[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for hlac0:ACM56614.1

[Show Plain Result]


## Summary of Sequence Search
    1::221
   26::215     1e-13  29%  217 aa  YRRM_BACSU RecName: Full=Putative O-methyltransferase yrrM;        
   21::241     7e-13  26%  242 aa  CAMT_VITVI RecName: Full=Caffeoyl-CoA O-methyltransferase;       
   58::247     2e-12  27%  247 aa  CAMT_POPTM RecName: Full=Caffeoyl-CoA O-methyltransferase;       
   58::246     2e-12  27%  249 aa  CAMT_EUCGU RecName: Full=Caffeoyl-CoA O-methyltransferase;       
   58::245     4e-12  27%  246 aa  CAMT1_EUCGL RecName: Full=Caffeoyl-CoA O-methyltransferase 1;      
   46::221     8e-12  30%  221 aa  MDMC_STRMY RecName: Full=O-methyltransferase mdmC;       
   43::223     1e-11  31%  224 aa  Y4520_MYCUA RecName: Full=Putative O-methyltransferase MUL_4520;   
   70::258     1e-11  27%  259 aa  CAMT4_ARATH RecName: Full=Probable caffeoyl-CoA O-methyltransferase
   53::241     1e-11  27%  242 aa  CAMT2_TOBAC RecName: Full=Caffeoyl-CoA O-methyltransferase 2;      
   58::247     2e-11  26%  247 aa  CAMT1_POPTR RecName: Full=Caffeoyl-CoA O-methyltransferase 1;      
   53::241     2e-11  27%  242 aa  CAMT_SOLTU RecName: Full=Caffeoyl-CoA O-methyltransferase;       
   53::241     2e-11  27%  242 aa  CAMT4_TOBAC RecName: Full=Caffeoyl-CoA O-methyltransferase 4;      
   50::238     2e-11  27%  239 aa  CAMT1_TOBAC RecName: Full=Caffeoyl-CoA O-methyltransferase 1;      
   53::241     4e-11  26%  242 aa  CAMT3_TOBAC RecName: Full=Caffeoyl-CoA O-methyltransferase 3;      
   51::239     5e-11  26%  240 aa  CAMT5_TOBAC RecName: Full=Caffeoyl-CoA O-methyltransferase 5;      
   26::247     7e-11  26%  247 aa  CAMT_MEDSA RecName: Full=Caffeoyl-CoA O-methyltransferase;       
   26::246     7e-11  26%  247 aa  CAMT6_TOBAC RecName: Full=Caffeoyl-CoA O-methyltransferase 6;      
   26::247     1e-10  25%  247 aa  CAMT2_POPTR RecName: Full=Caffeoyl-CoA O-methyltransferase 2;      
   52::240     2e-10  26%  241 aa  CAMT_PETCR RecName: Full=Caffeoyl-CoA O-methyltransferase;       
   29::225     2e-10  29%  226 aa  Y4497_MYCVP RecName: Full=Putative O-methyltransferase Mvan_4497;  
   29::225     2e-10  29%  226 aa  Y2199_MYCGI RecName: Full=Putative O-methyltransferase Mflv_2199;  
   26::246     2e-10  26%  247 aa  CAMT2_EUCGL RecName: Full=Caffeoyl-CoA O-methyltransferase 2;      
   44::214     3e-10  31%  215 aa  Y1361_MYCA9 RecName: Full=Putative O-methyltransferase MAB_1361c;  
   65::253     8e-10  25%  254 aa  CAMT_MESCR RecName: Full=Caffeoyl-CoA O-methyltransferase;       
   75::264     1e-09  28%  264 aa  CAMT2_MAIZE RecName: Full=Caffeoyl-CoA O-methyltransferase 2;      
   34::214     1e-09  29%  215 aa  Y1280_MYCBP RecName: Full=Putative O-methyltransferase BCG_1280c;  
