  717 aa  PNP_CYTH3 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  364::438     1e-06  40%  549 aa  RS1_HAEIN RecName: Full=30S ribosomal protein S1;
  636::717     1e-06  36%  732 aa  PNP_PELLD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  632::690     1e-06  39%  717 aa  PNP_MICAN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::698     1e-06  32%  729 aa  PNP_LEGPA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::688     1e-06  37%  702 aa  PNP_CLOBM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::688     1e-06  37%  702 aa  PNP_CLOBL RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::688     1e-06  37%  702 aa  PNP_CLOBK RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::688     1e-06  37%  702 aa  PNP_CLOBJ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::688     1e-06  37%  702 aa  PNP_CLOBH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::688     1e-06  37%  702 aa  PNP_CLOB6 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::688     1e-06  37%  702 aa  PNP_CLOB1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  618::689     1e-06  35%  706 aa  PNP_ALKOO RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  616::687     1e-06  38%  702 aa  PNP3_ALKMQ RecName: Full=Polyribonucleotide nucleotidyltransferase
  616::687     1e-06  38%  702 aa  PNP1_ALKMQ RecName: Full=Polyribonucleotide nucleotidyltransferase
  198::280     2e-06  36%  552 aa  RS1_HELPJ RecName: Full=30S ribosomal protein S1;
  625::710     2e-06  36%  741 aa  PNP_STRTD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  625::710     2e-06  36%  741 aa  PNP_STRT2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  625::710     2e-06  36%  741 aa  PNP_STRT1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  636::713     2e-06  35%  747 aa  PNP_MOOTA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::698     2e-06  32%  704 aa  PNP_LYSSC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  626::698     2e-06  37%  773 aa  PNP_LACLA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  630::697     2e-06  34%  777 aa  PNP_HERA2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  626::699     2e-06  36%  708 aa  PNP_BACFR RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  626::699     2e-06  36%  708 aa  PNP_BACFN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  630::702     2e-06  36%  713 aa  PNP_AMOA5 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  616::677     2e-06  37%  702 aa  PNP2_ALKMQ RecName: Full=Polyribonucleotide nucleotidyltransferase
  196::268     2e-06  30%  568 aa  RS1_RHIME RecName: Full=30S ribosomal protein S1;
  656::714     2e-06  37%  729 aa  PNP_SULNB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  624::683     2e-06  38%  753 aa  PNP_RHOBA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  626::699     2e-06  34%  708 aa  PNP_BACTN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::703     2e-06  31%  775 aa  PNP_AQUAE RecName: Full=Polyribonucleotide nucleotidyltransferase; 
   14::95      2e-06  32%  341 aa  IF2A_DICDI RecName: Full=Eukaryotic translation initiation factor
  479::553     3e-06  35%  569 aa  RS1_CHLTR RecName: Full=30S ribosomal protein S1;
  631::702     3e-06  32%  716 aa  PNP_SYNP6 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  631::702     3e-06  32%  716 aa  PNP_SYNE7 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  632::707     3e-06  35%  740 aa  PNP_DESRM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  190::264     4e-06  31%  559 aa  RS1_BUCAP RecName: Full=30S ribosomal protein S1;
  190::264     4e-06  32%  558 aa  RS1_BUCAI RecName: Full=30S ribosomal protein S1;
  631::697     4e-06  37%  715 aa  PNP_THEEB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  654::720     4e-06  34%  721 aa  PNP_SULDN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  626::695     4e-06  37%  714 aa  PNP_AKKM8 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  392::464     5e-06  36%  570 aa  RS1_CHLMU RecName: Full=30S ribosomal protein S1;AltName: Full=70
  665::729     5e-06  31%  736 aa  PNP_WOLSU RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  645::715     5e-06  35%  728 aa  PNP_SULMW RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::716     5e-06  31%  745 aa  PNP_RICPR RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  630::690     5e-06  39%  691 aa  PNP_METCA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::687     5e-06  39%  710 aa  PNP_BACSK RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  192::260     6e-06  28%  263 aa  RR1_PORYE RecName: Full=30S ribosomal protein S1, chloroplastic;
  192::260     6e-06  28%  263 aa  RR1_PORPU RecName: Full=30S ribosomal protein S1, chloroplastic;
  625::693     6e-06  41%  710 aa  PNP_STRPZ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  625::693     6e-06  41%  710 aa  PNP_STRPM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  625::693     6e-06  41%  710 aa  PNP_STRPG RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  625::693     6e-06  41%  710 aa  PNP_STRPF RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  625::693     6e-06  41%  710 aa  PNP_STRPD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  625::693     6e-06  41%  710 aa  PNP_STRPC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  616::684     6e-06  41%  701 aa  PNP_STRPB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  625::693     6e-06  41%  710 aa  PNP_STRP8 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  625::693     6e-06  41%  710 aa  PNP_STRP6 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  625::693     6e-06  41%  710 aa  PNP_STRP3 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  625::693     6e-06  41%  710 aa  PNP_STRP1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  631::689     6e-06  37%  715 aa  PNP_CYAP4 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::729     8e-06  32%  745 aa  PNP_RICM5 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  625::690     8e-06  38%  779 aa  PNP_DEIRA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  194::262     1e-05  33%  305 aa  RS1B_SYNY3 RecName: Full=30S ribosomal protein S1 homolog B;
  183::255     1e-05  35% 1145 aa  PRP22_YEAST RecName: Full=Pre-mRNA-splicing factor ATP-dependent
  617::692     1e-05  32%  702 aa  PNP_TREPS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  617::692     1e-05  32%  702 aa  PNP_TREPA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  624::685     1e-05  35%  701 aa  PNP_STACT RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::695     1e-05  33%  747 aa  PNP_RICCK RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::682     1e-05  41%  738 aa  PNP_EXISA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  658::705     1e-05  44%  725 aa  PNP_ARCB4 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  640::709     1e-05  30%  757 aa  YHGF_NEIMB RecName: Full=Uncharacterized protein NMB0075;
  640::709     1e-05  30%  757 aa  YHGF_NEIMA RecName: Full=Uncharacterized protein NMA0194;
  620::712     1e-05  33%  745 aa  PNP_RICTY RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::700     1e-05  35%  748 aa  PNP_RICRS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::700     1e-05  35%  748 aa  PNP_RICRO RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::681     1e-05  35%  703 aa  PNP_MACCJ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  635::696     1e-05  41%  732 aa  PNP_CHLP8 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  631::708     1e-05  35%  731 aa  PNP_CARHZ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  649::714     1e-05  42%  744 aa  PNP_BEUC1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  648::713     1e-05  44%  782 aa  PNP_ACIC1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  643::709     2e-05  41%  767 aa  PNP_THEFY RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  625::693     2e-05  39%  709 aa  PNP_STRA5 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  625::693     2e-05  39%  709 aa  PNP_STRA3 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  625::693     2e-05  39%  709 aa  PNP_STRA1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::695     2e-05  33%  748 aa  PNP_RICPU RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  661::723     2e-05  40%  755 aa  PNP_MYCA9 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::700     2e-05  28%  704 aa  PNP_MANSM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::697     2e-05  33%  701 aa  PNP_MAGSM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::697     2e-05  36%  796 aa  PNP_EHRCJ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  655::736     2e-05  42%  914 aa  PNP_BIFLI RecName: Full=Polyribonucleotide nucleotidyltransferase; 
   13::235     2e-05  23%  315 aa  IF2A_XENLA RecName: Full=Eukaryotic translation initiation factor 2
  625::687     2e-05  38%  698 aa  PNP_ELUMP RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::692     2e-05  36%  703 aa  PNP_CLOCE RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  191::266     3e-05  32%  295 aa  RS1_SYNE7 RecName: Full=30S ribosomal protein S1;
  631::691     3e-05  38%  790 aa  PNP_THERP RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  624::685     3e-05  35%  697 aa  PNP_STAS1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::692     3e-05  34%  749 aa  PNP_RICCN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::694     3e-05  33%  747 aa  PNP_RICAH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::692     3e-05  34%  748 aa  PNP_RICAE RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  660::722     3e-05  40%  763 aa  PNP_MYCS2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::711     3e-05  29%  714 aa  PNP_METSB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::697     3e-05  36%  796 aa  PNP_EHRCR RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  636::697     3e-05  41%  733 aa  PNP_CHLTE RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  655::736     3e-05  41%  892 aa  PNP_BIFAA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::695     3e-05  32%  717 aa  PNP_ACICJ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  261::329     4e-05  26%  411 aa  RR1_SPIOL RecName: Full=30S ribosomal protein S1,
  626::693     4e-05  41%  737 aa  PNP_STRPI RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  624::685     4e-05  32%  701 aa  PNP_STAES RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  624::685     4e-05  32%  701 aa  PNP_STAEQ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::692     4e-05  33%  747 aa  PNP_RICFE RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  627::701     4e-05  36%  789 aa  PNP_EHRRW RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  627::701     4e-05  36%  789 aa  PNP_EHRRG RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::696     4e-05  35%  698 aa  PNP_CLOPH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  655::736     4e-05  41%  913 aa  PNP_BIFLO RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  655::736     4e-05  41%  913 aa  PNP_BIFLD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  632::690     4e-05  36%  718 aa  PNP_ANAVT RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  632::690     4e-05  36%  718 aa  PNP_ANASP RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  636::688     5e-05  42%  728 aa  PNP_PELPB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::693     5e-05  38%  693 aa  PNP_DICTD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
   13::235     5e-05  22%  315 aa  IF2A_XENTR RecName: Full=Eukaryotic translation initiation factor 2
   13::235     5e-05  22%  315 aa  IF2A_HUMAN RecName: Full=Eukaryotic translation initiation factor 2
  194::266     7e-05  30%  328 aa  RS1A_SYNY3 RecName: Full=30S ribosomal protein S1 homolog A;
  618::693     7e-05  30%  703 aa  PNP_SULSY RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  632::690     7e-05  34%  718 aa  PNP_NOSP7 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  663::726     7e-05  40%  752 aa  PNP_MYCTU RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  663::726     7e-05  40%  752 aa  PNP_MYCTA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  665::728     7e-05  40%  757 aa  PNP_MYCPA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  665::728     7e-05  40%  762 aa  PNP_MYCMM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  663::726     7e-05  40%  752 aa  PNP_MYCBT RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  663::726     7e-05  40%  752 aa  PNP_MYCBP RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  663::726     7e-05  40%  752 aa  PNP_MYCBO RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  656::719     7e-05  40%  748 aa  PNP_MYCA1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  654::719     7e-05  44%  746 aa  PNP_KINRD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  610::687     7e-05  32%  732 aa  PNP_GEMAT RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::693     7e-05  37%  693 aa  PNP_DICT6 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  639::701     7e-05  39%  736 aa  PNP_CHLL2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
   13::235     7e-05  22%  315 aa  IF2A_CHICK RecName: Full=Eukaryotic translation initiation factor 2
  618::704     9e-05  32%  707 aa  PNP_THETN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  626::693     9e-05  40%  733 aa  PNP_STRSV RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  624::700     9e-05  29%  700 aa  PNP_STAHJ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::693     9e-05  34%  701 aa  PNP_PSESM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  659::721     9e-05  39%  754 aa  PNP_MYCVP RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  661::723     9e-05  39%  756 aa  PNP_MYCGI RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  642::703     9e-05  34%  713 aa  PNP_GLOVI RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  643::716     9e-05  39%  729 aa  PNP_FRASC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
   13::235     9e-05  22%  315 aa  IF2A_RAT RecName: Full=Eukaryotic translation initiation factor 2
   13::235     9e-05  22%  315 aa  IF2A_PONAB RecName: Full=Eukaryotic translation initiation factor 2
   13::235     9e-05  22%  315 aa  IF2A_MOUSE RecName: Full=Eukaryotic translation initiation factor 2
   13::235     9e-05  22%  315 aa  IF2A_BOVIN RecName: Full=Eukaryotic translation initiation factor 2
  626::693     1e-04  41%  737 aa  PNP_STRZT RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  626::693     1e-04  41%  737 aa  PNP_STRZJ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  626::693     1e-04  41%  737 aa  PNP_STRR6 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  626::693     1e-04  41%  737 aa  PNP_STRPS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  626::693     1e-04  41%  737 aa  PNP_STRPN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  626::693     1e-04  41%  737 aa  PNP_STRPJ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  626::693     1e-04  41%  737 aa  PNP_STRP7 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  626::693     1e-04  41%  737 aa  PNP_STRP4 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  626::693     1e-04  41%  737 aa  PNP_STRP2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  626::685     1e-04  32%  698 aa  PNP_STAAW RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  626::685     1e-04  32%  698 aa  PNP_STAAT RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  626::685     1e-04  32%  698 aa  PNP_STAAS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  626::685     1e-04  32%  698 aa  PNP_STAAR RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  626::685     1e-04  32%  698 aa  PNP_STAAN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  626::685     1e-04  32%  698 aa  PNP_STAAM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  626::685     1e-04  32%  698 aa  PNP_STAAE RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  626::685     1e-04  32%  698 aa  PNP_STAAC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  626::685     1e-04  32%  698 aa  PNP_STAAB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  626::685     1e-04  32%  698 aa  PNP_STAA9 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  626::685     1e-04  32%  698 aa  PNP_STAA8 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  626::685     1e-04  32%  698 aa  PNP_STAA3 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  626::685     1e-04  32%  698 aa  PNP_STAA2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  626::685     1e-04  32%  698 aa  PNP_STAA1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::661     1e-04  45%  718 aa  PNP_RHOP2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  649::731     1e-04  37%  742 aa  PNP_NOCSJ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  665::728     1e-04  40%  762 aa  PNP_MYCUA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  627::712     1e-04  33%  714 aa  PNP_FLAJ1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::696     1e-04  32%  699 aa  PNP_BLOPB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  623::680     2e-04  28%  705 aa  PNP_WIGBR RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  656::718     2e-04  39%  759 aa  PNP_MYCSS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  656::718     2e-04  39%  759 aa  PNP_MYCSK RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  656::718     2e-04  39%  759 aa  PNP_MYCSJ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  643::708     2e-04  37%  729 aa  PNP_FRASN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  624::683     2e-04  37%  739 aa  PNP_EXIS2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  625::690     2e-04  35%  721 aa  PNP_DEIDV RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::686     2e-04  38%  707 aa  PNP_METI4 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  637::697     2e-04  34%  706 aa  PNP_JANSC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  617::662     2e-04  43%  712 aa  PNP_DESAA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  625::690     2e-04  35%  721 aa  PNP_DEIGD RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  672::730     2e-04  44%  732 aa  PNP_CAMC1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  628::727     3e-04  29%  779 aa  RNR_BACSU RecName: Full=Ribonuclease R;         Short=RNase R;     
  620::661     3e-04  43%  722 aa  PNP_RHOPS RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::661     3e-04  43%  722 aa  PNP_RHOPA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  644::709     3e-04  37%  729 aa  PNP_FRAAA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  669::728     3e-04  37%  728 aa  PNP_CAMFF RecName: Full=Polyribonucleotide nucleotidyltransferase; 
   12::210     3e-04  24%  341 aa  IF2A_DROME RecName: Full=Eukaryotic translation initiation factor 2
  620::669     3e-04  40%  693 aa  PNP_THISH RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  648::713     3e-04  40%  737 aa  PNP_STRGG RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  648::713     3e-04  40%  739 aa  PNP_STRCO RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  648::713     3e-04  40%  738 aa  PNP_STRAW RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::661     3e-04  43%  722 aa  PNP_RHOPT RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::712     3e-04  31%  725 aa  PNP_METS4 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  618::698     3e-04  32%  712 aa  PNP_GLUDA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  624::698     3e-04  31%  711 aa  PNP_FLAPJ RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  655::729     3e-04  42%  873 aa  PNP_BIFA0 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::660     3e-04  46%  715 aa  PNP_BEII9 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  626::693     4e-04  38%  728 aa  PNP_STRGC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  641::707     4e-04  30%  709 aa  PNP_HELHP RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  627::688     6e-04  32%  697 aa  PNP_THEAB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::712     6e-04  30%  725 aa  PNP_METNO RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  632::703     6e-04  33%  703 aa  PNP_FUSNN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  622::659     8e-04  42%  730 aa  PNP_XANP2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  633::677     8e-04  31%  758 aa  PNP_WOLPP RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  650::716     8e-04  37%  733 aa  PNP_PROAC RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  638::689     8e-04  41%  734 aa  PNP_PROA2 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  619::687     8e-04  29%  750 aa  PNP_DESDG RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::657     0.001  46%  702 aa  PNP_STRMK RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  621::657     0.001  46%  702 aa  PNP_STRM5 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::704     0.001  27%  728 aa  PNP_PARL1 RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  643::702     0.001  35%  702 aa  PNP_CAMLR RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  627::697     0.001  27%  715 aa  PNP_BREBN RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  620::661     0.001  40%  720 aa  PNP_BRAJA RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  624::707     0.001  30%  805 aa  PNP_ANAMM RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  624::707     0.001  30%  805 aa  PNP_ANAMF RecName: Full=Polyribonucleotide nucleotidyltransferase; 
    1::266

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKYSGWPEPGELVVGDVDEIADFGVFVDLDEYEDKRGLCHISEVASGWIKNVRDHVREGQTVVAKVLDVD
IF2A_HALMA      MKYSGWPEPGELVVGKIDEIEDFGVFVDLDEYEGKRGLCHISEVASGWIKNVRDHVNEGQTVVAKVLDVD
IF2A_HALSA      MKYEGWPDEGELVVGKVDDIEDFGVFVDLEQYQDKRGLVHVSEVASGWIKNVRDHVNEDQTVVAKVLGVD
IF2A_HALS3      MKYEGWPDEGELVVGKVDDIEDFGVFVDLEQYQDKRGLVHVSEVASGWIKNVRDHVNEDQTVVAKVLGVD
IF2A_ARCFU      IKRSGYPSKGEIVIGTVKRVLDFGAFVSLDEYEGREGMVHISEVASGWIKDIREHVKKGQKVICKVLDVN
IF2A_METS3      -KNQEWPDEGELIIGTVYKVLNYGAFAKLEEYHGKEAFIHISEVSSGWVKNIRDHVRENQKIVCRVLRVN
IF2A_METJA      -----FPEEGDIVIGTVKDVKPYGAFVELLEYPGKEGMIHISEVTSGWVKNIRDHVKVGQRVVAKVLRVD
IF2A_METST      -----WPEEGDLIVGTVHKVLGYGAFAKLEEYEGKEAFIHISEVSSGWVKNIRDYVRENQKIVARVLRVN
IF2A_METTH      -----WPEEGELVVGTVHKVLNYGAFATLEEYPGKEAFIHISEVSSGWVKNIRDFVRENQKIVARVLRVN
IF2A_METKA      ------PEEGEIVMATVERVEDHGAFVTLDEYPGVDGYIHISEVASGWVKNIRDYVKEGQKVVAKVIRVN
IF2A_THEON      -KAKEYPEEGEFVIATVKSIHPYGAFLKLDEYPGKEGFMHISEVASTWVKNIRDYVKEGQKVVAKVIRVD
IF2A_PYRKO      -KAKEYPEEGEFVVATVKNIHPYGAFLTLDEYPGKEGFMHISEVAPTWVKNIRDYLKEGQKIVAKVIRVD
IF2A_THEGJ      -----YPEEGEFVVATVKNIHPYGAFLILDEYPGKEGFMHISEVAPTWVKNIRDYVKEGQKVVVKVIRVD
IF2A_THEAC      ------PDNGDLVVVKITEVKNFGANGVLEEYPGVEGYIHISEVATGWVKHIRSYLREGQRVVCKVIGVN
IF2A_PYRHO      -----YPEEGEFVVATVKRIHNYGAFLELDEYPGKEAFMHISEVASTWVRNIRDYLKEGQKVVAKVIRVD
IF2A_PYRFU      -----YPEEGELVVATVKRVHNYGAFLDLDEYPGKEGFMHISEVASTWVKNIRDYLREGQKVVAKVIRVD
IF2A_THEVO      ------PEVGDLVVVKITEVKNFGANGILEEYPGVEGYIHISEVATGWVKHIRSYLREGQRVVCKVINVN
IF2A_PYRAB      -----YPEEGEFVVATVKRIHNYGAFLELDEYPGKEAFMHISEVASTWVRNIRDYLKEGQKVVAKVIRVD
IF2A_STAMF      ------PNVGEYVIATVKEIFDYGAYVTLDEYNGLEAYLPWSEVASRWVRNIRDVIRENQXXXXXXXXXX
IF2A_HYPBU      ------PDVGELVVATVKEVYDYGAYLTLDEYGGLEAYLPWSEVASRWVRSIHDVVKPGXXXXXXXXXXX
IF2A_AERPE      ------PDVGEIVVGTVQEVHDYGAYLILDEYGGVRAFLPWSEIASRAVRNIHAVLXXXXXXXXXXXXXX
IF2A_SULTO      ------PTEGEILIATVKQIFDYGSYVTLDEYGNLQAFLPWSEISSRWVKNIRDXXXXXXXXXXXXXXXX
IF2A_PYRAE      -----FPDVGELVIGTVKKIAEHGAYVYLDEY-DLEAFAPTQEIVQSWFHSIRDYVKEGNKTVFKVISVN
IF2A_SULIY      ------PSEGEILIATVKQVFDYGSYVTLDEYGGLQAFLPWSEVSSKWVKNIRDVLKENXXXXXXXXXXX
IF2A_SULIN      ------PSEGEILIATVKQVFDYGSYVTLDEYGGLQAFLPWSEVSSKWVKNIRDVLKENXXXXXXXXXXX
IF2A_SULIM      ------PSEGEILIATVKQVFDYGSYVTLDEYGGLQAFLPWSEVSSKWVKNIRDVLKENXXXXXXXXXXX
IF2A_SULIK      ------PSEGEILIATVKQVFDYGSYVTLDEYGGLQAFLPWSEVSSKWVKNIRDVLKENXXXXXXXXXXX
IF2A_SULIA      ------PSEGEILIATVKQVFDYGSYVTLDEYGGLQAFLPWSEVSSKWVKNIRDVLKENXXXXXXXXXXX
IF2A_SULSO      ------PSEGEILIATVKQVFDYGSYVSLDEYGGLQAFLPWSEVSSKWVKNIRDVLKENXXXXXXXXXXX
IF2A_SULIL      ------PSEGEILIATVKQVFDYGSYITLDEYGGLQAFLPWSEVSSKWVKNIRDVLKENXXXXXXXXXXX
PNP_HAHCH       -------EVGKLYRGKVERIVEFGAFVNI--LPGKDGLVHISQIAQERVENVTDYLKEGQEVVVKVLDID
PNP_CHRSD       ------PEIGKLYRGTVARITDFGAFVTFMPGTD--GLVHISQIVPERVNDVRDYLSEGQEVIVKVLDID
PNP_MARAV       -------EVGAIYKGRVERIVDFGAFVNI--LPGKDGLVHISQISERRIENVTDELSEGQEVLVKVLDVD
PNP_LEPIN       -------EVGKIYEGKVKRIADFGAFVEI--LPGKEGLCHISKIDFKRVNSVKDIVKEGDIIRVKVLNVD
PNP_LEPIC       -------EVGKIYEGKVKRIADFGAFVEI--LPGKEGLCHISKIDFKRVNSVKDIVKEGDIIRVKVLNVD
PNP_HAMD5       -------EVGRIYQGTVTRIADYGAFVSIASA--KEGLVHISQIAEGRVEKVTDHLKLKQQVSVKVLEID
RS1H_BACSU      -------KPGDVLEGTVQRLVSFGAFVEI--LPGVEGLVHISQISNKHIGTPHEVLEEGQTVKVKVLDVN
PNP_LEPBL       -------EVGKIYEGKVKRIADFGAFVEI--LPGKEGLCHISKIDFKRVNSVKDIVKEGDIIRVKVLNVD
PNP_LEPBJ       -------EVGKIYEGKVKRIADFGAFVEI--LPGKEGLCHISKIDFKRVNSVKDIVKEGDIIRVKVLNVD
PNP_ACIBL       -------EVGKTYLGTVTRLADFGAFVEILPGTD--GLLHISEVAEHRIKDVKDELHEGDQVLVKVLAVD
PNP_MARMS       -------EVDKLYKGKVVRLAEFGAFVNI--LPGKDGLVHISQIAEERIRAVTDFLSEGQEVIVKVLDVD
GS13_BACSU      -------EVGSVYTGKVTGLQAYGAFVALDE--ETQGLVHISEVTHGFVKDINEHLSVGDEVQVKVLAVD
PNP_PSEU5       -------EIGKIYVGKVERIVDFGAFVNI--LPGKDGLVHISQISDQRIEKVTDVLKEGQEVKVLVLDVD
PNP_AZOVD       -------EIGKIYVGKVERIVDFGAFVNI--LPGKDGLVHISQISDQRIEKVTDVLKEGQEVKVLVLDVD
PNP_ACIC5       ------PEVGKTYLGKVVRLAEFGAFVEIFPGTD--GLLHISEIAEHRVKEVKDELHEGDQVMVKVLGVE
PNP_PSEA6       -------EAGKTYEGKVTRIVDFGAFVEI--LPGKEGLVHISQIAHERVNKVADHLSEGQIINVKVMEID
PNP_PSYIN       -------EVGTIYTGKVVRLADFGAFVNI--LPGKDGLVHISQICEERVQKVSDHLKEGQEVKVKVLEVD
PNP_PSEHT       -------EVGTIYEGKVVRIVDFGAFVNI--LPGKDGLVHISQISTERVNNVTDHLSEGQEVKVKVLEVD
PNP_PSEAE       -------EIGKIYVGKVERIVDFGAFVNI--LPGKDGLVHISQISDKRIDKVTDVLQEGQEVKVLVLDVD
PNP_PSEAB       -------EIGKIYVGKVERIVDFGAFVNI--LPGKDGLVHISQISDKRIDKVTDVLQEGQEVKVLVLDVD
PNP_PSEA8       -------EIGKIYVGKVERIVDFGAFVNI--LPGKDGLVHISQISDKRIDKVTDVLQEGQEVKVLVLDVD
PNP_PSEA7       -------EIGKIYVGKVERIVDFGAFVNI--LPGKDGLVHISQISDKRIDKVTDVLQEGQEVKVLVLDVD
PNP_XYLFT       -------EPGRIYEGKVAKIMDFGAFVTI--LPGKDGLVHVSQISSERVERVGDKLKEGDVVRVKVLEVD
PNP_XYLFM       -------EPGRIYEGKVAKIMDFGAFVTI--LPGKDGLVHVSQISSERVERVGDKLKEGDVVRVKVLEVD
PNP_XYLFA       -------EPGRIYEGKVAKIMDFGAFVTI--LPGKDGLVHVSQISSERVERVGDKLKEGDVVRVKVLEVD
PNP_XYLF2       -------EPGRIYEGKVAKIMDFGAFVTI--LPGKDGLVHVSQISSERVERVGDKLKEGDVVRVKVLEVD
PNP_PSEPW       -------EIGKIYVGKVERIVDFGAFVNI--LPGKDGLVHISMLSDARVEKVTDILKEGQEVEVLVLDVD
PNP_PSEPU       -------EIGKIYVGKVERIVDFGAFVNI--LPGKDGLVHISMLSDARVEKVTDILKEGQEVEVLVLDVD
PNP_PSEPK       -------EIGKIYVGKVERIVDFGAFVNI--LPGKDGLVHISMLSDARVEKVTDILKEGQEVEVLVLDVD