   34::214     1e-09  29%  215 aa  Y1252_MYCBO RecName: Full=Putative O-methyltransferase Mb1252c;    
   34::214     1e-09  29%  215 aa  Y1229_MYCTA RecName: Full=Putative O-methyltransferase MRA_1229;   
   34::214     1e-09  29%  215 aa  Y1220_MYCTU RecName: Full=Putative O-methyltransferase
   70::258     2e-09  27%  259 aa  CAMT_PINTA RecName: Full=Caffeoyl-CoA O-methyltransferase;       
   55::231     4e-09  28%  232 aa  CAMT1_ARATH RecName: Full=Putative caffeoyl-CoA O-methyltransferase
   43::223     5e-09  27%  224 aa  Y4217_MYCMM RecName: Full=Putative O-methyltransferase MMAR_4217;  
   39::167     5e-09  39%  220 aa  Y4009_MYCSJ RecName: Full=Putative O-methyltransferase Mjls_4009;  
   29::209     8e-09  29%  210 aa  Y5073_MYCS2 RecName: Full=Putative O-methyltransferase MSMEG_5073; 
   43::240     8e-09  28%  241 aa  CAMT_STELP RecName: Full=Caffeoyl-CoA O-methyltransferase;       
   56::230     8e-09  24%  231 aa  CAMT2_DICDI RecName: Full=Probable caffeoyl-CoA O-methyltransferase
   11::231     1e-08  25%  232 aa  CAMT_CITNA RecName: Full=Caffeoyl-CoA O-methyltransferase;       
   49::231     1e-08  24%  232 aa  CAMT3_ARATH RecName: Full=Probable caffeoyl-CoA O-methyltransferase
   39::219     3e-08  27%  220 aa  Y4069_MYCSK RecName: Full=Putative O-methyltransferase Mkms_4069;  
   39::219     3e-08  27%  220 aa  Y3995_MYCSS RecName: Full=Putative O-methyltransferase Mmcs_3995;  
   55::229     3e-08  24%  230 aa  CAMT1_DICDI RecName: Full=Probable caffeoyl-CoA O-methyltransferase
   59::262     1e-07  26%  262 aa  CMTD1_HUMAN RecName: Full=Catechol-O-methyltransferase
   55::234     2e-07  26%  235 aa  CAMT_POPKI RecName: Full=Caffeoyl-CoA O-methyltransferase;       
   69::258     4e-07  26%  258 aa  CAMT1_MAIZE RecName: Full=Caffeoyl-CoA O-methyltransferase 1;      
   59::262     8e-07  26%  262 aa  CMTD1_MOUSE RecName: Full=Catechol-O-methyltransferase
   56::244     2e-06  26%  245 aa  CAMT_ZINEL RecName: Full=Caffeoyl-CoA O-methyltransferase;       
   73::222     4e-06  31%  272 aa  COMT_BOVIN RecName: Full=Catechol O-methyltransferase;       
   55::151     5e-06  34%  219 aa  PIMT2_ARCFU RecName: Full=Protein-L-isoaspartate
   56::172     9e-06  34%  218 aa  PIMT_ROSS1 RecName: Full=Protein-L-isoaspartate
   26::140     9e-06  35%  210 aa  PIMT_PARUW RecName: Full=Protein-L-isoaspartate
   31::140     1e-05  32%  205 aa  PIMT_GLOVI RecName: Full=Protein-L-isoaspartate
   79::199     1e-05  32%  277 aa  SPEE1_THETN RecName: Full=Spermidine synthase 1;       
   65::222     1e-05  31%  264 aa  COMT_RAT RecName: Full=Catechol O-methyltransferase;       
   35::170     3e-05  34%  207 aa  PIMT_PYRCJ RecName: Full=Protein-L-isoaspartate
   84::200     3e-05  35%  244 aa  PIMT2_SHESH RecName: Full=Protein-L-isoaspartate