PNP_PSEPG       -------EIGKIYVGKVERIVDFGAFVNI--LPGKDGLVHISMLSDARVEKVTDILKEGQEVEVLVLDVD
PNP_PSEPF       -------EIGKIYVGKVERIVDFGAFVNI--LPGKDGLVHISMLSDARVEKVTDILKEGQEVEVLVLDVD
PNP_PSEP1       -------EIGKIYVGKVERIVDFGAFVNI--LPGKDGLVHISMLSDARVEKVTDILKEGQEVEVLVLDVD
PNP_PSEFS       -------EIGKIYVGKVERIVDFGAFVNI--LPGKDGLVHISMLSDARVEKVTDILKEGQEVEVLVLDVD
PNP_PSEF5       -------EIGKIYVGKVERIVDFGAFVNI--LPGKDGLVHISMLSDARVEKVTDILKEGQEVEVLVLDVD
PNP_PSEE4       -------EIGKIYVGKVERIVDFGAFVNI--LPGKDGLVHISMLSDARVEKVTDVLKEGQEVEVLVLDVD
PNP_PSE14       -------EIGKIYVGKVERIVDFGAFVNI--LPGKDGLVHISMLSDARVEKVTDILKEGQEVEVLVLDVD
ISPH_CLOTE      ---------GNIVLGTVVRFASFGAFVELEPGVD--GLIHISQISHKRVDRVEDELSIGEQVKAKIVEVD
PNP_XANOR       -------EPGRIYEGKVAKIMDFGAFVTI--LPGKDGLVHVSQISSERVEKVGDKLKEGDLVRVKVLEVD
PNP_XANOP       -------EPGRIYEGKVAKIMDFGAFVTI--LPGKDGLVHVSQISSERVEKVGDKLKEGDLVRVKVLEVD
PNP_XANOM       -------EPGRIYEGKVAKIMDFGAFVTI--LPGKDGLVHVSQISSERVEKVGDKLKEGDLVRVKVLEVD
PNP_XANCP       -------EPGRIYEGKVAKIMDFGAFVTI--LPGKDGLVHVSQISSERVEKVGDKLKEGDLVRVKVLEVD
PNP_XANCB       -------EPGRIYEGKVAKIMDFGAFVTI--LPGKDGLVHVSQISSERVEKVGDKLKEGDLVRVKVLEVD
PNP_XANC8       -------EPGRIYEGKVAKIMDFGAFVTI--LPGKDGLVHVSQISSERVEKVGDKLKEGDLVRVKVLEVD
PNP_XANC5       -------EPGRIYEGKVAKIMDFGAFVTI--LPGKDGLVHVSQISSERVEKVGDKLKEGDLVRVKVLEVD
PNP_XANAC       -------EPGRIYEGKVAKIMDFGAFVTI--LPGKDGLVHVSQISSERVEKVGDKLKEGDLVRVKVLEVD
PNP_PSEU2       -------EIGKIYIGKVERIVDFGAFVNI--LPGKDGLVHISMLSDARVEKVTDILKEGQEVEVLVLDVD
PNP_PHOPR       -------EVGRIYTGKVMRIVDFGAFVSV--IGAKEGLVHISQIAQERVEKVSDHLQMGQEVQVKVLEID
PNP_TREDE       ------PEVGMVYDGTVKKIMDFGAFVEI--LPGKEGLCHISKLSRSRVEKVSDVLKEGQEIPVKLLEID
PNP_PSEMY       -------EIGKIYVGKVERIVDFGAFVNI--LPGKDGLVHISMLSDQRVEKVTDVLKEGQEVKVLVLDVD
PNP_DESOH       ------PEPGEIYEGEVVRITDFGAFIQIKNGTD--GLCHISELEHHHVKSVTDVVKMGDKVRVKVLEV-
PNP_COXBU       -------ELGKVYEGTVVKITDFGAFVQI--LPNTQGLVHISQIAQERVENVRDYLEEGQVIRVKVIEID
PNP_COXBR       -------ELGKVYEGTVVKITDFGAFVQI--LPNTQGLVHISQIAQERVENVRDYLEEGQVIRVKVIEID
PNP_COXBN       -------ELGKVYEGTVVKITDFGAFVQI--LPNTQGLVHISQIAQERVENVRDYLEEGQVIRVKVIEID
PNP_COXB2       -------ELGKVYEGTVVKITDFGAFVQI--LPNTQGLVHISQIAQERVENVRDYLEEGQVIRVKVIEID
PNP_COXB1       -------ELGKVYEGTVVKITDFGAFVQI--LPNTQGLVHISQIAQERVENVRDYLEEGQVIRVKVIEID
PNP_ACIAD       -------EPGKIYDGKVIRIVEFGAFVNIMPGTD--GLLHISQISNERVANVSDVLKEGQDVKVQVADVD
PNP_SOLUE       -------EIGKTYLGKVVRLVDFGAFVEIFPGTD--GLLHISEIAENRIKDVRDELKEGDQILVKCLALE
PNP_NITEU       -------EVGRIYEGTVLKLLDFGAIVSV--LPGKDGLLHISQIANERVENVADHLKEGQTVRVKVLEAD
PNP_ACIF5       --------------GKVAKIMDFGAFVTILPGRD--GLLHISQISNERVSDVHDHLKEGQAVRVKVLEVD
PNP_ACIF2       --------------GKVAKIMDFGAFVTILPGRD--GLLHISQISNERVSDVHDHLKEGQAVRVKVLEVD
PNP_ACIBY       -------EPGKIYDGKVIRIVEFGAFVNIMPGTD--GLLHISQISNERIANVTDVLKEGQEVKVQVQDVD
PNP_ACIBT       -------EPGKIYDGKVIRIVEFGAFVNIMPGTD--GLLHISQISNERIANVTDVLKEGQEVKVQVQDVD
PNP_ACIBS       -------EPGKIYDGKVIRIVEFGAFVNIMPGTD--GLLHISQISNERITNVTDVLKEGQEVKVQVQDVD
PNP_ACIBC       -------EPGKIYDGKVIRIVEFGAFVNIMPGTD--GLLHISQISNERIANVTDVLKEGQEVKVQVQDVD
PNP_ACIB5       -------EPGKIYDGKVIRIVEFGAFVNIMPGTD--GLLHISQISNERIANVTDVLKEGQEVKVQVQDVD
PNP_ACIB3       -------EPGKIYDGKVIRIVEFGAFVNIMPGTD--GLLHISQISNERIANVTDVLKEGQEVKVQVQDVD
YABR_BACSU      -------EVGSKLQGKITGITNFGAFVELPG--GSTGLVHISEVADNYVKDINDHLKVGDQVEVKVINV-
PNP_CHLTR       ---TGEVEVGKVYNGRVTSIATFGVFVEV--LPGKEGLCHISELSKQKVDNISDFVKEGDKLAVKLLSIN
PNP_CHLTB       ---TGEVEVGKVYNGRVTSIATFGVFVEV--LPGKEGLCHISELSKQKVDNISDFVKEGDKLAVKLLSIN
PNP_CHLTA       ---TGEVEVGKVYNGRVTSIATFGVFVEV--LPGKEGLCHISELSKQKVDNISDFVKEGDKLAVKLLSIN
PNP_CHLT2       ---TGEVEVGKVYNGRVTSIATFGVFVEV--LPGKEGLCHISELSKQKVDNISDFVKEGDKLAVKLLSIN
PNP_ALCBS       -------EVGAIYEGKVTRVVDFGAFVAI--MPGTEGLLHISQIAEERVEKVTDYVNEGEIIKVKVLDVD
PRP22_SCHPO     --------------GVVSGIKDFGAFVTLDGFRKRTGLVHISNIQNGRLDHPSEAVSYGQPVFVKVIRID
PNP_EDWI9       ---------GRIYQGKVTRIVDFGAFVAIGG--GKEGLVHISQIADKRVEKVTDYLQMGQEVAVKVLEVD
PNP_CLONN       --YSREVKEGEVYLGKVTKIANFGAFVEI--LPGKEGLVHISKLDVKRVNKVEDVVSVGDEILVKVTEID
ISPH_CLOAB      ---------GSVVLGKVIRFADFGAFVKLEPGVD--GLVHISEISHKRIAKPSDALNVGEEIKAKILEVS
IF2A_YEAST      -----YPEIDDIVMVNVQQIAEMGAYVKLLEYDNIEGMXXXXXXXXXXXXXXQKLIRVGKNDVAVVLRVD
DHX8_ARATH      ------PELYQVYKGRVTRVMDAGCFVQFDKFRGKEGLVHVSQMATRRVDKAKEFVKRDMEVYVKVISI-
RS1_STAS1       ---------GDVIEGKVARLTNFGAFVDIGGVD---GLVHVSELSHEHVKSPEDVVSIGETVNVKIKSVD
PNP_VIBCM       -------EVGVIYTGKVARLADFGAFVTI--LPGKDGLVHISQIADKRVEKVSDYLTEGQEVQVKVLEID
PNP_VIBCH       -------EVGVIYTGKVARLADFGAFVTI--LPGKDGLVHISQIADKRVEKVSDYLTEGQEVQVKVLEID
PNP_VIBC3       -------EVGVIYTGKVARLADFGAFVTI--LPGKDGLVHISQIADKRVEKVSDYLTEGQEVQVKVLEID
PNP_SHEAM       -------EVGRLYTGKVIRIVDFGAFVNI--LPGKDGLVHISQISDERVANVSDHLQLNQEVTVKVMEVD
PNP_HALOH       -------EVGDIYEGRVKKITNFGAFVEI--LPGREGLVHISELADHHVKKVEDIVKIGDRIPVKVIEID
PNP_HALHL       -------EVGKVYDGKVAKLMDFGAFVNILPGRD--GLVHISQISNNRVENVADELSEGDSVRVKVLEVD
PNP_VIBFM       ---------GKIYTGKVMRIVDFGAFVTV--LGPKEGLVHISQIAEERIEKVADHLQVGQEVKTKVLEID
PNP_VIBF1       ---------GKIYTGKVMRIVDFGAFVTV--LGPKEGLVHISQIAEERIEKVADHLQVGQEVKTKVLEID
PNP_SYMTH       ------PEPGMIYTGRVTRLMQFGAFVEI--LPGKEGLVHISELSDKRVARVEDVVNIGDEVTVKVTEID
PNP_RHILO       ------PEVGEIYEGTVVKTADFGAFVNF--FGPRDGLVHISQLANERVAKTSDVVKEGDKVWVKLMGFD
PNP_POLSJ       -------EIGKVYEGAITKILDFGALVNL--LPGKDGLLHISQIAHERVEKVTDYLSEGQIVKVKVLETD
PNP_METEP       ------PEAGTIYDGTIVKIMEFGAFVNF--FGAKDGLVHISELAAQRVAKVGDVVKEGQKVKVKFLGAD
PNP_METC4       ------PEAGTIYDGTIVKIMEFGAFVNF--FGAKDGLVHISELAAQRVAKVGDVVKEGQKVKVKFLGAD
PNP_DELAS       -------EIGKIYEGPVTKILDFGALVNL--LPGKDGLLHISQIAHERVERVADYLQEGQIIKVKVMETD
PNP_ALISL       ---------GKIYPGKVMRIVDFGAFVTV--LGPKEGLVHISQIAEERIEKVADHLQVGQEVQTKVLEID
PNP_ACTSZ       -------EAGAVYTGKVTRLADFGAFVAI--LGNKEGLVHISQIAEERVEKVSDYLQVGQDVQVKVVEID
PNP_VIBHB       ---------GRIYTGKVARLADFGAFVTV--LPGKDGLVHISQIAEKRVEKVSDYLTEGQEVQVKVLEID
PNP_TERTT       --------------GKVVRIVDFGAFVNF--LPGKDGLVHISQIAHERVQNVTDYLKEGQEVDVKCMDID
PNP_OCHA4       ------PEVGEIYEGTVVKTADFGAFVNF--FGPRDGLVHISQLASDRVAKTTDVVKEGQKVWVKLMGFD
PNP_ERWCT       ---------GRVYQGKVTRIVDFGAFVAIGG--GKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVD
PNP_ECO27       ---------GRVYNGKVTRIVDFGAFVAIGG--GKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVD
PNP_DICNV       ------PEIGRIYDAKVTKITDFGAFLQF--LPGKEGLVHISQIADYRVNDVRDELTEGQEVKVKLLEID
PNP_DESPS       -------EVGAVYTGKVKTIKDFGAFVEILPGTD--GLVHISELALERVKDVTDVVNEGDTIEVKVLDVD
PNP_DESAH       ------PEIGGIYEGEVVKTTDFGAFVRIKTGTD--GLVHISELANHRVKKVTDVVKEGEVIRVKVLEIT
PNP_BURP8       -------EVGQVYEGTVLKLLDFGAIVNL--LPGKDGLLHISEIANERIKDINDYLKEGQQVKVKVIQTD
PNP_ALHEH       -------EVGTVYEGKVSKLMDFGAFVNILPGRD--GLVHISQISNERVERVGDYLKEGDTVRVKVLEVD
PNP_VARPS       -------EIGKVYEGPVTKILDFGALINL--LPGKDGLLHISQIAHERVEKVTDYLSEGQIVKVKVLETD
PNP_SILPO       ------PEEGQVYTGKVVKIVDFGAFVNF--FGKRDGLVHVSQIENRRLNHPSDVLKEGQEVKVKLLGFD
PNP_PASMU       -------EAGAVYKGKVTRLADFGAFVSI--VGNKEGLVHISQIAEERVEKVSDYLAVGQEVTVKVVEID
PNP_NITOC       -------EVGKIYEGRVSRLMDFGAFVTI--LPGKDGLLHISQISAERVKNVSDKLSEGDVIRVKVLEVD
PNP_KLEP3       ---------GRIYNGKVTRIVDFGAFVAIGG--GKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVD
PNP_BLOFL       ---------GSIYTGRVTHIVDFGAFVTL--FAGKEGLVHISQITEKRVNRVSDYLKLGQEVLVKVLEID
PNP_BAUCH       -------EVGSIYHGKVTRIVDFGAFIAISS--NKEGLVHISQITNKRVEKVADYLSIDQIVLVKVLEVD
PNP_AZOSE       -------EVGKVYNGTVVRLLDFGAIVNIMPGRD--GLLHVSQIANERVNNVADYVKEGQAVRVKVLETD
PNP_ANASK       -------EVGRIYLGTVRKIAEFGAFVEIFPGTD--GLIHISELSDKRVKSVSDVLSEGEEVMVKVISVD
PNP_ANADE       -------EVGRIYMGTVRKIAEFGAFVEIFPGTD--GLIHISELSDKRVKSVSDVLSEGEEVMVKVISVD
PNP_ANAD2       -------EVGRIYLGTVRKIAEFGAFVEIFPGTD--GLIHISELSDKRVKSVSDVLSEGEEVMVKVISVD
PNP_METPB       ------PEAGTIYDGTIVKIMEFGAFVNF--FGAKDGLVHISELAPQRVAKVGDVVKEGQKVKVKFLGAD
PNP_CLOK5       ---------GEIYLGKVTKITNFGAFVEI--HKGKEGLVHISKLDFTRVNKVEDIVSVGDEILVKVIEID
PNP_CLOK1       ---------GEIYLGKVTKITNFGAFVEI--HKGKEGLVHISKLDFTRVNKVEDIVSVGDEILVKVIEID
PNP_CHRVO       -------EVGKVYEGTVVKILDNNVGAIVSILPGKDGLVHISQIANERIKNVSDYLKEGQVVKVKAIEMD
PNP_AZOSB       -------EVGKVYEGTVVRLLDFGAIVNILPGRD--GLLHVSQIANERVNNVGDYVKEGQAVRVKVLETD
PNP_VESOH       ------PEVNKVYTGKVVKIVEFGAFINIMPNQD--GLLHISEISHERVEKVKDHIREGDKIDVKVIGLD
PNP_SPHWW       ------PEVGKIYTGKVVNLVDFGAFVNFMGGKD--GLVHVSEIKNERVEKVADALSEGQEVKVKVLEID
PNP_SACD2       --------------GKVVRIVDFGAFVNF--LPGKDGLVHISQIAHERVQNVSDYLKEGQDIEVKCMDID
PNP_NITWN       ------PEVGEIYEGTVVKVMEFGAFVNF--FGAKDGLVHISQLAAGRVQKTSDVVKEGAKVKVKLLGFD
PNP_CLOTH       -------EPGQVFLGRVIRVTSFGAFVEF--LPGKEGLVHISKLDKKRVERVEDIVRVGDQILVKVIEID
PNP_CLOPS       ---------GEIYLGKVTKIAQFGAFVEV--LPNKEGLVHISKLDNKRVEKVEDIVSVGDEILVKVTEID
PNP_CLOPE       ---------GEIYLGKVTKIAQFGAFVEV--LPNKEGLVHISKLDNKRVEKVEDVVSVGDEILVKVTEID
PNP_CLOP1       ---------GEIYLGKVTKIAQFGAFVEV--LPNKEGLVHISKLDNKRVEKVEDVVSVGDEILVKVTEID
PNP_CHLMU       ---TGEVEVGKIYNGRVTSVVAFGAFVEV--LPGKEGLCHISELSKQKVDNVADFVKEGDRLAVKLLSIN
PNP_CHLAB       ----GEVEVGKIYEGRVTSVVPFGAFVEI--LPGKEGLCHISEFSKQRIDNVGDFVKQGDTLTVKLLSIN
PNP_CELJU       ----------------VVRIVDFGAFVNF--LPGKDGLVHISQIADERVNNVSDYLKEGQVVKVKCLDVD
PNP_BRUSU       ------PEVGEIYEGTVVKTADFGAFVNF--FGPRDGLVHISQLAADRVAKTTDVVKEGQKVWVKLMGFD
PNP_BRUSI       ------PEVGEIYEGTVVKTADFGAFVNF--FGPRDGLVHISQLAADRVAKTTDVVKEGQKVWVKLMGFD
PNP_BRUO2       ------PEVGEIYEGTVVKTADFGAFVNF--FGPRDGLVHISQLAADRVAKTTDVVKEGQKVWVKLMGFD
PNP_BRUME       ------PEVGEIYEGTVVKTADFGAFVNF--FGPRDGLVHISQLAADRVAKTTDVVKEGQKVWVKLMGFD
PNP_BRUMB       ------PEVGEIYEGTVVKTADFGAFVNF--FGPRDGLVHISQLAADRVAKTTDVVKEGQKVWVKLMGFD
PNP_BRUC2       ------PEVGEIYEGTVVKTADFGAFVNF--FGPRDGLVHISQLAADRVAKTTDVVKEGQKVWVKLMGFD
PNP_BRUAB       ------PEVGEIYEGTVVKTADFGAFVNF--FGPRDGLVHISQLAADRVAKTTDVVKEGQKVWVKLMGFD
PNP_BRUA2       ------PEVGEIYEGTVVKTADFGAFVNF--FGPRDGLVHISQLAADRVAKTTDVVKEGQKVWVKLMGFD
PNP_BRUA1       ------PEVGEIYEGTVVKTADFGAFVNF--FGPRDGLVHISQLAADRVAKTTDVVKEGQKVWVKLMGFD
PNP_ACTPJ       -------EVNAIYKGKVTRVVDFGAFVSI--LGGKEGLVHISQITNERVERVADYLSVGQEVTVKVVEID
PNP_ACTP7       -------EVNAIYKGKVTRVVDFGAFVSI--LGGKEGLVHISQITNERVERVADYLSVGQEVTVKVVEID
PNP_ACTP2       -------EVNAIYKGKVTRVVDFGAFVSI--LGGKEGLVHISQITNERVERVADYLSVGQEVTVKVVEID
RS1_LEULA       ---------GSVLEGTVKRVKDFGAFVEI--LPGIEGLVHVSQISNKRIENPSEVLKSGDKVQVKVLDIK
PNP_SHESW       -------EVGRIYNGKVIRIVDFGAFVNI--LPGKDGLVHISQISDERVANVSDHLELNQEVAVKVMEVD
PNP_SHESR       -------EVGRIYNGKVIRIVDFGAFVNI--LPGKDGLVHISQISDERVANVSDHLELNQEVTVKVMEVD
PNP_SHESM       -------EVGRIYNGKVIRIVDFGAFVNI--LPGKDGLVHISQISDERVANVSDHLELNQEVTVKVMEVD
PNP_SHESA       -------EVGRIYNGKVIRIVDFGAFVNI--LPGKDGLVHISQISDERVANVSDHLELNQEVTVKVMEVD
PNP_SHEPC       -------EVGRIYNGKVIRIVDFGAFVNI--LPGKDGLVHISQISDERVANVSDHLELNQEVAVKVMEVD
PNP_SHEON       -------EVGRIYNGKVIRIVDFGAFVNI--LPGKDGLVHISQISDERVANVSDHLELNQEVTVKVMEVD
PNP_SHEB2       -------EVGRIYNGKVIRIVDFGAFVNI--LPGKDGLVHISQISDERVANVSDHLELNQEVAVKVMEVD
PNP_RUTMC       ------PKIGKVYTGKVVKIVDFGAFINIKPNQD--GLLHISEIAHERVDKVENHLKEGDEIDVKVLSLD
PNP_RHIME       ------PEVGQVYEGTVVKTADFGAFVNFFGARD--GLVHISQLASERVAKTTDVVKEGDKVWVKLMGFD
PNP_RHILW       ------PEIGQIYEGTVVKTADFGAFVNFFGARD--GLVHISQLASERVAKTQDVVKEGDKVWVKLLGFD
PNP_PHEZH       ------PEVGQIYTGKVVKIVDFGAFVNF--FGAKDGLVHVSQISNERVAKVSDVLTEGQQVKVKLLGFD
PNP_NITMU       -------EVGRVYDGTVLKLLDFGAIVSV--LPGKDGLLHISQIANERVNNVGDHLKEGQVVRVKVLEAD
PNP_HAEIG       ---------GAIYKGKVTRLADFGAFVAI--VGNKEGLVHISQIAEERVEKVSDYLQVGQEVNVKVVEID
PNP_HAEIE       ---------GAIYKGKVTRLADFGAFVAI--VGNKEGLVHISQIAEERVEKVSDYLQVGQEVNVKVVEID
PNP_HAEI8       ---------GAIYKGKVTRLADFGAFVAI--VGNKEGLVHISQIAEERVEKVSDYLQVGQEVNVKVVEID
PNP_DIAST       -------EVGKVYEGPVTKILDFGALINL--LPGKDGLLHISQIAHERVEKVGDYLQEGQVVKVKVLETD
PNP_BART1       ------PEVGAIYQGTVVKTADFGAFINF--FGSRDGLVHISQLASERVTKTTDIVKEGDKVWVKLMGFD
PNP_ACISJ       -------EVGKIYEGPVTKILDFGALINL--LPGKDGLLHISQIAHERVEKVGDYLQEGQIVKVKVLETD
PNP_VIBSL       ---------GRIYQGKVARLADFGAFVTI--LPGKDGLVHISQIADKRVEKVSDYLTEGQEVPVKVLEID
PNP_TOLAT       -------EIGRIYEGKVTRLAEFGAFVNI--LPGKDGLVHISQITDERVKDVSDYLKVGDMVRTKVLEVD
PNP_SHISS       ---------GRVYTGKVTRIVDFGAFVAIGG--GKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVD
PNP_SHIFL       ---------GRVYTGKVTRIVDFGAFVAIGG--GKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVD
PNP_SHIF8       ---------GRVYTGKVTRIVDFGAFVAIGG--GKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVD
PNP_SHIBS       ---------GRVYTGKVTRIVDFGAFVAIGG--GKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVD
PNP_SHIB3       ---------GRVYTGKVTRIVDFGAFVAIGG--GKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVD
PNP_SHEDO       ---------GRVYNGKVIRIVDFGAFINI--LPGKDGLVHISQISDERVANVSDHLEMNQDVKVKVMEVD
PNP_RHOFD       -------EIGKIYEGPITKILDFGALVNL--LPGKDGLLHISQIAHERVEKVTDYLSEGQIVKVKVMETD
PNP_RHOCS       ------PEVGEIYEGKVVKIMDFGAFVNFLGSRD--GLVHISELKNERVAKVTDVVKQGDAVKVKVLGFD
PNP_RHIL3       ------PEIGQVYEGTVVKTADFGAFVNFFGARD--GLVHISQLASERVAKTQDVVKEGDKVWVKLLGFD
PNP_RALSO       -------EVGKIYSGTVLKLLDFGAIVNI--LPGKDGLLHISEIANERVNQVSDYVKEGQMVRVKLLSTD
PNP_RALPJ       -------EVGKIYNGTVLKLLDFGAIVNI--LPGKDGLLHISEIANERVNQVSDYVKEGQAVRVKLLSTD
PNP_PHOLU       -------EVGRIYAGKVTRIVDFGAFVAIGG--GKEGLVHISQIADKRVEKVADYLQVGQETSVKVLEID
PNP_NITHX       ------PEVGQIYEGTVVKVMEFGAFVNF--FGAKDGLVHISQLAANRVQKSSDIVKEGDKVKVKLLGFD
PNP_NITEC       -------EVGKIYEGTVLKLLDFGAIVSI--LPGKDGLLHISQIANERVESVADHLKEGQIIRVKVLEAD
PNP_MYXXD       -------EIGKIYTGTVRKIAEFGAFVELFPGTD--GLIHISELSDKRVKSVSDVLNEGDEVLVKVVSID
PNP_HAEIN       ---------GVIYKGKVTRLADFGAFVAI--VGNKEGLVHISQIAEERVEKVSDYLQVGQEVNVKVVEID
PNP_GEOSL       -------EEGKLYMGTVKKVMDFGAFVEIFPGTD--GLVHISELDTERVKNVTDVLNEGDKVLVKCIGID