   34::150     7e-05  34%  217 aa  PIMT2_GEOUR RecName: Full=Protein-L-isoaspartate
   83::199     1e-04  30%  277 aa  SPEE_THEPX RecName: Full=Spermidine synthase;       
   83::199     1e-04  30%  277 aa  SPEE_THEP3 RecName: Full=Spermidine synthase;       
   56::172     1e-04  34%  218 aa  PIMT_ROSCS RecName: Full=Protein-L-isoaspartate
   42::171     1e-04  34%  233 aa  PIMT_OPITP RecName: Full=Protein-L-isoaspartate
  110::234     1e-04  29%  637 aa  DNAK2_SYNPX RecName: Full=Chaperone protein dnaK2;AltName:
   65::222     1e-04  29%  265 aa  COMT_MOUSE RecName: Full=Catechol O-methyltransferase;       
   60::173     1e-04  29%  221 aa  PIMT_CYTH3 RecName: Full=Protein-L-isoaspartate
   67::160     2e-04  30%  222 aa  PIMT_SYNP2 RecName: Full=Protein-L-isoaspartate
  131::261     2e-04  27%  381 aa  ERG6_YARLI RecName: Full=Sterol 24-C-methyltransferase;       
  110::238     2e-04  28%  630 aa  DNAK_PROMT RecName: Full=Chaperone protein dnaK;AltName: Full=Heat
   87::221     2e-04  32%  271 aa  COMT_HUMAN RecName: Full=Catechol O-methyltransferase;       
   69::226     2e-04  29%  269 aa  COMT_HORSE RecName: Full=Catechol O-methyltransferase;       
   55::173     2e-04  31%  216 aa  PIMT1_ARCFU RecName: Full=Protein-L-isoaspartate
  110::238     2e-04  28%  634 aa  DNAK2_PROMM RecName: Full=Chaperone protein dnaK2;AltName:
   43::154     3e-04  31%  220 aa  PIMT_THEON RecName: Full=Protein-L-isoaspartate
   57::149     3e-04  33%  211 aa  PIMT2_POLSJ RecName: Full=Protein-L-isoaspartate
    8::136     3e-04  28%  186 aa  COMT_PIG RecName: Full=Catechol O-methyltransferase;       
   55::133     4e-04  46%  210 aa  Y7326_OLICO RecName: Full=UPF0301 protein OCAR_7326;
   55::172     4e-04  31%  211 aa  PIMT_IGNH4 RecName: Full=Protein-L-isoaspartate
   48::178     4e-04  27%  220 aa  PIMT_DICT6 RecName: Full=Protein-L-isoaspartate
   69::169     6e-04  32%  222 aa  Y1364_MYCA1 RecName: Full=Putative O-methyltransferase MAV_1364;   
   33::152     6e-04  34%  215 aa  PIMT1_PELPD RecName: Full=Protein-L-isoaspartate
  110::238     6e-04  28%  633 aa  DNAK2_PROMA RecName: Full=Chaperone protein dnaK2;AltName:
  167::262     8e-04  30%  300 aa  PRMA_BURVG RecName: Full=Ribosomal protein L11 methyltransferase;  
  147::221     8e-04  37%  310 aa  COQ5_XENLA RecName: Full=Ubiquinone biosynthesis methyltransferase
    1::221

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxLSDSAERFLAATAPEHTATQVEMAALADDWGFPISGPEAGAVLRLLARLTDAERVFEFGSGFGYSAT
YRRM_BACSU      -------------------------LEAYAEEHHVPIMEKAGMEVLLQILSVKQPKKILEIGTAIGYSAI
CAMT_VITVI      ----SDALYQYILETSPREPESMKELRELTAQWNIMTTSADEGQFLNMLLKLINAKNTMEIGVYTGYSAT
CAMT_POPTM      --------------------------------WNIMTTSADEGQFLNMLLKLVNAKNTMEIGVYTGYSAT
CAMT_EUCGU      --------------------------------WNIMTTSADEGQFLNMLLKLINAKNTMEIGVFTGYSAT
CAMT1_EUCGL     --------------------------------WNIMTTSADEGQFLNMLLKLINAKNTMEIGVFTGYSAT
MDMC_STRMY      ---------------------------------------PEEAQFLGLLIRLVGARRVLEIGTFTGYSTL
Y4520_MYCUA     -----------------------------AVDIGVGAVTPAVGALLSMLAKLSGGKAVAEVGTGAGVSGL
CAMT4_ARATH     --------------------------------WNIMTTSADEGQFLNMLIKLVNAKNTMEIGVYTGYSAT
CAMT2_TOBAC     --------------------------------WNLMTTSADEGQFLSMLLKLINAKNTMEIGVFTGYSAT
CAMT1_POPTR     --------------------------------WNIMTTSADEGQFLNMLLKLVNAKNTMEIGVYTGYSAT
CAMT_SOLTU      --------------------------------WNLMTTSADEGQFLNMLLKLINAKNTMEIGVFTGYSAT
CAMT4_TOBAC     --------------------------------WNLMTTSADEGQFLSMLIKLINAKNTMEIGVFTGYSAT
CAMT1_TOBAC     --------------------------------WNLMTTSADEGQFLSMLIKLINAKNTMEIGVFTGYSAT
CAMT3_TOBAC     --------------------------------WNIMTTSADEGQFLSMLLKLINAKNTMEIGVFTGYSAT
CAMT5_TOBAC     --------------------------------WNLMTTSADEGQFLNMLLKLINAKNTMEIGVYTGYSAT
CAMT_MEDSA      ----SDALYQYILETSVEHEAMELREVTAKHPWNIMTTSADEGQFLSMLLKLINAKNTMEIGVYTGYSAT
CAMT6_TOBAC     ----SDALYQYILETSPREPEPMKELRELTHPWNLMTTSADEGQFLSMLLKLIIAKNTMEIGVYTGYSAT
CAMT2_POPTR     ----SDALYQYILETSPREPECMKELRELTHPWNIMTTSADEGQFLNMLLKLINAKNTMEIGVFTGYSAT
CAMT_PETCR      --------------------------------WNLMTTSADEGQFLNMLLKLINAKNTMEIGVYTGYSAT
Y4497_MYCVP     -----------------EHSISEDAIVAAARDIGAGAVSPAVGALLCVLAKLTGARAVVEVGTGAGVSGL
Y2199_MYCGI     -----------------EHSISEDAIVAAARERAVDIGAPAVGALLCVLAKLTGAKAVVEVGTGAGVSGL
CAMT2_EUCGL     ----SDALYQYILETSPREPESMKELREITHPWNLMTTSADEGQFLNMLLKLINAKNTMEIGVYTGYSAT
Y1361_MYCA9     ---------------------------------------PAVGALLSVFARLSGGKAVVEVGTGAGVSGL
CAMT_MESCR      --------------------------------WNLMTTSADEGQFLNMLLKLINAKNTIEIGVYTGYXXX
CAMT2_MAIZE     --------------------------------WNLMTTSADEGQFLNMLIKLIGAKKTMEIGVYTGYSAT
Y1280_MYCBP     -----------------------------ATDIGAGAVTPAVGALLCLLAKLSGGKAVAEVGTGAGVSGL
Y1252_MYCBO     -----------------------------ATDIGAGAVTPAVGALLCLLAKLSGGKAVAEVGTGAGVSGL
Y1229_MYCTA     -----------------------------ATDIGAGAVTPAVGALLCLLAKLSGGKAVAEVGTGAGVSGL
Y1220_MYCTU     -----------------------------ATDIGAGAVTPAVGALLCLLAKLSGGKAVAEVGTGAGVSGL
CAMT_PINTA      --------------------------------WNLMTTSADEGQFLGLLLKLINAKNTMEIGVYTGYSST
CAMT1_ARATH     ----------------------------------------DEGHFLSMLVKIMNAKNTIEIGVFTGYSLT
Y4217_MYCMM     -----------------------------AVDIGVGAVTPAVGALLSMLAKLSGGKAVAEVGTGAGVSGL
Y4009_MYCSJ     -----------------------------AVDIGAGAVTPAVGALLSVLARLTEAKAVVEVGTGAGVSGL
Y5073_MYCS2     -----------------------------ADDIGAGAVTPAVGALLSVLARLTGGRAVVEVGTGAGVSGL
CAMT_STELP      ----------------------ELRKATESHPMSFMGTSPLAGQLLSFMLKTVKPKKTIEVGVFTGYSAT