PNP_ECOSE       ---------GRVYTGKVTRIVDFGAFVAIGG--GKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVD
PNP_ECOLI       ---------GRVYTGKVTRIVDFGAFVAIGG--GKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVD
PNP_ECOLC       ---------GRVYTGKVTRIVDFGAFVAIGG--GKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVD
PNP_ECOHS       ---------GRVYTGKVTRIVDFGAFVAIGG--GKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVD
PNP_ECODH       ---------GRVYTGKVTRIVDFGAFVAIGG--GKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVD
PNP_ECOBW       ---------GRVYTGKVTRIVDFGAFVAIGG--GKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVD
PNP_ECO8A       ---------GRVYTGKVTRIVDFGAFVAIGG--GKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVD
PNP_ECO7I       ---------GRVYTGKVTRIVDFGAFVAIGG--GKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVD
PNP_ECO5E       ---------GRVYTGKVTRIVDFGAFVAIGG--GKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVD
PNP_ECO57       ---------GRVYTGKVTRIVDFGAFVAIGG--GKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVD
PNP_ECO55       ---------GRVYTGKVTRIVDFGAFVAIGG--GKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVD
PNP_ECO24       ---------GRVYTGKVTRIVDFGAFVAIGG--GKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVD
PNP_BURXL       -------EVGQVYEGTVLKLLDFGAIVNI--LPGKDGLLHISEIANERIKDINDYLKDGQQVKVKVIQTD
PNP_BURTA       -------EVGQVYEGTVLKLLDFGAIVNL--LPGKDGLLHISEIVNERVKDINDYLKEGQQVKVKVIQTD
PNP_BURPP       -------EVGQVYEGTVLKLLDFGAIVNI--LPGKDGLLHISEIANERIKDINDYLKDGQQVKVKVIQTD
PNP_BURCM       -------EVGQVYEGTVLKLLDFGAIVNL--LPGKDGLLHISEIVNERVKDINDYLKEGQQVKVKVIQTD
PNP_BURA4       -------EVGQVYEGTVLKLLDFGAIVNL--LPGKDGLLHISEIVNERVKDINDYLKEGQQVKVKVIQTD
PNP_BUCBP       -------EVGSVYTGKVTRIVDFGAFVSIGI--GKEGLVHISQIAHKRVDKVSDHLRLHQEIFVKVLEVD
PNP_BACLD       -------EVGQLYLGKVKRIEKFGAFVEL--FSGKDGLVHISELALERVGKVEDVVKIGDELLVKVTEID
PNP_YERPY       ---------GRIYAGKVTRIVDFGAFVAIGG--GKEGLVHISQIADKRVEKVTDYLQMGQDVPVKVMEVD
PNP_YERPS       ---------GRIYAGKVTRIVDFGAFVAIGG--GKEGLVHISQIADKRVEKVTDYLQMGQDVPVKVMEVD
PNP_YERPP       ---------GRIYAGKVTRIVDFGAFVAIGG--GKEGLVHISQIADKRVEKVTDYLQMGQDVPVKVMEVD
PNP_YERPN       ---------GRIYAGKVTRIVDFGAFVAIGG--GKEGLVHISQIADKRVEKVTDYLQMGQDVPVKVMEVD
PNP_YERPG       ---------GRIYAGKVTRIVDFGAFVAIGG--GKEGLVHISQIADKRVEKVTDYLQMGQDVPVKVMEVD
PNP_YERPE       ---------GRIYAGKVTRIVDFGAFVAIGG--GKEGLVHISQIADKRVEKVTDYLQMGQDVPVKVMEVD
PNP_YERPB       ---------GRIYAGKVTRIVDFGAFVAIGG--GKEGLVHISQIADKRVEKVTDYLQMGQDVPVKVMEVD
PNP_YERPA       ---------GRIYAGKVTRIVDFGAFVAIGG--GKEGLVHISQIADKRVEKVTDYLQMGQDVPVKVMEVD
PNP_YERP3       ---------GRIYAGKVTRIVDFGAFVAIGG--GKEGLVHISQIADKRVEKVTDYLQMGQDVPVKVMEVD
PNP_VIBVY       -------EVGVIYTGKVARLADFGAFVTI--LPGKDGLVHISQIADKRVEKVSDYLTEGQEVQVKVLEID
PNP_VIBVU       -------EVGVIYTGKVARLADFGAFVTI--LPGKDGLVHISQIADKRVEKVSDYLTEGQEVQVKVLEID
PNP_SHEFN       ---------GRIYNGKVIRIVDFGAFVNI--LPGKDGLVHISQISDERVANVSDHLEMNQEVAVKVMEVD
PNP_RHIEC       ------PEIGQIYEGTVVKTADFGAFVNFFGARD--GLVHISQLASERVAKTTDVVKEGDKVWVKLLGFD
PNP_PSYA2       ---------GKTYEGTVARIVDFGAFVNVLPNTD--GLVHISQIADERVENVSDYLKEGQIVKVLVQDVD
PNP_METPP       -------EIGKVYEGPVTKILDFGALVNI--LPGKDGLLHISQIAHQRVEKVTDFLTEGQIVKVKVLETD
PNP_HAES2       -------------------LADFGAFVAL--VGNKEGLVHISQIAEERVEKVSDYLAIGQEVIVKVLEID
PNP_HAES1       -------------------LADFGAFVAL--VGNKEGLVHISQIAEERVEKVSDYLAIGQEVIVKVLEID
PNP_GEOTN       -------EVGQVYLGKVKRIEKFGAFVEL--FNGKDGLVHISELAEERIGKVEDIVSIGDEILVKVTEID
PNP_GEOSW       -------EVGQIYLGKVKRIEKFGAFVEL--FNGKDGLVHISELAEERVGRVEDVVSIGDEILVKVMEID
PNP_GEOKA       -------EVGQVYLGKVKRIEKFGAFVEL--FNGKDGLVHISELAEGRVGKVEDVVSIGDEILVKVTEID
PNP_CHLCV       ----GEVEVGKIYEGRVTSIVPFGAFVEI--LPGKEGLCHISEFSKQRIENVGDFVKQGDILAVKLLSIN
PNP_BRAHW       ------PEVGEVYDGIVKDIKDFGAFVEI--LPGVEGLCHISELAYKHVMNVEEVLKIGDEVKVKILDV-
PNP_ANADF       -------EIGKTYLGTVRKIAEFGAFVELFPGTD--GLIHISELSDKRVKSVSDVLSEGEEVLVKVISVD
PNP_AGRRK       ------PEVGQIYEGTVVKTADFGAFVNFFGARD--GLVHISQLASERVAKTQDVVKEGDKVWVKLLGFD
RRP5_BOVIN      --------PGMLLIGFVKNIKDYGVFVQFPS--GLSGLAPKAILSDKFVTSTSDHFVEGQTVVAKVTNVD
PNP_ZYMMO       ------PEVGKIYNGKVVNIVDFGAFVNFMGGRD--GLVHVSEIKNERVNKVSDVLSEGQEVKVKVLEID
PNP_SYNAS       -------EVGKIYRGTVKKVVDFGAFVEI--LPGTEGLLHISQLAKERVNKVTDIVNEGDEVIVKVLEVD
PNP_SERP5       ---------GRIYQGKVTRIVDFGAFVAIGG--GKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVD
PNP_SALRD       ------PEEGEDYVGTVKGIRDFGAFVEI--MPEKTGLLHVSEIDYDYVENVEDYLEVGDKVKVHLLEVH
PNP_RHIE6       ------PEIGQIYEGTVVKTADFGAFVNFFGARD--GLVHISQLASERVAKTQDVVKEGDKVWVKLLGFD
PNP_PSYCK       ---------GKTYEGTVARIVDFGAFINVLPNTD--GLVHISQIADERVENVSDYLKEGQIVKVLVQDVD
PNP_POLNA       -------EIGKVYEGAITKILDFGALVNLMPGKD--GLLHISQIAHERVEKVTDYLSEGQIIKVKVLETD
PNP_PHOLL       -------EVARIYTGKVTRIVDFGAFVAIGG--GKEGLVHISQIADKRVEKVADYLQVGQEVSVKVLEID
PNP_PARUW       -------EIGRIYSGKAISIAPFGVFVEI--LPGKEGLCHISEFDVNRINSLDEFVKQGDMLMVKVLDIN
PNP_MESSB       ------PEVGEIYEGTVVKTADFGAFVNF--FGPRDGLVHISQLAPERVQKTTDVVKEGDKVFVKLMGFD
PNP_LARHH       -------EIGKIYEGTVVKILDKNVGAIVQIMPGRDGLVHISQIANERIANVADHLQEGQQVRVKVLETD
PNP_GEOSM       -------EEGKLYMGTVKKIMEFGAFVEIFPGTD--GLVHVSELDTERVKNVSDILKEGDKVLVKCIGID
PNP_GEOBB       -------EEGKLYMGTVKKIMEFGAFVEIFPGTD--GLVHVSELDTERVKNVSDILKEGDKVLVKCIGID
PNP_CLOAB       ---------GEVYLGKVTKITNFGAFVEV--LPGKEGLVHISKLDINKVNKVEDVVSVGDEILVKVTDID
PNP_BURVG       -------EVGQVYEGTVLKLLDFGAIVNL--LPGKDGLLHISEIVNERVKDINDYLKEGQQVKVKVIQTD
PNP_BURS3       -------EVGQVYEGTVLKLLDFGAIVNL--LPGKDGLLHISEIVNERVKDINDYLKEGQQVKVKVIQTD
PNP_BURM1       -------EVGQVYEGTVLKLLDFGAIVNL--LPGKDGLLHISEIVNERVKDINDYLKEGQQVKVKVIQTD
PNP_BURCJ       -------EVGQVYEGTVLKLLDFGAIVNL--LPGKDGLLHISEIVNERVKDINDYLKEGQQVKVKVIQTD
PNP_BURCH       -------EVGQVYEGTVLKLLDFGAIVNL--LPGKDGLLHISEIVNERVKDINDYLKEGQQVKVKVIQTD
PNP_BURCC       -------EVGQVYEGTVLKLLDFGAIVNL--LPGKDGLLHISEIVNERVKDINDYLKEGQQVKVKVIQTD
PNP_BURCA       -------EVGQVYEGTVLKLLDFGAIVNL--LPGKDGLLHISEIVNERVKDINDYLKEGQQVKVKVIQTD
RS1H_BACC1      ---------GDVVEGTVQRLTDFGAFVNVGGVD---GLVHISQISHERVEQPSEVLEQGQKVKVKVLSVD
PNP_VIBPA       ---------GRIYTGKVARLADFGAFVTV--LPGKDGLVHISQIAEKRVEKVSDYLTEGQEVQVKVLEID
PNP_THICR       ------PEIGKVYDAKVVKIVDFGAFVSY--MPGREGLVHVSQIADERVEDVNEYLKEGQEIKVRLTDVD
PNP_SHIDS       ---------GRVYTGKVTRIVDFGAFVAIGG--GKEGLVHISQIADKRVEKVTDYLLMGQEVPVKVLEVD
PNP_SALTY       ---------GRIYNGKVTRIVDFGAFVAIGG--GKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVD
PNP_SALPK       ---------GRIYNGKVTRIVDFGAFVAIGG--GKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVD
PNP_SALPC       ---------GRIYNGKVTRIVDFGAFVAIGG--GKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVD
PNP_SALPB       ---------GRIYNGKVTRIVDFGAFVAIGG--GKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVD
PNP_SALPA       ---------GRIYNGKVTRIVDFGAFVAIGG--GKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVD
PNP_SALG2       ---------GRIYNGKVTRIVDFGAFVAIGG--GKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVD
PNP_SALEP       ---------GRIYNGKVTRIVDFGAFVAIGG--GKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVD
PNP_SALCH       ---------GRIYNGKVTRIVDFGAFVAIGG--GKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVD
PNP_SALAR       ---------GRIYNGKVTRIVDFGAFVAIGG--GKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVD
PNP_PELCD       ---------GKLYMATVKKIMEFGAFVEI--FPGTEGLVHISELAKERVKKVTDILQEGDQVLVKCLDID
PNP_PECCP       ---------GRVYQGKVTRIVDFGAFVAIGG--GKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVD
PNP_KLEP7       ---------GRIYNGKVTRIVDFGAFVAIGG--GKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVD
PNP_ESCF3       ---------GRVYNGKVTRIVDFGAFVAIGG--GKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVD
PNP_ERWT9       ---------GRIYNGKVTRIVDFGAFVAIGG--GKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVD
PNP_ENTS8       ---------GRIYNGKVTRIVDFGAFVAIGG--GKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVD
PNP_ENT38       ---------GRIYNGKVTRIVDFGAFVAIGG--GKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVD
PNP_ECOUT       ---------GRVYNGKVTRIVDFGAFVAIGG--GKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVD
PNP_ECOSM       ---------GRVYNGKVTRIVDFGAFVAIGG--GKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVD
PNP_ECOLU       ---------GRVYNGKVTRIVDFGAFVAIGG--GKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVD
PNP_ECOL6       ---------GRVYNGKVTRIVDFGAFVAIGG--GKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVD
PNP_ECOL5       ---------GRVYNGKVTRIVDFGAFVAIGG--GKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVD
PNP_ECOK1       ---------GRVYNGKVTRIVDFGAFVAIGG--GKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVD
PNP_ECO81       ---------GRVYNGKVTRIVDFGAFVAIGG--GKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVD
PNP_ECO45       ---------GRVYNGKVTRIVDFGAFVAIGG--GKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVD
PNP_DECAR       -------EIGKIYEGTVLKILDFGAIVSV--LPGKDGLLHISQIAQERVNKVEDYVKEGQIVRVKVLETD
PNP_CITK8       ---------GRIYNGKVTRIVDFGAFVAIGG--GKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVD
PNP_CHLFF       ----GEVEVGKIYEGRVTSIVPFGAFVEI--LPGKEGLCHISEFSKQRIENVGDFVKQGDILPVKLLSIN
PNP_BACSU       -------EVGQLYLGKVKRIEKFGAFVEI--FSGKDGLVHISELALERVGKVEDVVKIGDEILVKVTEID
PNP_BACC0       ---------GEIYEGKVKRVEKFGAFVEL--FSDKDGLVHISELALERVGKVEDVVKIGDVITVKVIEID
PNP_ACIAC       -------EIGKIYEGPVVKILDFGALINL--LPGKDGLLHISQIAHERVEKVTDYLTEGQVVKVKVLETD
YHGF_ECOLI      -------QPGMILEGAVTNVTNFGAFVDIGVHQD--GLVHISSLSNKFVEDPHTVVKAGDIVKVKVLEVD
PNP_VEREI       -------EIGKIYEGPVTKLLDFGALINL--LPGKDGLLHISQIAHERVERVSDYLSEGQIVRVKVMEAD
PNP_THETH       ---------GEIYEGTVTRITPFGAFISL--FPGTEGLLHISQIAPGRVERVEDHLKVGDVIKVKVHRID
PNP_THET2       ---------GEIYEGTVTRITPFGAFISL--FPGTEGLLHISQIAPGRVERVEDHLKVGDVIKVKVHRID
PNP_SORC5       ------PEVGATYKGTVKRITDFGAFVEILPNTD--GLLHISEMAHTRVERVEDVVKEGDSLDVKVLSVD
PNP_SILST       ------PEEGAVYTGKVVKIVDFGAFVNF--FGKRDGLVHVSQIENRRLNHPSDVLKEGQEVKVKLLGFD
PNP_SHELP       -------EVGTVYNGKVVRIVDFGAFVTI--LPGKDGLVHISQIAEERVANVSDYLEVGQEVKVKVMEVD
PNP_RALME       -------EVGKIYAGTVLKLLDFGAIVNI--LPGKDGLLHISEIVNERVKDIKDWLKEGQQVRVKLIQAD
PNP_RALEH       -------EVGKIYAGTVLKLLDFGAIVNI--LPGKDGLLHISEIVNERVKDIKDWLKEGQQVRVKLIQAD
PNP_PSYWF       -------EVGKVYKGTVARVVDFGAFVTVLPGTD--GLVHISQIADERVESVSDYLSEGQQINVLVQDVD
PNP_PERMH       -------ELGEVYMGKVTRVEDYGAFVEL--MPGKLSLLHVSQISPERIRSAKEKIKVGDILTVKVIDID
PNP_LEPCP       -------EIGKVYEGPVVKILDFGALINI--LPGKDGLLHISQIAHQRVEKVTDFLTEGQVVKVKVLETD
PNP_GEOMG       -------EEGKLYMGTVRKVMDFGAFVEIFPGTD--GLVHISELDTERVKDVTDILKEGDKVLVKCIGID
PNP_CUPTR       -------EVGKIYAGTVLKLLDFGAIVNI--LPGKDGLLHISEIVNERVKDIKDWLKEGQQVRVKLIQAD
PNP_COLP3       -------EVGTLYTGKVVRIVDFGAFVNV--LPGKDGLVHISQISEERVNNVSEVLTEGQEVKVKVLEVD
PNP_CLOBB       ---------GEIYLGKVTKITTFGAFVEI--LPNKEGLVHISKLDKERVNKVEDVVSVGDEILVKVTEID
PNP_CLOBA       ---------GEIYLGKVTKITTFGAFVEI--LPNKEGLVHISKLDKERVNKVEDVVSVGDEILVKVTEID
PNP_BURPS       -------EVGHVYEGTVLKLLDFGAIVNL--LPGKDGLLHISEIVNERVKDINDYLKEGQQVKVKVIQTD
PNP_BURP6       -------EVGHVYEGTVLKLLDFGAIVNL--LPGKDGLLHISEIVNERVKDINDYLKEGQQVKVKVIQTD
PNP_BURP1       -------EVGHVYEGTVLKLLDFGAIVNL--LPGKDGLLHISEIVNERVKDINDYLKEGQQVKVKVIQTD
PNP_BURP0       -------EVGHVYEGTVLKLLDFGAIVNL--LPGKDGLLHISEIVNERVKDINDYLKEGQQVKVKVIQTD
PNP_BURMS       -------EVGHVYEGTVLKLLDFGAIVNL--LPGKDGLLHISEIVNERVKDINDYLKEGQQVKVKVIQTD
PNP_BURMA       -------EVGHVYEGTVLKLLDFGAIVNL--LPGKDGLLHISEIVNERVKDINDYLKEGQQVKVKVIQTD
PNP_BURM9       -------EVGHVYEGTVLKLLDFGAIVNL--LPGKDGLLHISEIVNERVKDINDYLKEGQQVKVKVIQTD
PNP_BURM7       -------EVGHVYEGTVLKLLDFGAIVNL--LPGKDGLLHISEIVNERVKDINDYLKEGQQVKVKVIQTD
PNP_BUCAP       ---------GRIYSGKVTRIVDFGAFISIGI--GKEGLVHISQISNKRVEKVSDHLTVDQIISVKVLEID
PNP_AGRVS       ------PEIGVVYEGTVVKTADFGAFVNF--FGSRDGLVHISQLAVDRVAKTQDVVKEGDKVWVKLMGFD
RS1_MYCTU       ---------GQIVPGKVTKLVPFGAFVRVEEGIE--GLVHISELAERHVEVPDQVVAVGDDAMVKVIDID
RS1_MYCLE       ---------GQIVPGKVTKLVPFGAFVRVEEGIE--GLVHISELAERHVEVPDQVVAVGDDAMVKVIDID
RS1_BUCBP       MEFSKKYNKGSHVVGKIKSITDFGIFIGLEGSID--GLVHLSDIS--WNISGEESVKKGEEVLAVVLQVD
RRP5_SCHPO      ---------GSNLDGTVVKVGDYGVLIRIDGTDNIVGLCHKSEIADAVVLNISKLYSSGDKVRAHVLDVD
PNP_RHOSK       ------PEEGQIYTGKVVKLVDFGAFVNF--FGKRDGLVHVSQIANKRLTHPNEVLKEGQEVKVKLLGFD
PNP_RHISN       ------PEVGQIYEGTVVKTADFGAFVNFFGARD--GLVHISQLASERVAKTTDVVKEGDKVWVKLMGFD
PNP_PROMH       -------EVGRIYNGKVTRIVDFGAFVAIGG--GKEGLVHISQIADKRVEKVSDYLTMGQEVPVKVLEID
PNP_MARMM       ------PEEGQIYKGKVVKVMDFGAFVNF--FGPKDGLVHVSQLKAERVNHPSDVVKEGQEVYVKLLGFD
PNP_HAEDU       --------------GKVSRVVDFGAFVTI--LGGKEGLVHISQITDARVERVSDYLSVGQEVNVKVVEID
PNP_GEOUR       -------EEGKLYMGLVKKVMEFGAFVEIFPGTD--GLVHISELDTERVKNVTDILKEGDKVLVKCIGID
PNP_GEOSF       -------EEGKLYMGLVKKVMEFGAFVEIFPGTD--GLVHISELDTERVKNVTDVLKEGDKVLVKCIGID
PNP_ANOFW       -------EVGQVYLGKVKRIEKFGAFVEL--FSGKDGLVHISELAEERVGKVEDVVSIGDEILVKVTEID
PNP_AGRT5       ------PEVGQIYEGTVVKTADFGAFVNFFGARD--GLVHISQLASERVAKTSDVVKEGDKVWVKLMGFD
PNP_AERHH       --------------GKVVRLADFGAFVNI--LPGKDGLVHISQITDARVQNVADYLKIGDVVKVKVLEVD
RS1_NEIMB       -------QEGSVIKGIVKNITDYGAFVDLGGID---GLLHITDLAWRRVKHPSEVLEVGQEVEAKVLKFD
PNP_THET8       ---------GEIYEGTVTRITPFGAFISL--FPGTEGLLHISQIAPGRVARVEDHLKVGDVIKVKVHRID
PNP_SINMW       ------PEVGQVYEGTVVKTADFGAFVNFFGARD--GLVHISQLASERVAKTTDVVKEGDKVWVKLMGFD
PNP_SHEB9       -------EVGRIYNGKVIRIVDFGAFVNI--LPGKDGLVHISQISDERVANVSDHLELNQEVAVKVMEVD
PNP_SHEB8       -------EVGRIYNGKVIRIVDFGAFVNI--LPGKDGLVHISQISDERVANVSDHLELNQEVAVKVMEVD
PNP_SHEB5       -------EVGRIYNGKVIRIVDFGAFVNI--LPGKDGLVHISQISDERVANVSDHLELNQEVAVKVMEVD
PNP_OPITP       -------EVGKIYTGRVTGVKEFGCFVECTPGNE--GLCHVSELADFRVRRTEDVVKMGDSITVKCIGID
PNP_OCEIH       -------EVGQIYLGKVKRIEKFGAFVEL--FKGKDGLVHISELAEERTNKVEDVVSIDDQIMVKVKEID
PNP_NOVAD       -------EVGKIYKGKVVNIVDFGAFVNFMGGKD--GLVHVSEMKNERVEKPTDVVKEGQDVYVKVLEID
PNP_HYPNA       -------EVGEIYEGKVVSMKDFGIFVNF--FGPKDGLVHVSQMANKRIGHPKEMVKEGDKVWVKLMGFD
PNP_GLUOX       ------PEIGRIYEGKVVKTADFGAFVNFLGPRD--GLVHISELAEGRVAKTSDVVKQGDAVKVKVIGFD
PNP_ENTFA       -------EVGQVYLAKVVRIEKFGAFVNLIKGKD--GLIHISQLANERVNNVEDVVKLGDEVLVKVTEID
PNP_CLOB8       ---------GEVYLGKVTKITTFGAFVEI--LPSKEGLVHISKLAKERVNKVEDVVSIGDEILVKVTEID
PNP_BDEBA       -------EVGKTYKGRIVKIAEFGAFVEI--LPNTQGLLHISEISNERVRAVSDVLKEGEIIDVKVLEVD
PNP_BACHD       ---------GQMYLGTVKRIEKFGAFVEL--FKGKDGLVHISQLAEERVNKVEDVVKIGDEILVKVMEID
RRP5_HUMAN      --------PGMLLIGFVKSIKDYGVFIQFPS--GLSGLAPKAIMSDKFVTSTSDHFVEGQTVAAKVTNVD
PNP_SODGM       ---------GRIYNGKVTRIVDFGAFFAIGG--GKEGLVHISQIADKRVEKVADYLELGQEVPVKVLEVD
PNP_POLSQ       -------EVGKIYEGPVVKLLEFGALVNI--LPGKDGLLHISEISNERVKEVKDYLAEGQVVRVKLLAAD
PNP_POLNS       -------EVGKIYEGPVVKLLEFGALVNI--LPGKDGLLHISEISNERVKEVKDYLAEGQVVRVKLLAAD
PNP_PARDP       ------PEEGKIYVGKVVKLVDFGAFVNF--FGKRDGLVHVSQIAGKRLNHPNEVLKEGQEVKVKLLGFD
PNP_HELMI       -------EVGKVYTGKVTRIMNFGAFVEV--LPGKEGLIHISQLAEERVAKVEDVVKIGDEVTVKVVEID
PNP_GEOLS       -------EEGKLYMGTVKKIMEFGAFVEVLPGTD--GLVHISELDETRVKNVTDILNEGDKVLVKCIGVD
PNP_FINM2       ------PEIGEKYLGRVTKIMNFGAFVEI--LPGKEGLLHISNIAHERTNKVEDVLKENDEIMVKLMDID
PNP_BACP2       -------EVGQLYLGKVKRIEKFGAFLEI--FSGKDGLVHISELALDRVGKVEDVVKIGDELLVKVTEID
PNP_BACA2       -------EVGQLYLGKVKRIEKFGAFVEI--FSGKDGLVHISELALERVGKVEDVVKIGDEILVKVTEID
PNP_THEPX       ---------GEIYLGKVLRITPFGAFVEIAP--GKEGLVHISKLSKKRVQKVEDVVKVGDDILVKVTDID
PNP_THEP3       ---------GEIYLGKVLRITPFGAFVEIAP--GKEGLVHISKLSKKRVQKVEDVVKVGDDILVKVTDID
PNP_SULAA       -------EVGEVYMGKVTRVEDYGAFVEL--LPGRLSLLHVSQITGERLKSAKEKIKVGDVLKVKVSEID
PNP_RHOS5       ------PEEGQIYTGKVVKLVDFGAFVNF--FGKRDGLVHVSQIANKRLTHPNEVLKEGQEVKVKLLGFD
PNP_RHOS4       ------PEEGQIYTGKVVKLVDFGAFVNF--FGKRDGLVHVSQIANKRLTHPNEVLKEGQEVKVKLLGFD
PNP_RHOS1       ------PEEGQIYTGKVVKLVDFGAFVNF--FGKRDGLVHVSQIANKRLTHPNEVLKEGQEVKVKLLGFD
PNP_PELTS       -------QTGEIYTGRVTRITDFGCFVEIIPMQGKEGLVHISQLAHHRVNRVEDVVKEGDVILVKVTGYD
PNP_DINSH       ------PEEGKVYTGTVVKIVDFGAFVNF--FGKRDGLVHVSQIENRRLNHPSDVLKEGQEVKVKLLGFD
IF2A_SCHPO      -----FPEVDELVVVNVRQIQEMGAYVKLLEYDNIEGMVXXXXXXXXXXXXVQKHIXXXXXXXXXXXXXD
DHX8_MOUSE      ------PAIGDIYNGKVTSIMQFGCFVQLEGLRKREGLVHISELREGRVANVADVVSKGQRVKVKVLSF-
DHX8_HUMAN      ------PTIGDIYNGKVTSIMQFGCFVQLEGLRKREGLVHISELREGRVANVADVVSKGQRVKVKVLSF-
PNP_THIDA       -------EVGKVYEGPVIKLLDFGAIVNVLPGRD--GLLHISQIAHERVNTIGDYLKEGQVVRVKILEAD
PNP_SALTI       ---------GRIYNSKVTRIVDFGAFVAIGG--GKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVD
PNP_LISMO       -------EVGEVYTGKVRRIEKFGAFVELFKGTD--GLVHISELAHERVGKVEDILKLGDEVTVKVIEVD
PNP_LISMH       -------EVGEVYTGKVRRIEKFGAFVELFKGTD--GLVHISELAHERVGKVEDILKLGDEVTVKVIEVD
PNP_LISMF       -------EVGEVYTGKVRRIEKFGAFVELFKGTD--GLVHISELAHERVGKVEDILKLGDEVTVKVIEVD
PNP_LISMC       -------EVGEVYTGKVRRIEKFGAFVELFKGTD--GLVHISELAHERVGKVEDILKLGDEVTVKVIEVD
PNP_HAEPS       --------------GKVTRVVDFGAFVSI--LGGKEGLVHISQITDARVERVADYLSVGQDVQVKVVEI-
PNP_BUCCC       ---------GKIYSGKVTRILDFGAFVSIGF--GKEGLIHISQISNKRIDKVINHLKINQIIFVKVLEVD
RS1_STAAW       ---------GDVIDGKVARLTQFGAFIDIGGVD---GLVHVSELSHEHVQTPEEVVSIGQDVKVKIKSID
RS1_STAAS       ---------GDVIDGKVARLTQFGAFIDIGGVD---GLVHVSELSHEHVQTPEEVVSIGQDVKVKIKSID
RS1_STAAR       ---------GDVIDGKVARLTQFGAFIDIGGVD---GLVHVSELSHEHVQTPEEVVSIGQDVKVKIKSID
RS1_STAAN       ---------GDVIHGKVARLTQFGAFIDIGGVD---GLVHVSELSHEHVQTPEEVVSIGQDVKVKIKSID
RS1_STAAM       ---------GDVIHGKVARLTQFGAFIDIGGVD---GLVHVSELSHEHVQTPEEVVSIGQDVKVKIKSID
RS1_STAAC       ---------GDVIDGKVARLTQFGAFIDIGGVD---GLVHVSELSHEHVQTPEEVVSIGQDVKVKIKSID
RS1_PSEAE       -------QEGQQVKGIVKNLTDYGAFVDLGGVD---GLLHITDMAWKRIKHPSEIVNVGDEIDVKVLKFD
PNP_RALEJ       -------EVGKIYNGTVLKLLDFGAIVNI--LPGKDGLLHISEIVNERVKDIKDWLKEGQQLRVKLIQAD
PNP_BUCAT       -------EVGRIYSGKVTRIVDFGAFVSIGL--GKEGLVHISQISDKRVDKVSNHLKIDQIISVKVLEID
PNP_BUCAI       -------EVGRIYSGKVTRIVDFGAFVSIGL--GKEGLVHISQISDKRVDKVSNHLKIDQIISVKVLEID
PNP_BUCA5       -------EVGRIYSGKVTRIVDFGAFVSIGL--GKEGLVHISQISDKRVDKVSNHLKIDQIISVKVLEID
PNP_BACWK       ---------GEIYLGKVKRVEKFGAFVEL--FSGKDGLVHISELALERVGKVEDVVKIGDEISVKVIEID
PNP_BACHK       ---------GEIYEGKVKRVEKFGAFVEL--FSGKDGLVHISELALERVGKVEDVVKIGDVITVKVIEID
PNP_BACCZ       ---------GEIYEGKVKRVEKFGAFVEL--FSGKDGLVHISELALERVGKVEDVVKIGDVITVKVIEID
PNP_BACCQ       ---------GEIYEGKVKRVEKFGAFVEL--FSGKDGLVHISELALERVGKVEDVVKIGDVITVKVIEID
PNP_BACC7       ---------GEIYEGKVKRVEKFGAFVEL--FSGKDGLVHISELALERVGKVEDVVKIGDVITVKVIEID
PNP_BACC4       ---------GEIYEGKVKRVEKFGAFVEL--FSGKDGLVHISELALERVGKVEDVVKIGDVITVKVIEID
PNP_BACC3       ---------GEIYEGKVKRVEKFGAFVEL--FSGKDGLVHISELALERVGKVEDVVKIGDVITVKVIEID
PNP_BACC2       ---------GEIYEGKVKRVEKFGAFVEL--FSGKDGLVHISELALERVGKVEDVVKIGDVITVKVIEID
PNP_BACC1       ---------GEIYEGKVKRVEKFGAFVEL--FSGKDGLVHISELALERVGKVEDVVKIGDVITVKVIEID
PNP_BACAN       ---------GEIYEGKVKRVEKFGAFVEL--FSGKDGLVHISELALERVGKVEDVVKIGDVITVKVIEID
PNP_BACAH       ---------GEIYEGKVKRVEKFGAFVEL--FSGKDGLVHISELALERVGKVEDVVKIGDVITVKVIEID
PNP_BACAC       ---------GEIYEGKVKRVEKFGAFVEL--FSGKDGLVHISELALERVGKVEDVVKIGDVITVKVIEID
PNP_BACAA       ---------GEIYEGKVKRVEKFGAFVEL--FSGKDGLVHISELALERVGKVEDVVKIGDVITVKVIEID
RS1_STAHJ       ----------DVIEGKVVRLANFGAFVEIAP--GVQGLVHISEIAHEHIGTPGEKLEPGQQVNVKILGID
RS1_RICCN       ---------GKQMTGKVTNFADYGVFIELKD--GLEGLVHSSEIS--WLKNPRKTLTIGQEVEFVVLEVD
PNP_SPHAL       -------EVGKIYDGKVVNLVDFGAFVNFMGGKD--GLVHVSEIRNERVEKVADVLSEGQDVKVKVLEID
PNP_SHESH       ---------GTIYNGKVVRIVDFGAFVTI--LPGKDGLVHISQIAEERVANVSDYLQVGQEVKVKVMEVD
PNP_ROSDO       ------PEEGMVYTGTVVKIVDFGAFVNF--FGKRDGLVHVSQIENRRLNHPSDVLKEGQEVKVKLLGFD
PNP_PELPD       -------EEGKLYMGIVKKIMDFGAFVEILPGTD--GLVHISELDTKRVKTVTEVLNEGDRVLVKCIGVD
PNP_LISW6       -------EVGEVYTGKVRRIEKFGAFVELFKGTD--GLVHISELAHERVGKVEDILKLGDEVTVKVIEVD
PNP_LISIN       -------EVGEVYTGKVRRIEKFGAFVELFKGTD--GLVHISELAHERVGKVEDILKLGDEVTVKVIEVD
PNP_JANMA       -------EVGKIYEGTVLKLLDFGAIVQVMPGKD--GLLHISQIANERVNAVADYLQEGQQVRVKVLETD
PNP_HERAR       -------EVGKVYEGTVLKLLDFGAIVQVMPGKD--GLLHISQIANERVNAVADYLKEGQQVRVKVLETD
PNP_ERYLH       -------EVGKIYNGKVVNIVDFGAFVNFMGGKD--GLVHVSEMKNERVEKPTDVVSEGQEVKVKVLEID
PNP_BORA1       -------EVGQVYDGSVLRLLDFGAIVQVLPGRD--GLLHISEIANYRIANINDVLKVGQQVRVKVIEAD
PNP_BARBK       ------PEVGTIYQGTVVKTTEFGAFINFFGSHD--GLVHISQLASKRVAKTTDVVKEGDKVWVQLMGFD
PNP_BACCN       ---------GEIYLGKVKRIEKFGAFVEL--FSGKDGLVHISELALERVGKVEDVVKIGDEISVKVIEID
ISPH_FUSNN      ---------GQIVDCVVTEVLDFGLAVDINTL---KGFIHISEVSWKRLDKLSDNYKVGDKIKAVVVSLD
Y568_HAEIN      ---------GMILEGTVTNVTNFGAFVDIGVHQD--GLVHISSLSDKFVEDPHQVVKTGNIVKVKVLEVD
RS1_RICFE       ---------GKKMTGKVTNFADYGVFIELRD--GLEGLVHSSEIS--WLKNPRKTLTIGQEVEFVVLEVD
RS1_CHLPN       ---------GTVISGVVTKITAFGAFVELQNGIE--GLIHVSELSDKPFAKIEDIISIGENVSAKVIKLD
RRP5_MOUSE      -------QPGMLLIGFVKCIKEYGVFVQFPS--GLSGLSPKTIMSDKFVTTPSEHFVEGQTVVAKVTNVD
PNP_YEREN       -----------IYAGKVTRIVDFGAFVAIGG--GKEGLVHISQIADKRVDKVTDYLQMGQEVPVKVIEVD
PNP_YERE8       -----------IYAGKVTRIVDFGAFVAIGG--GKEGLVHISQIADKRVDKVTDYLQMGQEVPVKVIEVD
PNP_SHEWM       ---------GTVYNGKVVRIVDFGAFVTI--LPGKDGLVHISQIAEERVANVSDYLQVGQEVKVKVMEVD
PNP_RUBXD       -------EAGDIYVGKVVKTTNFGAFVELTPGRD--GLLHISRLAPGRVRRVEDVLNEGDVVKVRVLEID
PNP_CHLPN       --------------GRVTSVVAFGAFVEV--LPGKEGLCHISECSRQRIENISDVVKEGDIIDVKLLSIN
PNP_CHLPB       ------PEVGTIYMGKVKDIRDLGAFVEILPRTD--GLVHISEIARERVNKVSDHLKQGDRVKVKLIDID
PNP_BORPE       -------EVGQIYDGSVLRLLDFGAIVQVLPGRD--GLLHISEIANYRIANINDVLKVGQPVRVKVIEAD
PNP_BORPA       -------EVGQIYDGSVLRLLDFGAIVQVLPGRD--GLLHISEIANYRIANINDVLKVGQPVRVKVIEAD
PNP_BORBR       -------EVGQIYDGSVLRLLDFGAIVQVLPGRD--GLLHISEIANYRIANINDVLKVGQPVRVKVIEAD
RS1_RICBR       ---------GKKMTGKVTNFADYGVFIELKD--GLEGLVHSSEIS--WLKNPRKTLTIGQEVEFMVLEVD
PNP_THEYD       -------ELGRIYMGKVTRIVDFGAFVEI--MPGVEGLLHISQIADKRIQKVSEVLKTGEQIPVKVIEID
PNP_SYNFM       ------PEVGQLYMSRIVRVTDFGAFAEI--LPNIEGLIHISQLEHRRVRKVTDVVQEGDEVLVKVIEID
PNP_SHEPW       ---------GTVYNGKVVRIVDFGAFVTI--LPGKDGLVHISQIAEERVANVSDYLEVGQEVKVKVMEVD
PNP_SHEPA       ---------GTVYNGKVVRIVDFGAFVTI--LPGKDGLVHISQIAEERVANVSDYLEVGQEVKVKVMEVD
PNP_SHEHH       ---------GTVYNGKVVRIVDFGAFVTI--LPGKDGLVHISQIAEERVANVSDYLEVGQEVKVKVMEVD
PNP_DEHSC       -------EAGSIYTGKVTRIMTFGAFVEI--LPGKEGMVHISELADHRVEKVEDIVKVGDDITVKVIEID
PNP_DEHSB       -------EAGSIYTGKVTRIMTFGAFVEI--LPGKEGMVHISELADHRVEKVEDIVKVGDDITVKVIEID
PNP_CLOTE       -------EAGEIYLGKVTRTTNFGAFVEI--LPGKEGLVHISKLDFTRVNKVEDVVSVGDEILVKVTDID
PNP_BACV8       ------PEVGEVYVGKVRSVMPYGVFVEF--LPGKDGLLHISEIDWKRLETIEEGLKEGDEIEVKLLDID
PNP4_ALKMQ      ------PEVGQNYTGKVIKIMNFGAFLEI--LPGKEGLLHVSNIAHERVNKVEDVLEVGQEIEVKVMEID
RS1_RICTY       ---------GKKMTGKVTNFADYGVFLELKD--GLEGLVHSSEIS--WLKNPRKMLTIGQEVEFIVLEVD
RS1_RICPR       ---------GKKMTGKVTNFADYGVFLELKD--GLEGLVHSSEIS--WLKNPRKMLTIGQEVEFIVLEVD
RS1_RHOPA       -------EEGQVIDGVVKNITDYGAFVDLGGID---GLLHVTDIAWRRVNHPTEVLTIGQTVKVKIIKIN
RS1_COXBU       -------QEGQEIKGVIKNITDYGAFVDLGGVD---GLLHITDMAWGRVKHPSDLLNVGDEVHVKVLKFD
PNP_SYNWW       -------EVGKTYMGTVKRIMDFGAFVEIIPTSGKEGLVHISQLAEERVNKVRDVVDIGDQILVKVTEID
PNP_NATTJ       ------PEVGEVYLGKVVRTEKYGAFVEI--LPGKEGLVHISELAEDRVGKTEDVAKVGDEILVKIINID
PNP_IDILO       -------EVGKIYQGKVARIVDFGAFVTV--LPGKDGLVHISQIAEERVNDVNEYLKVGDVVPVKVLEID
PNP_DESAP       ---------GEVYLGRVVKIMDFGCFVEVIPLPGKDGLVHISHLAHNRVRKVEDVVREGDQILVKAIGFD
PNP_CLOD6       ------PEVGKTYKGKVSRIMNFGAFVEI--LPGKEGLLHISHIAHERVAKVEDVLNIGDEVEVKVTEID
PNP_CHLCH       ------PEVGNIYVGKVRDVRDLGAFVEFLPKTD--GLVHISEISSTRVAKVSDHLKVGDKVTVKLVDVR
PNP_BARQU       ------PEVGGIYQGTVVKTAEFGAFVNF--FGSRDGLVHISQLTTERVTKTTNVVKEGDKVWVKLMGFD
PNP_BARHE       ------PEVGVIYQGTVVKTAEFGAFVNF--FGSRDGLVHISQLTTERVTKTTDVVKEGDKVWVKLMGFD
RS1_STAEQ       ----------DVIEGTVVRLANFGAFVEIAP--SVQGLVHISEIDHKHIGSPNEVLEPGQQVNVKILGID
RRP5_YEAST      ---------GDVFEGTIKSVTDFGVFVKLDNTVNVTGLAHITEIADKKPEDLSALFGVGDRVKAIVLKTN
PNP_PORGI       ------PEVGETYPGKITSVMPYGCFVEF--LPGKEGLLHISEVDWKRFETIEDNLKEGESINVKLLDID
PNP_PORG3       ------PEVGETYPGKITSVMPYGCFVEF--LPGKEGLLHISEVDWKRFETIEDNLKEGESINVKLLDID
PNP_ORITI       ------PQIGDIFDGEVVKVIESGAFIKYVTGRD--GFVHISEINDTHIKDINAHVKLGDKVKVKIIGID
PNP_ORITB       ------PQIGDIFDGEVVKVIESGAFIKYVTGRD--GFVHISEINDTHIKDINAHVKLGDKVKVKIIGID
PNP_NEOSM       ---------GELYDGKIVSVVDFGLFVVLPNKQE--GLVHISEISKNRVNDIRADYTEGQAVTVRIKDIG
PNP_NEIMF       -------EVGKVYEGTVVKILDNNVGAIVSVMPGKDGLVHISQIAHERVRNVGDYLQVGQVVNVKALEVD
PNP_NEIMB       -------EVGKVYEGTVVKILDNNVGAIVSVMPGKDGLVHISQIAHERVRNVGDYLQVGQVVNVKALEVD
PNP_NEIMA       -------EVGKVYEGTVVKILDNNVGAIVSVMPGKDGLVHISQIAHERVRNVGDYLQVGQVVNVKALEVD
PNP_NEIM0       -------EVGKVYEGTVVKILDNNVGAIVSVMPGKDGLVHISQIAHERVRNVGDYLQVGQVVNVKALEVD
PNP_NEIG2       -------EVGKVYEGTVVKILDNNVGAIVSVMPGKDGLVHISQIAHERVRNVGDYLQVGQVVNVKALEVD
PNP_NEIG1       -------EVGKVYEGTVVKILDNNVGAIVSVMPGKDGLVHISQIAHERVRNVGDYLQVGQVVNVKALEVD
PNP_CHLSY       ---------GDIFLGKVVSIKPFGAFVNI--LPGKDGMVHVSELDEKRVENVEDVVSLGDEINVMVIDID
PNP_CHLAD       ---------GDIFLGKVVSIKPFGAFVNI--LPGKDGMVHVSELDEKRVENVEDVVSLGDEINVMVIDID
PNP_CHLAA       ---------GDIFLGKVVSIKPFGAFVNI--LPGKDGMVHVSELDEKRVENVEDVVSLGDEINVMVIDID
PNP_CAUCR       -------EVGKIYDGKVVKVVDFGAFVNF--FGAKDGLVHVSQISNERVAKPSDVLKEGQMVKVKLLGFD
PNP_CAUCN       -------EVGKIYDGKVVKVVDFGAFVNF--FGAKDGLVHVSQISNERVAKPSDVLKEGQMVKVKLLGFD
PNP_BORPD       -------EVGQVYDGSVLRLLDFGAIVQVLPGRD--GLLHISEIANYRIANINDVLKVGQQVRVKVIEAD
PNP_AZOPC       ------PEVGEIYEGKIRSIMPYGAFIEF--LPGKEGLLHISEISWKHLESIEEALNEGDFIKIKLVDID
TEX_BORPE       --------PGMVLEGVVTNVANFGAFVDIGVHQD--GLVHISALAEKFVKDPRDXXXXXXXXXXXXLEVD
PNP_LEPBP       -------EVGKIYDGVIKRIADFGAFVEI--LPGKEGLCHISKLDVKRVQSVRDIVSEG-XXXXXXXXXX
PNP_LEPBA       -------EVGKIYDGVIKRIADFGAFVEI--LPGKEGLCHISKLDVKRVQSVRDIVSEG-XXXXXXXXXX
PNP_CYAP7       ---------GEVYVGRVTRIIQIGAFVEI--MPGKEGMIHISQLAEGRVGKVEDELAVGDEVVVKVREID
PNP_BACCR       ---------GEIYEAKVKRVEKFGAFVEL--FSGKDGLVHISELALERVGKVEDVVKIGDVITVKVIEID
PNP_PROVI       ------PEVGTVYIGKVRDIRDLGAFVEFIPKTD--GLVHISEIANERVAKVSDHLKVGERVKVKLVDI-
PNP_DESHY       -------EVGRIYNGRVTRIMDFGAFVEVIPLSGKEGLVHISQLAHGRVEKVEDVVKLGDDILVKATGID
PNP_DESHD       -------EVGRIYNGRVTRIMDFGAFVEVIPLSGKEGLVHISQLAHGRVEKVEDVVKLGDEILVKATGID
PNP_CHLPD       ------PEIGNTYLGKVRDIRDLGAFVEFLPKTD--GLVHISEISKERVTKVSDHLKVGDRVKVKLVDIR
PNP_CAUSK       -------EVGAIYDGKVVKVVDFGAFVNF--FGAKDGLVHVSQISNERVAKPSDVLKEGQIVKVKLLGFD
PNP_ANAPZ       ------PEVGKIYSGEVCELAKYGAFVTF--LGARKGLVHISEIRNEHINAVADVLAVGDKV--KVLVID
PNP_TRIEI       --------PGDVYVGRVTRIIPIGAFVEV--FAGKEGMVHISQIADYRVGKVEDELAIGDEVIVKVREID
PNP_ROSS1       ---------GDIFLGKVVRIMPFGAFVNLAPGKD--GMVHVSELDVGRVENVEDVIKMGDEINVMVIGIE
PNP_ROSCS       ---------GDIFLGKVVRIMPFGAFVNLAPGKD--GMVHVSELDVGRVENVEDVIKMGDEINVMVIGIE
PNP_PELUB       -------ELNKIYSGKVMKIMEFGAFVNFLGKQD--GLVHISELATKRVEKVTDIVKEGDEVKVKVIGFD
PNP_LEGPL       -------EVGQTYQGKVSKIVDFGAFINL--LPGKDGLLHISQICAARTQKVEEVLQEGQEIEVFVAGID
PNP_CYAP8       ---------GEVYMGRVTRIIQIGAFVEV--LPGKEGMIHISQLAEGRVGKVEDEVAVGDEVIVKVREID
RS1_SHIFL       -------QEGMEVKGIVKNLTDYGAFVDLGGVD---GLLHITDMAWKRVKHPSEIVNVGDEITVKVLKFD
RS1_PROSP       -------QEGMEVKGIVKNLTDYGAFVDLGGVD---GLLHITDMAWKRVKHPSEIVNVGDEITVKVLKFD
RS1_HELPY       -------KPGYAIKVVVSNIEHYGVFVDIGN--DIEGFLHVSEIS--WDKNVNNYLSVGQEIDVKIIDID
RS1_ECOLI       -------QEGMEVKGIVKNLTDYGAFVDLGGVD---GLLHITDMAWKRVKHPSEIVNVGDEITVKVLKFD
RS1_ECOL6       -------QEGMEVKGIVKNLTDYGAFVDLGGVD---GLLHITDMAWKRVKHPSEIVNVGDEITVKVLKFD
RS1_ECO57       -------QEGMEVKGIVKNLTDYGAFVDLGGVD---GLLHITDMAWKRVKHPSEIVNVGDEITVKVLKFD
PNP_SPICI       ---------GEKIIGPVVKIEKFGVFVHLKENLD--GLIHISKLAKQHVEKAEDIVQLNDIVKVKVIEID
PNP_RICBR       ------PEIGEVFNGTVMKILDSGAFVNY--LGNKDGFVHISEIAEERIESVGSVLKQGDIVKVKLIGFD
PNP_RICB8       ------PEIGEVFNGTVMKILDSGAFVNY--LGNKDGFVHISEIAEERIESVGSVLKQGDIVKVKLIGFD
PNP_PARD8       ------PEIGEVYEGKISSIMPYGAFVEFMPGKD--GLLHISEIDWKRLETVEQALKEGDTVSVKLVDID
PNP_NITSB       ------PEPGDILKGKIKRTTNFGAFVELPGGVD--GLLHISKLSSGRVERVEDVVNIGDEVEVEVL--S
PNP_LEGPH       -------EVGQTYQGKVSKIVDFGAFINL--LPGKDGLLHISQICADRTQKVEEVLQEGQEIEVFVAGID
PNP_LEGPC       -------EVGQTYQGKVSKIVDFGAFINL--LPGKDGLLHISQICADRTQKVEEVLQEGQEIEVFVAGID
PNP_CYTH3       ------PEVGEVYEGKVKSITAFGAFVEF--LPGKDGLLHISEIKWERLDTMEGVLEVGETVKVKLVEVD
RS1_HAEIN       ---------GDKVTGKIKSITDFGIFIGLEGGID--GLVHLSDIS--WSISGEEAVRQGDEVSAVVLAVD
PNP_PELLD       ------PEVGTIYVGKVRDVRDLGAFVEFIPKTD--GLVHISEISRERVTKVSDHLKVGDRIKVKLVDIR
PNP_MICAN       ---------GEVYLGRVTRIIQIGAFVEV--LPGKEGMIHISQLAEGRVGKVEDEVAVGDEVLVKVREID
PNP_LEGPA       -------EVGQTYQGKVSKIVDFGAFINL--LPGKDGLLHISQICAERTQKVEEVLQEGQEIEVFVAGID
PNP_CLOBM       ---------GEIYLGKVTKTTNFGAFVEI--LPGKEGLVHISKLDFARVEKVEDVVSVGDEILVKVTDID
PNP_CLOBL       ---------GEIYLGKVTKTTNFGAFVEI--LPGKEGLVHISKLDFARVEKVEDVVSVGDEILVKVTDID
PNP_CLOBK       ---------GEIYLGKVTKTTNFGAFVEI--LPGKEGLVHISKLDFARVEKVEDVVSVGDEILVKVTDID
PNP_CLOBJ       ---------GEIYLGKVTKTTNFGAFVEI--LPGKEGLVHISKLDFARVEKVEDVVSVGDEILVKVTDID
PNP_CLOBH       ---------GEIYLGKVTKTTNFGAFVEI--LPGKEGLVHISKLDFARVEKVEDVVSVGDEILVKVTDID
PNP_CLOB6       ---------GEIYLGKVTKTTNFGAFVEI--LPGKEGLVHISKLDFARVEKVEDVVSVGDEILVKVTDID
PNP_CLOB1       ---------GEIYLGKVTKTTNFGAFVEI--LPGKEGLVHISKLDFARVEKVEDVVSVGDEILVKVTDID
PNP_ALKOO       ------PEIGDIFKGKVIKLMNFGAFVEI--LPGKEGLVHISNLAHERVNKVEDVLAVGDEIDVKVIEID
PNP3_ALKMQ      ------PVVGEVYTGKVIKIMDFGAFVEI--LPGKEGLVHISNLAHERVTKVTDVLAEGDLIEVKLMEIN
PNP1_ALKMQ      ------PVVGEVYTGKVIKIMDFGAFVEI--LPGKEGLVHISNLAHERVAKVADVLAEGDLIEVKLMEIN
RS1_HELPJ       -------EATEPVLGVVRQITPFGIFV---KFKGIDGLVHYSEISHKGPVNPEKYYKEGDEVYVKAIAYD
PNP_STRTD       ---------GEVYTVPVVRIEKFGAFVHLFNKTD--ALVHISELAWKHTEHVEDVVKVGDMVTVKIIKID
PNP_STRT2       ---------GEVYTVPVVRIEKFGAFVHLFNKTD--ALVHISELAWKHTEHVEDVVKVGDMVTVKIIKID
PNP_STRT1       ---------GEVYTVPVVRIEKFGAFVHLFNKTD--ALVHISELAWKHTEHVEDVVKVGDMVTVKIIKID
PNP_MOOTA       -------ETGKVYNGKVTRVTDFGAFVEVIPMPGKEGLVHISQLANERVEKVEDVVQEGDYILVKAIGFD
PNP_LYSSC       ---------GEYYLSTVKRIEKFGAFCEI--FPGKDGLLHISEIQEERTKQVEDVLKLGDQLLVKVIEID
PNP_LACLA       ---------GEIYDAKVVRIESFGAFVNLFGKQD--AMVHISEMAWARTENVEDVVKLGDTVKVKIMKID
PNP_HERA2       ---------GEIFTGKVVRIMPYGAFVNV--LPGKDGMVHVSELDEKRVENVEDVVKIGDELTVMVIDVE
PNP_BACFR       ------PEVGEVYKGKVRSIMPYGAFVEF--LPGKDGLLHISEIDWKRLETVEEGIKEGDEIEVKLIDID
PNP_BACFN       ------PEVGEVYKGKVRSIMPYGAFVEF--LPGKDGLLHISEIDWKRLETVEEGIKEGDEIEVKLIDID
PNP_AMOA5       ------PVVGDVYQGTVKSIVPFGAFVEF--MPGKEGLLHISEVKWERIENLDQVLELGEVIPVKLLEID
PNP2_ALKMQ      ------PVVGEVYTGKVIKIMDFGAFVEI--LPGKEGLVHISNLAHERVAKVADVLAEGDLIEVKLMEIN
RS1_RHIME       -------EEGQVVEGVVKNITDYGAFVDLGGID---GLLHVTDMAWRRVNHPSEILNIGQQVKVQIIRIN
PNP_SULNB       -------EVGKTYVGKVKKIVDFGIFVEMPDGFD--ALLHISKVAKERVNNLNERYHEGDDITVVVME--
PNP_RHOBA       ---------GKIYDGTVSSIKEFGAFVEILPGRD--GLVHISEMSGGYISSLDQVIAVGDAMKVLVIDVD
PNP_BACTN       ------PEVGEVYKGKVRSIMPYGAFIEF--LPGKDGLLHISEIDWKRLETVEEGIKEGDEIEVKLIDID
PNP_AQUAE       -------EVGAVYKGTITRVEPYGVFVEL--WPGKIGLLHVSKMAEP-VRSATEKYKVGEEIIVKVLDLD
IF2A_DICDI      -----YPEENELVMVRIESIGDMGVYVSLLEYNNIEGMXXXXXXXXXXXXXXNKLVRVGKTEAVVVVRVD
RS1_CHLTR       ---------GSDISGVVTKITAFGAFVELQNGIE--GLIHVSELSEKPFAKIEDVLSIGDKVSAKVIKLD
PNP_SYNP6       ---------GDVYIGKVTRIIPIGAFVEF--LPGKEGMIHISQIADYRVARVEDELTVGDEVVVKVREID
PNP_SYNE7       ---------GDVYIGKVTRIIPIGAFVEF--LPGKEGMIHISQIADYRVARVEDELTVGDEVVVKVREID
PNP_DESRM       ---------GKLYNGKVTRVTDFGCFVEVIPLPGKEGLVHISQLAFQRVEKTEDIVKEGEVIAVKAIGYD
RS1_BUCAP       -------QEGIEIKGIVKNLTDYGAFVDLGGVD---GLLHITDMAWKRVKHPSEIVNVGDEINVKILKFD
RS1_BUCAI       -------QEGMHVKGIVKNLTDYGAFVDLGGVD---GLLHITDMAWKRVKHPSEIVNVGDEINIKILKFD
PNP_THEEB       ---------GDVYLGRVTRIIPIGAFVEL--LPGKEGMIHISQLAEYRVGKVEDEVKIGDEIVVKIREVD
PNP_SULDN       ---------GDIHKGIVKKIVEFGAFIELPDGVD--GLLHISKISDQRVEKVSDILKEGEEINVEILEF-
PNP_AKKM8       -------EIGELYTGKIVSTTTFGAFMEV--LPGKDGLIHISELAEGRTAKTEDVVSVGDVVTAKCIGID
RS1_CHLMU       ---------GLRVTAEIKNLTNYGAFVELEPGIE--GLIHISDMS--WIKKVSELFKKGNTVEAVILSVD
PNP_WOLSU       ---------GEVFKGKVKKIVDFGAFIELPKGGD--GLLHVSKIVQHRDQRIDEVIKEGEEIEVQILSIN
PNP_SULMW       ------PKVGTIYKAKVKNIKKFGVFVKISKYLE--GLLHIYEIS--WLTKVESFIRKGDIISVKYLGKN
PNP_RICPR       ------PEIGEIFNGTVMKVLDSGAFINY--LGNKDGFVHISEISDARIDKVSSVLKQGDIVKVKLIGFD
PNP_METCA       -------------------LMDFGAFVTI--LPGKDGLVHISQISDEHVEKVSDKLAEGDMVKVKVLEID
PNP_BACSK       ---------GETYHGKVKRIEKFGAFVEL--FKGKDGLLHISQIAEERINKVEDVFKLGDEVDVRVTEID
RR1_PORYE       ---------GNIIEGIINQITPYGLFIKVGNL---KGLVHISEINIKNLEQISSQFKIGDTIKAVIIHVD
RR1_PORPU       ---------GNIIEGVINQITPYGLFIKAGNL---KGLVHISEINVKQVERIPSQFKIGDTIKAVIIHVD
PNP_STRPZ       ---------GEVYHAKVVRIEKFGAFVNLFDKTD--ALVHISEIAWTRTTNVSDVLEVGEDVDVKVIKID
PNP_STRPM       ---------GEVYHAKVVRIEKFGAFVNLFDKTD--ALVHISEIAWTRTTNVSDVLEVGEDVDVKVIKID
PNP_STRPG       ---------GEVYHAKVIRIEKFGAFVNLFDKTD--ALVHISEIAWTRTANVSDVLEVGEDVDVKVIKID
PNP_STRPF       ---------GEVYHAKVIRIEKFGAFVNLFDKTD--ALVHISEIAWTRTANVSDVLEVGEDVDVKVIKID
PNP_STRPD       ---------GEVYHAKVVRIEKFGAFVNLFDKTD--ALVHISEIAWTRTTNVSDVLEVGEDVDVKVIKID
PNP_STRPC       ---------GEVYHAKVVRIEKFGAFVNLFDKTD--ALVHISEIAWTRTTNVSDVLEVGEDVDVKVIKID
PNP_STRPB       ---------GEVYHAKVVRIEKFGAFVNLFDKTD--ALVHISEIAWTRTTNVSDVLEVGEDVDVKVIKID
PNP_STRP8       ---------GEVYHAKVIRIEKFGAFVNLFDKTD--ALVHISEIAWTRTTNVSDVLEVGEDVDVKVIKID
PNP_STRP6       ---------GEVYHAKVVRIEKFGAFVNLFDKTD--ALVHISEIAWTRTTNVSDVLEVGEDVDVKVIKID
PNP_STRP3       ---------GEVYHAKVIRIEKFGAFVNLFDKTD--ALVHISEIAWTRTANVSDVLEVGEDVDVKVIKID
PNP_STRP1       ---------GEVYHAKVVRIEKFGAFVNLFDKTD--ALVHISEIAWTRTTNVSDVLEVGEDVDVKVIKID
PNP_CYAP4       ---------GDVYVGKVTRIIPIGAFVEF--LPGKEGMIHISQLADYRVNKVEDEVSVGDEVIVKVREID
PNP_RICM5       ------PEIGEIFNGTVMKVLDSGAFINY--LGNKDGFVHISEISEERIETVSSVLKQGDIVKVKLIGFD
PNP_DEIRA       ---------GEEFEGTVVKIAPFGAFVNLFPGQD--GMLHISQLSEQRVENVEDVLTVGDKLKVKIANID
RS1B_SYNY3      ---------GNIYEGKVAKIQPYGVFVEI---EGVTGLLHVSQVSGTRVDSLNTLFAFGQAISVYVQEID
PRP22_YEAST     --------------GKVRNITTFGCFVQIFGTRMKNGLVHISEMSDQRTLDPHDVVRQGQHIFVEVIKI-
PNP_TREPS       ------PRVGRVYQGVVKRIVEFGAFVEI--FPGKEGLCHXXXXXXXXXXXXXXXXQEGQRICVKLIDID
PNP_TREPA       ------PRVGRVYQGVVKRIVEFGAFVEI--FPGKEGLCHXXXXXXXXXXXXXXXXQEGQRICVKLIDID
PNP_STACT       -------EVGQVYNAKVRRIEKYGTFVEL--FPGKDALLHISQIANQRINKVEDVLKLGDTIEVKVTEID
PNP_RICCK       ------PEIGEIFNGTVTKILDSGAFINY--LGNKDGFVHISEISEERIDTVSSVIKQGDIVKVKLIGFD
PNP_EXISA       ----------EVVVGEVYDIEKFGAFVEL--FKGKDALVHVSEFSLERVANVEDVVKLGDSIQVKVTEID
PNP_ARCB4       ----------EVVIGKVERLADFGAFILLP--KGGEGLLHISKISKDRVKNVADVLSIGQ----------
YHGF_NEIMB      ---------GMILEGVVSNVANFGAFVDIGVHQD--GLVHISALSNKFVQDPREXXXXXXXXXXXXLEVD
YHGF_NEIMA      ---------GMILEGVVSNVANFGAFVDIGVHQD--GLVHISALSNKFVQDPREXXXXXXXXXXXXLEVD
PNP_RICTY       ------PEIGEIFNGTVMKVLDSGAFINY--LGNKDGFVHISEISETRIDKVSSVLKQGDIVKVKLIGFD
PNP_RICRS       ------PEIGEIFNGTVVKVLDSGAFINY--VGNKDGFVHISEVSGERIETVSSVLKQGDIVKVKLIGFD
PNP_RICRO       ------PEIGEIFNGTVVKVLDSGAFINY--VGNKDGFVHISEVSGERIETVSSVLKQGDIVKVKLIGFD
PNP_MACCJ       -------EVGQIYMATVKRIEKFGAFVEI--FPGKDALVHISQIALERINKVEDVVKLGDQFLVKVTEID
PNP_CHLP8       ------PEVGTIYMGKVRDIRDLGAFVEFLPKTD--GLVHISEIARERIAKVSDVLKPGERVKVKLIDI-
PNP_CARHZ       -------EVGKVYLGKVTRIADFGAFXXXXXXXXXXXXXHISQLAHSRVKRVEDVVKEGDQILVKAIGYD
PNP_BEUC1       ------PEVGERFVGTVVKTTSFGAFVSLTPGKD--GLLHISQVGGKRVENVEDVLGVGQKVQVEIAEID
PNP_ACIC1       ------PEVGERYLGTVVKATPFGVFVSL--LPGKDGLLHISEMAGGRVENVEDVLKVGDKIQVEIRDID
PNP_THEFY       ------PEVGERYLGTVVKTTAFGAFVSL--LPGKDGLLHISQIGGQRIENVEDVISIGEKIHVEVRDID
PNP_STRA5       ---------GEVYHAKVVRIEKFGAFVNLFDKTD--ALVHISEIAWTRTANVADVLEIGEEVDVKVIKID
PNP_STRA3       ---------GEVYHAKVVRIEKFGAFVNLFDKTD--ALVHISEIAWTRTANVADVLEIGEEVDVKVIKID
PNP_STRA1       ---------GEVYHAKVVRIEKFGAFVNLFDKTD--ALVHISEIAWTRTANVADVLEIGEEVDVKVIKID
PNP_RICPU       ------PEIGEIFNGTVVKVLDSGAFINY--VGNKDGFVHISEVSGERIETVSSVLKQGDIVKVKLIGFD
PNP_MYCA9       ------PKIGERFLGTVVKTTDFGAFVSLLPGRD--GLVHISKLGKGRIAKVEDVVKVGDKIQVEIADID
PNP_MANSM       -------EAGAVYTGKVTRLADFGAFVAI--VGNKEGLVHISQIAEERVEKVSDYLXXXXXXXXXXXXID
PNP_MAGSM       -------EKGQVYEGKVVRITDFGAFVNI--LPNKDGLVHISQLANRRVQNXXXXXXXXXXXXXXXLDVD
PNP_EHRCJ       ------PEIGKVFEGTVVEIVKFGAFVNF--LGGKRGLIHISEIKNEHISAVGSVISVNDKVKVLVIGID
PNP_BIFLI       ------PEAGETYNGKVVKTTSFGAFVNLTPGTD--GLLHISQIANGRIDAVEDVLREGDTVEVIVQGVD
IF2A_XENLA      -----FPEVDDVVMVNVRSIAEMGAYVSLLEYNNIEGMXXXXXXXXXXXXXXNKLIRIGRNECVVVIRVD
PNP_ELUMP       -------ELNKIYKGKVVSIQPFGAFVELIPGKD--GLLHISEIDKKRINKVEDVLKMGDIVEVKVVEID
PNP_CLOCE       -------EPGEVYLGKVVRITTFGAFVEI--LPGKDGLVHISXXXXXXXXXXXXXXSIGDEILVKVTEID
RS1_SYNE7       -------EVGQLINGKVTGLKPFGVFVDLG---GATALLPINQISQKFVADVGAIFKIGDPIQALVVAID
PNP_THERP       ------PEVGEIFYGRVVTIIPSGAFVEI--LPGKDGFLHISEIAPERVRSVEDVLKVGQEINVMVIGV-
PNP_STAS1       -------EVGQVYEGKVKRIEKYGAFVEL--FPGKDALVHISQIANERIDKVEDVLKVGDIFKIKVTEID
PNP_RICCN       ------PEIGEIFNGTVVKVLDSGAFINY--VGNKDGFVHISEVSGERIETVSSVLKQGDIVKVKLIGFD
PNP_RICAH       ------PEIGEIFNGTVMKVLDSGAFINYLGTKD--GFVHISEIAEERIETVGSVLKQGDIVKVKLIGFD
PNP_RICAE       ------PEIGEIFNGTVVKVLDSGAFINY--VGNKDGFVHISEVSGERIETVSSVLKQGDIVKVKLIGFD
PNP_MYCS2       ------PKVGERFLGTVVKTTDFGAFVSLLPGRD--GLVHISKLGKGRIAKVEDVVKVGDKLRVEIADID
PNP_METSB       ------PEVGQIYEGTVVKVVDFGAFVNF--FGSKDGLVHISQLAKGRVAKSSDXXXXXXXXXXXXXXFD
PNP_EHRCR       ------PEIGKVFEGTVVEIMKFGAFVSF--LGGKKGLVHISEIRNEHISSVGSVISLNDKVKVLVIGID
PNP_CHLTE       ------PEVGTIYMGKVRDIRDLGAFVEFLPKTD--GLVHISEIARERIAKVSDVLKVGDRIKVKLIDV-
PNP_BIFAA       ------PEAGETYNGKVVKTTSFGAFVNLTPGTD--GLLHISQIANGRIDAVEDVLKEGDTVEVVVQGVD
PNP_ACICJ       ------PEVGQIYTGKVVKIADFGAFVNF--FGARDGLVHISELAQGRVARXXXXXXXXXXXXXXMIGLD
RR1_SPIOL       ---------GSVVTGTVQSLKPYGAFIDIGGIN---GLLHVSQISHDRVSDIATVLQPGDTLKVMILSHD
PNP_STRPI       ----------EVYRAKVVRIEKFGAFVNLFDKTD--ALVHISEMAWTRTNNVEDLVAIGDEVDVKVIKID
PNP_STAES       -------EVGQVYHAKVKRIEKYGAFVEL--FPGKDALLHISQISQERINKVEDVLKIGDTIEVKITEID
PNP_STAEQ       -------EVGQVYHAKVKRIEKYGAFVEL--FPGKDALLHISQISQERINKVEDVLKIGDTIEVKITEID
PNP_RICFE       ------PEIGEIFNGTVMKVLDSGAFINY--LGNKDGFVHISEISEERIETVSSVLKQGDIVKVKLIGFD
PNP_EHRRW       ------PEIGKVFDGTVIEIVKFGAFVSF--LGGKRGLIHISEIKNEHINAVGSVISVNDKVKVLVIGID
PNP_EHRRG       ------PEIGKVFDGTVIEIVKFGAFVSF--LGGKRGLIHISEIKNEHINAVGSVISVNDKVKVLVIGID
PNP_CLOPH       -------EEGQVFEGKVISIKEFGAFLEFAP--GKEGMVHISKISKERINHVEDVLTLGDVVKVVCLGKD
PNP_BIFLO       ------PEAGETYNGKVVKTTSFGAFVNLTPGTD--GLLHISQIANGRIDAVEDVLKEGDTVEVIVQGVD
PNP_BIFLD       ------PEAGETYNGKVVKTTSFGAFVNLTPGTD--GLLHISQIANGRIDAVEDVLKEGDTVEVIVQGVD
PNP_ANAVT       ---------GDVYAGRVTRIIPIGAFVEF--LPGKEGMIHISQLADYRVGKVEDEVAVGDEVIVKVREID
PNP_ANASP       ---------GDVYAGRVTRIIPIGAFVEF--LPGKEGMIHISQLADYRVGKVEDEVAVGDEVIVKVREID
PNP_PELPB       ------PEVGNIYIGKVRDIRDLGAFVEFLPKTD--GLVHISEISSERVTKVSDHLKIGE----------
PNP_DICTD       ---------GDIFLGKVIRVTDYGAFVEI--LPGKIGLLHISKYTTGTGKNTREEINLGDEILIKVDSID
IF2A_XENTR      -----FPEVDDVVMVNVRSIAEMGAYVSLLEYNNIEGMXXXXXXXXXXXXXXNKLIRIGRNECVVVIRVD
IF2A_HUMAN      -----FPEVEDVVMVNVRSIAEMGAYVSLLEYNNIEGMXXXXXXXXXXXXXXNKLIRIGRNECVVVIRVD
RS1A_SYNY3      -------EVAQVVVGSVRGIKPYGAFIDIGGVS---GLLHISEISHDHIDTPHSVFNVNDEIKVMIIDLD
PNP_SULSY       -------ELGEVYLGKVTRVEDYGAFVEL--MPGKLSLLHVSQISSERLKSAXXXXXXXXXXXXXXSEID
PNP_NOSP7       ---------GDVYAGRITRIIPIGAFVEF--LPGKEGMIHISQLADYRVGKVEDEVAVGDEVIIKVREID
PNP_MYCTU       ------PTVGERFLGTVVKTTDFGAFVSLLPGRD--GLVHISKLGKGRIAKVEDVVNVGDKLRVEIADID
PNP_MYCTA       ------PTVGERFLGTVVKTTDFGAFVSLLPGRD--GLVHISKLGKGRIAKVEDVVNVGDKLRVEIADID
PNP_MYCPA       ------PTVGERFLGTVVKTTDFGAFVSLLPGRD--GLVHISKLGKGRIAKVEDVVNVGDKLRVEIADID
PNP_MYCMM       ------PTVGERFLGTVVKTTDFGAFVSLLPGRD--GLVHISKLGKGRIAKVEDVVNVGDKLRVEIADID
PNP_MYCBT       ------PTVGERFLGTVVKTTDFGAFVSLLPGRD--GLVHISKLGKGRIAKVEDVVNVGDKLRVEIADID
PNP_MYCBP       ------PTVGERFLGTVVKTTDFGAFVSLLPGRD--GLVHISKLGKGRIAKVEDVVNVGDKLRVEIADID
PNP_MYCBO       ------PTVGERFLGTVVKTTDFGAFVSLLPGRD--GLVHISKLGKGRIAKVEDVVNVGDKLRVEIADID
PNP_MYCA1       ------PTVGERFLGTVVKTTDFGAFVSLLPGRD--GLVHISKLGKGRIAKVEDVVNVGDKLRVEIADID
PNP_KINRD       ------PEVGERYLGTVVKTTTFGAFVSL--MPGKDGLLHISQLLSGGVDNVEDVVAVGQKVQVEIAEID
PNP_GEMAT       MAITAEPVVGETYEGTVKTVTAFGAFVEI--MPGNEALLHVSEMRWERVEKPEDVVKKGDRVTVKLVDRD
PNP_DICT6       ---------GDIFLGKVIRVTDYGAFVEI--LPGKIGLLHISKYTTGTGKNTREEINLGDEILIKVDSID
PNP_CHLL2       ------PEVGTIYLGKVRDVRDLGAFVEFLPKTD--GLVHISEIATERVAKVSDHLKIGDRIKVKLVDV-
IF2A_CHICK      -----FPEVEDVVMVNVRSIAEMGAYVSLLEYNNIEGMXXXXXXXXXXXXXXNKLIRIGRNECVVVIRVD
PNP_THETN       -------EVGGIYLGKVLRIAPFGAFVEIAP--GKEGLVHISNLSXXXXXXXXXXXXXGDNILVKVTEID
PNP_STRSV       ----------EVYHAKVVRIEKFGAFVNLFDKTD--ALVHISELAWTRTNNVEDVVQIGDEVDVKVIKID
PNP_STAHJ       -------EVGQVYNAKVKRIEKYGAFVEL--FAGKDALLHISQISKERINKVEDVLSIGDSIDVKITEID
PNP_PSESM       -------EIGKIYLGKVERIVDFGAFVNI--LPGKDGLVHISMLSDARVEKVTD-ILKXXXXXXXXXXXX
PNP_MYCVP       ------PKVGERFLGTVVKTTDFGAFVSLLPGRD--GLVHISKLGRGRINKVEDVAKVGDKLRVEIADID
PNP_MYCGI       ------PKVGERFLGTVVKTTDFGAFVSLLPGRD--GLVHISKLGRGRINKVEDVAKVGDKLRVEIADID
PNP_GLOVI       -------------------IPNLGAFVEV--MPGKEGLVHISQLAEHRVRKVEDELNVGDEVVVKVKEID
PNP_FRASC       ------PEVGERYLGTIVKITNFGAFVSLTPGRD--GLLHVSKLLSGGVEKVEDVLTVGQKLQVEITEID
IF2A_RAT        -----FPEVEDVVMVNVRSIAEMGAYVSLLEYNNIEGMXXXXXXXXXXXXXXNKLIRIGRNECVVVIRVD
IF2A_PONAB      -----FPEVEDVVMVNVRSIAEMGAYVSLLEYNNIEGMXXXXXXXXXXXXXXNKLIRIGRNERVVVIRVD
IF2A_MOUSE      -----FPEVEDVVMVNVRSIAEMGAYVSLLEYNNIEGMXXXXXXXXXXXXXXNKLIRIGRNECVVVIRVD
IF2A_BOVIN      -----FPEVEDVVMVNVRSIAEMGAYVSLLEYNNIEGMXXXXXXXXXXXXXXNKLIRIGRNECVVVIRVD
PNP_STRZT       ----------EVYRAKVVRIEKFGAFVNLFDKTD--ALVHISEMAWTRTNRVEDLVEIGDEVDVKVIKID
PNP_STRZJ       ----------EVYRAKVVRIEKFGAFVNLFDKTD--ALVHISEMAWTRTNRVEDLVEIGDEVDVKVIKID
PNP_STRR6       ----------EVYRAKVVRIEKFGAFVNLFDKTD--ALVHISEMAWTRTNRVEDLVEIGDEVDVKVIKID
PNP_STRPS       ----------EVYRAKVVRIEKFGAFVNLFDKTD--ALVHISEMAWTRTNRVEDLVEIGDEVDVKVIKID
PNP_STRPN       ----------EVYRAKVVRIEKFGAFVNLFDKTD--ALVHISEMAWTRTNRVEDLVEIGDEVDVKVIKID
PNP_STRPJ       ----------EVYRAKVVRIEKFGAFVNLFDKTD--ALVHISEMAWTRTNRVEDLVEIGDEVDVKVIKID
PNP_STRP7       ----------EVYRAKVVRIEKFGAFVNLFDKTD--ALVHISEMAWTRTNRVEDLVEIGDEVDVKVIKID
PNP_STRP4       ----------EVYRAKVVRIEKFGAFVNLFDKTD--ALVHISEMAWTRTNRVEDLVEIGDEVDVKVIKID
PNP_STRP2       ----------EVYRAKVVRIEKFGAFVNLFDKTD--ALVHISEMAWTRTNRVEDLVEIGDEVDVKVIKID
PNP_STAAW       ---------GQTYQATVKRIEKYGAFVGL--FPGKDALLHISQISKNRIEKVEDVLKIGDTIEVKITEID
PNP_STAAT       ---------GQTYQATVKRIEKYGAFVGL--FPGKDALLHISQISKNRIEKVEDVLKIGDTIEVKITEID
PNP_STAAS       ---------GQTYQATVKRIEKYGAFVGL--FPGKDALLHISQISKNRIEKVEDVLKIGDTIEVKITEID
PNP_STAAR       ---------GQTYQATVKRIEKYGAFVGL--FPGKDALLHISQISKNRIEKVEDVLKIGDTIEVKITEID
PNP_STAAN       ---------GQTYQATVKRIEKYGAFVGL--FPGKDALLHISQISKNRIEKVEDVLKIGDTIEVKITEID
PNP_STAAM       ---------GQTYQATVKRIEKYGAFVGL--FPGKDALLHISQISKNRIEKVEDVLKIGDTIEVKITEID
PNP_STAAE       ---------GQTYQATVKRIEKYGAFVGL--FPGKDALLHISQISKNRIEKVEDVLKIGDTIEVKITEID
PNP_STAAC       ---------GQTYQATVKRIEKYGAFVGL--FPGKDALLHISQISKNRIEKVEDVLKIGDTIEVKITEID
PNP_STAAB       ---------GQTYQATVKRIEKYGAFVGL--FPGKDALLHISQISKNRIEKVEDVLKIGDTIEVKITEID
PNP_STAA9       ---------GQTYQATVKRIEKYGAFVGL--FPGKDALLHISQISKNRIEKVEDVLKIGDTIEVKITEID
PNP_STAA8       ---------GQTYQATVKRIEKYGAFVGL--FPGKDALLHISQISKNRIEKVEDVLKIGDTIEVKITEID
PNP_STAA3       ---------GQTYQATVKRIEKYGAFVGL--FPGKDALLHISQISKNRIEKVEDVLKIGDTIEVKITEID
PNP_STAA2       ---------GQTYQATVKRIEKYGAFVGL--FPGKDALLHISQISKNRIEKVEDVLKIGDTIEVKITEID
PNP_STAA1       ---------GQTYQATVKRIEKYGAFVGL--FPGKDALLHISQISKNRIEKVEDVLKIGDTIEVKITEID
PNP_RHOP2       ------PEVGEIYEGTVVKVMEFGAFVNF--FGAKDGLVHISQLASGRVQ--------------------
PNP_NOCSJ       ------PEVGERYLGTVVKTTNFGAFVSL--MPGKDGLLHISKLRSKRVDAVEDVVSVGQKIQVQIAEID
PNP_MYCUA       ------PTVGERFLGTVVKTTDFGAFVALLPGRD--GLVHISKLGKGRIAKVEDVVNVGDKLRVEIADID
PNP_FLAJ1       ------PQVGEAYEVKVIKMLDFGAVVEYTAAPGNEVLLHVSELAWERTENVADVVKMGDVFEVKYLGVD
PNP_BLOPB       -------EIGAVYTGKVSHIVEFGAFVTI--LSGKEGLVHISQISERRINKVTDYXXXXXXXXXXXXEID
PNP_WIGBR       ----------KIYVAKITRISEFGIFACL--INNKEGLIHVSKIPYKKFSDINNNFKIGQIISVKVIEID
PNP_MYCSS       ------PKIGERFLGTVVKTTDFGAFVSLLPGRD--GLVHISKLGRGRIAKVEDVAKVGDKLRVEIADID
PNP_MYCSK       ------PKIGERFLGTVVKTTDFGAFVSLLPGRD--GLVHISKLGRGRIAKVEDVAKVGDKLRVEIADID
PNP_MYCSJ       ------PKIGERFLGTVVKTTDFGAFVSLLPGRD--GLVHISKLGRGRIAKVEDVAKVGDKLRVEIADID
PNP_FRASN       ------PEVGERYLGTIVKITNFGAFVSLTPGKD--GLLHVSQLAGGRVEKVEDVLSVGQKLQVEITEID
PNP_EXIS2       ---------GEEFDGTVRRVEKFGAFVEL--FKGKDALVHISELALERVGQTEDVVKLGDKLKVRVTEVD
PNP_DEIDV       ---------GEEYEGTVVKTAPFGAFVNL--YAGQDGMLHISQISEERLSAVEDALNVGDKLRVKIAGID
PNP_METI4       ---------GEVTVGGVVSVKDFGCFIEIKGKGE--GLVHISELSDTPVRRVDQVVRVGEEIWVKCIGVD
PNP_JANSC       ---------------------DFGAFVNF--FGKRDGLVHVSQIKNERLNHPSDVLSEGQEVWVKLLGFD
PNP_DESAA       ------PEVGAVYEGTVVKIMDFGAFVAI--LPGTEGLCHISQLDTKHVKKVSD----------------
PNP_DEIGD       ---------GEEYEGTVVKTAPFGAFVNLFPGQD--GMLHISQMSENRVNAVEDVLNVGDRLRVKIANID
PNP_CAMC1       ---------GDEFTGSVKSVVDFGVFIELKDGVD--GLLHISKIKSP--LNVGDQV--------KVCVSE
RNR_BACSU       ---------GEEFDGMISSVTNFGMFVELPNTIE--GLVHVSFMTDDYYRFDEQHFRIGDEITVKVVDVN
PNP_RHOPS       ------PEVGEIYEGTVVKVMEFGAFVNF--FGAKDGLVHISQLAAGRVQ--------------------
PNP_RHOPA       ------PEVGEIYEGTVVKVMEFGAFVNF--FGAKDGLVHISQLAAGRVQ--------------------
PNP_FRAAA       ------PEVGERYLGTIVKITNFGAFVSLTPGRD--GLLHVSKLLSGGVEKVEDVLTVGQKLQVEITEID
PNP_CAMFF       ---------GDEFEGEIKKMAAFGAFISLRDGVD--GLLHISKIVSP--------LKEGDTIKVKVSDIK
IF2A_DROME      -----YPEIEDVVMVNVLSIAEMGAYVHLLEYNNIEGMXXXXXXXXXXXXXXNKLIRVGKTEPVVVIRVD
PNP_THISH       -------EVGRIYEGRVVKIMDFGAFVTILPGRD--GLVHISQISEERVESVSDRLTEG-----------
PNP_STRGG       ------PEVGERYLGTVVKTTTFGAFVSL--MPGKDGLLHISQIAGGRVENVEDVLGVGAKVQVEIAEID
PNP_STRCO       ------PEVGERYLGTVVKTTTFGAFVSL--LPGKDGLLHISQIAGGRVENVEDVLGVGAKVQVEIAEID
PNP_STRAW       ------PEVGERYLGTVVKTTTFGAFVSL--LPGKDGLLHISQIAGGRVENVEDVLGVGAKVQVEIAEID
PNP_RHOPT       ------PEIGEIYEGTVVKVMEFGAFVNF--FGAKDGLVHISQLAAGRVQ--------------------
PNP_METS4       ------PEAGMIYDGTVVKTMEFGAFVNF--FGAKDGLVHISELAPQRVAXXXXXXXXXXXXXXXFLGQD
PNP_GLUDA       ------PELGAIYTGKVVKTADFGAFVNFLGARD--GLVHISELAQGRVAKTTXXXXXXXXXXXXXLGFD
PNP_FLAPJ       ------PQIGEAYEVKVIKMLDFGAVVEYTAVPGNEVLLHVSELAWERTENVTDVVNMGDVFMVKYLGLD
PNP_BIFA0       ------PQAGETYKGTVVKTTSFGAFVNLTPGID--GLLHISQIADGQIDAVEDVLKEGDSVEVVVQGVD
PNP_BEII9       ------PEVGHIYDGTVVKVVDFGAFVNF--FGSKDGLVHISQLAKG-----------------------
PNP_STRGC       ----------EVYHAKVVRIEKFGAFVNLFDKTD--ALVHISELAWTRTNNVEDVVQIGDEVDVMVIKID
PNP_HELHP       ---------GERFVGKIKKIVDFGIFVELPRGGD--GLIHISKITKDKTQQLSEIFHNVSELECEIL--S
PNP_THEAB       -------EVGDVFEGKITRIEPYGIFVEL--MPGKIGLAHSSKLGED-SKNFKEKYKIGDTIKVIVVNID
PNP_METNO       ------PEAGMIYDGTVVKTMEFGAFINF--FGAKDGLVHISELAPQRVAXXXXXXXXXXXXXXXFLGQD
PNP_FUSNN       -------EYNEVYEGRVVSIMKFGAFMEI--LPGKEGLLHISEISPERVEKVEDVLSVGDVFKVRVISME
PNP_XANP2       ------PEVGQIYEGTVVKVVDFGAFVNF--FGSKDGLVHVSQMAN------------------------
PNP_WOLPP       --------------------------VELELLNGRKGKMHISEVANQHVESIEDILKQGDTFKALIIDFE
PNP_PROAC       ------PEVGERYLGTVVKTTSFGAFVSL--LPGKDGLLHISKMRGKRVEAVEDVLSVGQKIQVEIAEVD
PNP_PROA2       ------PEVGTVYSGKVRDIRDLGAFVEFLPKTD--GLVHISEISNERVAKVSDHLKPG-----------
PNP_DESDG       MYYDQRPELGKNYTAKVRKIMEIGAIVEI--LPNCEALIHISQLDTSRVEKTEDVVQLGQDVEVKVIEIN
PNP_STRMK       -------EPGRIYEGKVAKIMDFGAFVTI--LPGKDGLVHVSQISS------------------------
PNP_STRM5       -------EPGRIYEGKVAKIMDFGAFVTI--LPGKDGLVHVSQISS------------------------
PNP_PARL1       ------PEVGKIYEGTVVKAVDFGAFVNF--FGPRDGLVHISQMAPTRVEQVSXXXXXXXXXXXXXXXFD
PNP_CAMLR       ---------GEEFLGRVQKVVEFGVFVELKEGVD--GLLHNSK--------IKEKLEVGHEIKVKVAEIK
PNP_BREBN       ---------GQVYLGTVKRVEKYGAFIEL--FAGKEGLCHISQLAEERVAKTEXXXXXXXXXXXXXTEID
PNP_BRAJA       ------PEVGQIYDGTVVKVMEFGAFVNF--FGSKDGLVHISQLASARVQ--------------------
PNP_ANAMM       ------PEVGKVFSGVISEIAKYGAFVSF--LGGRRGLVHISEIKNEHIGXXXXXXXXXXXXXXXXIGID
PNP_ANAMF       ------PEVGKVFSGVISEIAKYGAFVSF--LGGRRGLVHISEIKNEHIGXXXXXXXXXXXXXXXXIGID


                         .         .         *         .         .         .         .:140
query           ESANQIDLSIKDVNEHQRKDKIQDWKNSQKADNWMLIALGEDVDDDRYTAVANALLVEFDSLYDAFEAAA
IF2A_HALMA      ESAQQIDLSIKDVNDHQRKEKIQEWKNEQKADNWMELAFGEDLDDETYAAIANELLAEFGSMYDGFESAA
IF2A_HALSA      ESAQQIDLSLKDVNDHQHSDTIQEWKNEQKADKWLTLAFGEDMADDQFRRIANGLLADFGSLYDGFEQAA
IF2A_HALS3      ESAQQIDLSLKDVNDHQHSDTIQEWKNEQKADKWLTLAFGEDMADDQFRRIANGLLADFGSLYDGFEQAA
IF2A_ARCFU      PKRGHIDLSIKDVNERQRREKLQQWKNEMKAFKWLEI-IGENIDFKELEKIGKKLMKEYDSVYSAFEEAA
IF2A_METS3      PKKGHVDASLKRIREDQRTKKIQHWKIEQKAEKFLELSLGKSL-NDAYDEVGYELMDIFGDVYGAFETAA
IF2A_METJA      ERKGHIDLSLKRVTEQQKRAKVQEWKRFQRASKMLERALGKSL-EEAWEEVGYLLEDEFGELYNAFETMV
IF2A_METST      PKKGHVDASLKRIREDQRTRRMQQWKIEQKAEKLLEISAKNKTLDEAYDEVGYLIMEEFGDLYEGFELAS
IF2A_METTH      PRKGHVDVSMKRIREDQRTKKIQAWKIEQKAEKFLELALGKDL-DTAYEEVGYELMDIFGDLYGAFETAA
IF2A_METKA      PKRKYANLSLRKVTDHQRKEKLKEWKREQRXXXXXXXXXGKDL-DEAYEEAGYKLIEEYGSLYDALEAAA
IF2A_THEON      PNKGHIDLSLKRVNQQQRKAKLQEYKRAQKAENLLKMALGKDF-EMAWQEVWVPLEEEYGEVYAAFEDAA
IF2A_PYRKO      PEKGHIDLSLKRVNQQQRKAKLQEYKRAQKAENLLKMALGKDF-ETAWREVWVPLEEEYGEVYAAFEDAA
IF2A_THEGJ      PEKGHIDLSLKRVNQQQRKAKLQEYKRAQKAENLLKMA-AEKIGKDFETAVWVPLEEEYGEVYAAFEDAA
IF2A_THEAC      PERKVVDLSLKRVNQHQSREKIAEWKNEQKADKLFEIVCSRNRNPEECKEQFGRRLVEFGTLFAAFESAA
IF2A_PYRHO      PRKGHIDLSLRRVTQQQRKAKLQEFKRAQKAENLLRLALGKDF-EAAWREVWVPLEEEWGEVYAAFEDAA
IF2A_PYRFU      PKKGHIDLSLRRVTQQQRKAKLQEFKRXXXXXXXXXXXXXXXXXDEAWREVWVPLENEWGEVYAAFEDAA
IF2A_THEVO      QERKNVDLSLKRVNQHQSREKIAEWKNEQKADKLFEIVLNKDLE-----ACKKEFGVRLVELYGTLXXXX
IF2A_PYRAB      PRKGHIDLSLRRVTQQQRKAKLQEFKRXXXXXXXXXXXXXXXXXDTAWREVWVPLEEEWGEVYAAFEDAA
IF2A_STAMF      XXXXTVDVSLKKVPENEKRRKMLWWKRYLKASKIVLVAIGKSI-EDAYREVVWKLEDYYGDPLLGLEEAV
IF2A_HYPBU      XXXXXXDVSLKRVTDSERRRKMMEWKRAQKAERILLVALGKSL-EEAYEAVGKKLEDYYGELMAAFEEVV
IF2A_AERPE      XXXGQVDVSLKRVMDSEKKRKMMFYKRYLKAATLVLIALGKSV-DEAYREVLWKLEDAYGDPMKGLEAAV
IF2A_SULTO      XXXGTIDVSLKKVTEDEKRKKMSQWKKIQKVDKILEIVSQKKTEKEGWEQVAWKLEDKYGDAYDALVKAV
IF2A_PYRAE      PKMRVVEVSLKRVRVDEKEKKLLLYRHRVRVLKLLEIAMKKNRPAEEALKVMWYLEEQFGDPFKVFEEVV
IF2A_SULIY      XXXGTVDVSLKKVTDDERRKKNLQWKKIQRLDK-ILELVSQQLEKDAWEQVAWKLEAKYGDPISAIERAV
IF2A_SULIN      XXXGTVDVSLKKVTDDERRKKNLQWKKIQRLDK-ILELVSQQLEKDAWEQVAWKLEAKYGDPISAIERAV
IF2A_SULIM      XXXGTVDVSLKKVTDDERRKKNLQWKKIQRLDK-ILELVSQQLEKDAWEQVAWKLEAKYGDPISAIERAV
IF2A_SULIK      XXXGTVDVSLKKVTDDERRKKNLQWKKIQRLDK-ILELVSQQLEKDAWEQVAWKLEAKYGDPISAIERAV
IF2A_SULIA      XXXGTVDVSLKKVTDDERRKKNLQWKKIQRLDK-ILELVSQQLEKDAWEQVAWKLEAKYGDPISAIERAV
IF2A_SULSO      XXXGTVDVSLKKVTDDERRKKNLQWKKIQRLDK-ILELVSQKLEKDAWEQVAWKLEAKYGDPITAIEKAV
IF2A_SULIL      XXXGTVDVSLKKVTDDERRKKNLQWKKIQRLDK-ILELVSQQLEKDAWEQVAWKLEAKYGDPISAIERAV
PNP_HAHCH       -ARGRIKLSMKEVTEDEK----------------------------------------------------
PNP_CHRSD       -NRNRVKLSIKEVTAEEK----------------------------------------------------
PNP_MARAV       -NRGRVKLSMKEVKEGEQPTDFAD----------------------------------------------
PNP_LEPIN       KT-GKIDLSRKDALEEEQ----------------------------------------------------
PNP_LEPIC       KT-GKIDLSRKDALEEEQ----------------------------------------------------
PNP_HAMD5       RQ-GRIRLSIKDAIADTSEHKIED----------------------------------------------
RS1H_BACSU      ENEERISLSMRELEETPKADQ-EDYRQYQKEETSTGFQLGDLIGD-------------------------
PNP_LEPBL       KT-GKIDLSRKDALE-------------------------------------------------------
PNP_LEPBJ       KT-GKIDLSRKDALE-------------------------------------------------------
PNP_ACIBL       --GNRIKLSRKAVLKEQR----------------------------------------------------
PNP_MARMS       -ARGRIKLSMKDVTEEEK----------------------------------------------------
GS13_BACSU      EEKGKISLSIR-----------------------------------------------------------
PNP_PSEU5       -NRGRIKLSIKDV---------------------------------------------------------
PNP_AZOVD       -NRGRIKLSIKDV---------------------------------------------------------
PNP_ACIC5       --GNRIKLSRKAVIREQRQ---------------------------------------------------
PNP_PSEA6       RQ-NRVRLSIKELLE-------------------------------------------------------
PNP_PSYIN       RQ-GRVRLSIKEAAE-------------------------------------------------------
PNP_PSEHT       RQ-GRVRLSIKEAME-------------------------------------------------------
PNP_PSEAE       -NRGRIKLSIKDV---------------------------------------------------------
PNP_PSEAB       -NRGRIKLSIKDV---------------------------------------------------------
PNP_PSEA8       -NRGRIKLSIKDV---------------------------------------------------------
PNP_PSEA7       -NRGRIKLSIKDV---------------------------------------------------------
PNP_XYLFT       KQ-GRIRLSIKAVEE-------------------------------------------------------
PNP_XYLFM       KQ-GRIRLSIKAVEE-------------------------------------------------------
PNP_XYLFA       KQ-GRIRLSIKAVEE-------------------------------------------------------
PNP_XYLF2       KQ-GRIRLSIKAVEE-------------------------------------------------------
PNP_PSEPW       -NRGRIKLSIKDV---------------------------------------------------------
PNP_PSEPU       -NRGRIKLSIKDV---------------------------------------------------------
PNP_PSEPK       -NRGRIKLSIKDV---------------------------------------------------------
PNP_PSEPG       -NRGRIKLSIKDV---------------------------------------------------------
PNP_PSEPF       -NRGRIKLSIKDV---------------------------------------------------------
PNP_PSEP1       -NRGRIKLSIKDV---------------------------------------------------------
PNP_PSEFS       -NRGRIKLSIKDV---------------------------------------------------------
PNP_PSEF5       -NRGRIKLSIKDV---------------------------------------------------------
PNP_PSEE4       -NRGRIKLSIKDV---------------------------------------------------------
PNP_PSE14       -NRGRIKLSIKDV---------------------------------------------------------
ISPH_CLOTE      GEKRKIGLSIKEVND-------------------------------------------------------
PNP_XANOR       KQ-GRIRLSIKAVEE-------------------------------------------------------
PNP_XANOP       KQ-GRIRLSIKAVEE-------------------------------------------------------
PNP_XANOM       KQ-GRIRLSIKAVEE-------------------------------------------------------
PNP_XANCP       KQ-GRIRLSIKAVEE-------------------------------------------------------
PNP_XANCB       KQ-GRIRLSIKAVEE-------------------------------------------------------
PNP_XANC8       KQ-GRIRLSIKAVEE-------------------------------------------------------
PNP_XANC5       KQ-GRIRLSIKAVEE-------------------------------------------------------
PNP_XANAC       KQ-GRIRLSIKAVEE-------------------------------------------------------
PNP_PSEU2       -NRGRIKLSIKDV---------------------------------------------------------
PNP_PHOPR       RQ-GRIRLSMKEAVADQNPATVQD----------------------------------------------
PNP_TREDE       K-LGRLNLSYVDALEERSK---------------------------------------------------
PNP_PSEMY       -NRGRIKLSIKDV---------------------------------------------------------
PNP_DESOH       ----------------------------------------------------------------------
PNP_COXBU       RQ-GRVRLSMKQID--------------------------------------------------------
PNP_COXBR       RQ-GRVRLSMKQID--------------------------------------------------------
PNP_COXBN       RQ-GRVRLSMKQID--------------------------------------------------------
PNP_COXB2       RQ-GRVRLSMKQID--------------------------------------------------------
PNP_COXB1       RQ-GRVRLSMKQID--------------------------------------------------------
PNP_ACIAD       -NRGRIKLSMKDIEQ-------------------------------------------------------
PNP_SOLUE       --GNKIKLSRKAVLKEQRE---------------------------------------------------
PNP_NITEU       EK-GRLRLSMK-----------------------------------------------------------
PNP_ACIF5       RQ-GKIKLSMKDI---------------------------------------------------------
PNP_ACIF2       RQ-GKIKLSMKDI---------------------------------------------------------
PNP_ACIBY       -NRGRIKLTMKDIEQ-------------------------------------------------------
PNP_ACIBT       -NRGRIKLTMKDIEQ-------------------------------------------------------
PNP_ACIBS       -NRGRIKLTMKDIEQ-------------------------------------------------------
PNP_ACIBC       -NRGRIKLTMKDIEQ-------------------------------------------------------
PNP_ACIB5       -NRGRIKLTMKDIEQ-------------------------------------------------------
PNP_ACIB3       -NRGRIKLTMKDIEQ-------------------------------------------------------
YABR_BACSU      EKDGKIGLSIKKAKDRPQARPRNDFRPKESFEQKM-----------------------------------
PNP_CHLTR       EK-GQLKLSHK-----------------------------------------------------------
PNP_CHLTB       EK-GQLKLSHK-----------------------------------------------------------
PNP_CHLTA       EK-GQLKLSHK-----------------------------------------------------------
PNP_CHLT2       EK-GQLKLSHK-----------------------------------------------------------
PNP_ALCBS       Q-RGRIKLSMKEAKE-------------------------------------------------------
PRP22_SCHPO     ESAKRISLSMKEVNQVTGED--------------------------------------------------
PNP_EDWI9       RQ-GRVRLSIKEAN--------------------------------------------------------
PNP_CLONN       -SMGRVNLS--------RKDAIKDSENNQDKD--------------------------------------
ISPH_CLOAB      SEEKKIGLSIREVEE-------------------------------------------------------
IF2A_YEAST      KEKGYIDLSKRRVSS-EDIIKCEEKYQKSKTVHSILRYCAEKFQEELYKTIAWPLSRKFGHAYEAFKLSI
DHX8_ARATH      -SSDKYSLSMRDVDQNTGRDLIPLRKPSDEDDS-------------------------------------
RS1_STAS1       KDSERISLSIKD----------------------------------------------------------
PNP_VIBCM       RQ-GRVRLSMKEAVE-------------------------------------------------------
PNP_VIBCH       RQ-GRVRLSMKEAVE-------------------------------------------------------
PNP_VIBC3       RQ-GRVRLSMKEAVE-------------------------------------------------------
PNP_SHEAM       RQ-GRVRLSIKE----------------------------------------------------------
PNP_HALOH       E-LGRINLSRKRALKEQKKE--------------------------------------------------
PNP_HALHL       RQ-GRIRLSMKAVEE-------------------------------------------------------
PNP_VIBFM       RQ-GRIRLSIK-----------------------------------------------------------
PNP_VIBF1       RQ-GRIRLSIK-----------------------------------------------------------
PNP_SYMTH       R-LGRINLSIKDAMPKQ-----------------------------------------------------
PNP_RHILO       E-RGKVRLSMKVVDQATGKEIVRDKRAEGEED--------------------------------------
PNP_POLSJ       EK-GRVKLSMKALLDRPAQNQDQD----------------------------------------------
PNP_METEP       E-RGKIRLSMKVVDQETGEDLTEKLK--------------------------------------------
PNP_METC4       E-RGKIRLSMKVVDQETGEDLTEKLK--------------------------------------------
PNP_DELAS       EK-GRVKLSLKALTE-------------------------------------------------------
PNP_ALISL       RQ-GRIRLSIKE----------------------------------------------------------
PNP_ACTSZ       RQ-GRIRLTMKDI---------------------------------------------------------
PNP_VIBHB       RQ-GRVRLSMKEAVE-------------------------------------------------------
PNP_TERTT       Q-RGRIKLSIKEL---------------------------------------------------------
PNP_OCHA4       E-RGKVRLSMKVVDQ-------------------------------------------------------
PNP_ERWCT       RQ-GRVRLSIKEAN--------------------------------------------------------
PNP_ECO27       RQ-GRIRLSIKEATEQSQ----------------------------------------------------
PNP_DICNV       RQ-GRVRLSIKE----------------------------------------------------------
PNP_DESPS       -NRGRIRLSRK-----------------------------------------------------------
PNP_DESAH       RD-GKIRLSCKALEEEEK----------------------------------------------------
PNP_BURP8       EK-GRVRLSAK-----------------------------------------------------------
PNP_ALHEH       RQ-GRIRLSMKAVQD-------------------------------------------------------
PNP_VARPS       EK-GRVKLSMKALTE-------------------------------------------------------
PNP_SILPO       D-RGKVRLSMKVVDQETGEEIVPEKKEASEAE--------------------------------------
PNP_PASMU       RQ-GRIRLTMKEVAPKQ-----------------------------------------------------
PNP_NITOC       KQ-GRVRLSVKAI---------------------------------------------------------
PNP_KLEP3       RQ-GRVRLSIKEATE-------------------------------------------------------
PNP_BLOFL       RQ-GRMRLSMRGIN--------------------------------------------------------
PNP_BAUCH       RQ-GRIRLSMKDTN--------------------------------------------------------
PNP_AZOSE       E-RGKIRLSMK-----------------------------------------------------------
PNP_ANASK       RS-GKIRLSRKE----------------------------------------------------------
PNP_ANADE       RS-GKIRLSRKE----------------------------------------------------------
PNP_ANAD2       RS-GKIRLSRKE----------------------------------------------------------
PNP_METPB       E-RGKIRLSMKVVDQETGED--------------------------------------------------
PNP_CLOK5       -NQGRINLSRKDAIKDSEK-KEQNEKDVQK----------------------------------------
PNP_CLOK1       -NQGRINLSRKDAIKDSEK-KEQNEKDVQK----------------------------------------
PNP_CHRVO       D-RGRIRLSIKALLEEEAK---------------------------------------------------
PNP_AZOSB       E-RGKIRLSMK-----------------------------------------------------------
PNP_VESOH       R--GRIKLSRK-----------------------------------------------------------
PNP_SPHWW       -NRGKVRLSMRVVDQ-------------------------------------------------------
PNP_SACD2       Q-RGRIKLSIK-----------------------------------------------------------
PNP_NITWN       D-RGKTRLSMKVVDQETGED--------------------------------------------------
PNP_CLOTH       KQ-GRVNLSRKDAMEDE-----------------------------------------------------
PNP_CLOPS       -SQGRINLSRKDIKEAEEENKQQ-----------------------------------------------
PNP_CLOPE       -SQGRINLSRKDIKEAEEENKQQ-----------------------------------------------
PNP_CLOP1       -SQGRINLSRKDIKEAEEENKQQ-----------------------------------------------
PNP_CHLMU       EK-GQLKLSHK-----------------------------------------------------------
PNP_CHLAB       EK-GQYKLSHK-----------------------------------------------------------
PNP_CELJU       Q-RGRIKLSIK-----------------------------------------------------------
PNP_BRUSU       E-RGKVRLSMKVVDQ-------------------------------------------------------
PNP_BRUSI       E-RGKVRLSMKVVDQ-------------------------------------------------------
PNP_BRUO2       E-RGKVRLSMKVVDQ-------------------------------------------------------
PNP_BRUME       E-RGKVRLSMKVVDQ-------------------------------------------------------
PNP_BRUMB       E-RGKVRLSMKVVDQ-------------------------------------------------------
PNP_BRUC2       E-RGKVRLSMKVVDQ-------------------------------------------------------
PNP_BRUAB       E-RGKVRLSMKVVDQ-------------------------------------------------------
PNP_BRUA2       E-RGKVRLSMKVVDQ-------------------------------------------------------
PNP_BRUA1       E-RGKVRLSMKVVDQ-------------------------------------------------------
PNP_ACTPJ       RQ-NRIRLTMKDLN--------------------------------------------------------
PNP_ACTP7       RQ-NRIRLTMKDLN--------------------------------------------------------
PNP_ACTP2       RQ-NRIRLTMKDLN--------------------------------------------------------
RS1_LEULA       PAEERISLSMKALEEKEREDRRGNDGSASRAD----IAAYKQQDDSAAT---------------------
PNP_SHESW       RQ-GRVRLSIKE----------------------------------------------------------
PNP_SHESR       RQ-GRVRLSIKE----------------------------------------------------------
PNP_SHESM       RQ-GRVRLSIKE----------------------------------------------------------
PNP_SHESA       RQ-GRVRLSIKE----------------------------------------------------------
PNP_SHEPC       RQ-GRVRLSIKE----------------------------------------------------------
PNP_SHEON       RQ-GRVRLSIKE----------------------------------------------------------
PNP_SHEB2       RQ-GRVRLSIKE----------------------------------------------------------
PNP_RUTMC       R--GRIKLSRK-----------------------------------------------------------
PNP_RHIME       E-RGKVRLSMKVVDQATGKEVVAE--KSEKKD--------------------------------------
PNP_RHILW       E-RGKVRLSMKVVDQATGQEIPNEKKKEEAAE--------------------------------------
PNP_PHEZH       D-RGKTRLSMKVVDQETGEDLS---KSNEKAE--------------------------------------
PNP_NITMU       DK-GRLRLSMK-----------------------------------------------------------
PNP_HAEIG       RQ-GRIRLTMKDLAPKQETEINQE----------------------------------------------
PNP_HAEIE       RQ-GRIRLTMKDLAPKQETEINQE----------------------------------------------
PNP_HAEI8       RQ-GRIRLTMKDLAPKQETEINQE----------------------------------------------
PNP_DIAST       DK-GRVKLSMKALADRPAGD--------------------------------------------------
PNP_BART1       E-RGKVRLSMKAVDQKTGKEMTDD----------------------------------------------
PNP_ACISJ       DK-GRVKLSMKALADRPAGD--------------------------------------------------
PNP_VIBSL       RQ-GRVRLSMK-----------------------------------------------------------
PNP_TOLAT       RQ-GRIRLSIKEAKRDE-----------------------------------------------------
PNP_SHISS       RQ-GRIRLSIK-----------------------------------------------------------
PNP_SHIFL       RQ-GRIRLSIK-----------------------------------------------------------
PNP_SHIF8       RQ-GRIRLSIK-----------------------------------------------------------
PNP_SHIBS       RQ-GRIRLSIK-----------------------------------------------------------
PNP_SHIB3       RQ-GRIRLSIK-----------------------------------------------------------
PNP_SHEDO       RQ-GRVRLSIKEAQE-------------------------------------------------------
PNP_RHOFD       EK-GRIKLSMK-----------------------------------------------------------
PNP_RHOCS       D-RGKVKLSMKVVDQTTGED--------------------------------------------------
PNP_RHIL3       E-RGKVRLSMKVVDQATGQEIPNEKKKEEAAE--------------------------------------
PNP_RALSO       EK-GRMRLSIK-----------------------------------------------------------
PNP_RALPJ       EK-GRMRLSIK-----------------------------------------------------------
PNP_PHOLU       RQ-GRVRLSIKE----------------------------------------------------------
PNP_NITHX       D-RGKTRLSMKAVDQQTGEDLEAAGHKAEKAD--------------------------------------
PNP_NITEC       DK-GRLRLSMK-----------------------------------------------------------
PNP_MYXXD       KT-GKIRLSRKE----------------------------------------------------------
PNP_HAEIN       RQ-GRIRLTMKDLAPKQETEINQE----------------------------------------------
PNP_GEOSL       KQ-GKIKLSRKE----------------------------------------------------------
PNP_ECOSE       RQ-GRIRLSIK-----------------------------------------------------------
PNP_ECOLI       RQ-GRIRLSIK-----------------------------------------------------------
PNP_ECOLC       RQ-GRIRLSIK-----------------------------------------------------------
PNP_ECOHS       RQ-GRIRLSIK-----------------------------------------------------------
PNP_ECODH       RQ-GRIRLSIK-----------------------------------------------------------
PNP_ECOBW       RQ-GRIRLSIK-----------------------------------------------------------
PNP_ECO8A       RQ-GRIRLSIK-----------------------------------------------------------
PNP_ECO7I       RQ-GRIRLSIK-----------------------------------------------------------
PNP_ECO5E       RQ-GRIRLSIK-----------------------------------------------------------
PNP_ECO57       RQ-GRIRLSIK-----------------------------------------------------------
PNP_ECO55       RQ-GRIRLSIK-----------------------------------------------------------
PNP_ECO24       RQ-GRIRLSIK-----------------------------------------------------------
PNP_BURXL       EK-GRVRLSAK-----------------------------------------------------------
PNP_BURTA       EK-GRVRLSAK-----------------------------------------------------------
PNP_BURPP       EK-GRVRLSAK-----------------------------------------------------------
PNP_BURCM       EK-GRVRLSAK-----------------------------------------------------------
PNP_BURA4       EK-GRVRLSAK-----------------------------------------------------------
PNP_BUCBP       RQ-GRLR