CAMT2_DICDI     ----------------------------------------EQCSFFKLLIQVLNAKKTIDIGVFTGLSSL
CAMT_CITNA      ----SDALRQYILETSPESMKELREVTA-KHPWNLMRTSADEGQFLNMSLKLINAKNTMEIGVYTDYSAT
CAMT3_ARATH     -------------------------------------TAPDAGQLMGMLLNLVNARKTIEVGVFTGYSLT
Y4069_MYCSK     -----------------------------AVDMGAGAVTPAVGALLSVLARLTEAKAVVEVGTGAGVSGL
Y3995_MYCSS     -----------------------------AVDMGAGAVTPAVGALLSVLARLTEAKAVVEVGTGAGVSGL
CAMT1_DICDI     ----------------------------------------EQCSFFKLLIQVLNAKKTIDIGVFTGLSSL
CMTD1_HUMAN     -----------LSRSMREHPALRLRLLTLEQPQGDSMMTCEQAQLLANLARLIQAKKALDLGTFTGYSXX
CAMT_POPKI      ----------------------------------------DEGRFLSMLLKLMNAKRTLEVGVFTGYSST
CAMT1_MAIZE     --------------------------------WNLMTTSADEGQFLNMLIKLIGAKKTMEIGVYTGYSAT
CMTD1_MOUSE     -----------LSRSMREHPALRLRLLTLEQPQGDSMMTCEQAQLLANLARLIKAKKALDLGTFTGYSXX
CAMT_ZINEL      --------------------------------WNLMTTSADEGQFXXXXXXXXXXXXTMEIGVYTGYSST
COMT_BOVIN      ----------------PQSVVAAIDSYSLEKEWAMHV-GEKKGQIVDRVLREQQPSVLLELGAYCGYSAV
PIMT2_ARCFU     --------------------------------YGQTISAPHMVAIMCELLDLREGDKVLEVGTGCGYHAT
PIMT_ROSS1      ---------------------------------GQTISQPYMVALMVEALQLAPTDRVLEVGAGSGYAAA
PIMT_PARUW      --------ERFVS----EHIAPLAEDRPLSIDEGQTISQPFIVAVMAQQAQITPQDKVLEIGTGSGYSAA
PIMT_GLOVI      ----------------PPYTRLAYEDRPLPIGHSQTISQPFIVAYMSEAARITPGAKVLEIGTGSGYQAA
SPEE1_THETN     ---------------------------------------------------------VLIIGGGDGGSVR
COMT_RAT        ----------------PQSVLEAIDTYCTQKEWAMNV-GDAKGQIMDAVIREYSPSLVLELGAYCGYSAV
PIMT_PYRCJ      ----------------PEYRMMAYEDRPLPLFAGATISAPHMVAMMCELIEPRPGMKILEVGTGSGY---
PIMT2_SHESH     ---------------------------------GQTISQPYIVALMTELLELTGSERVLEIGTGSGYQAA
PIMT2_GEOUR     ----------------PRHIFVEEAMSAQASDSSLPISQPYMVALMSGMLQLTGKEKVLELGTGSGYQAA
SPEE_THEPX      -------------------------------------------------------------GGGDGGSVR
SPEE_THEP3      -------------------------------------------------------------GGGDGGSVR
PIMT_ROSCS      ---------------------------------GQTISQPYMVALMIEALQLAPTDRVLEIGAGSGYAAA
PIMT_OPITP      ---ITDEATLAAMRTVPRHRFVPEDVRRSAYDHGQTISQPYIVAYMTQAARLKRDSRVLEIGTGSGYQAA
DNAK2_SYNPX     ---------------APEEVSAQV-LRKLAEDAGKYLGETVTQAVITVPAYFNDSQRTKDAGKIAGLEVL
COMT_MOUSE      ----------------PQSVLEAIDTYCSEKEWAMNV-GDAKGQIMDAVIREYRPSLVLELGAYCGYSAV
PIMT_CYTH3      ---------------------------------GQTISQPYTVASQTSLLKLSPGMKVLEIGTGSGYQCS
PIMT_SYNP2      --------------------------------YGQTISQPYIVAYMTEAAHLTPSSKVLEIGTGCGYQAA
ERG6_YARLI      --------------------------------------------------------KVLDVGCGVGGPAR
DNAK_PROMT      ---------------SPEEVSAQV-LRKLSDDAGKYLGETVTQAVITVPAYFNDSQRTKDAGKIAGLEVL
COMT_HUMAN      -------------------------------EWAMNV-GDKKGKIVDAVIQEHQPSVLLELGAYCGYSAV
COMT_HORSE      ----------------PQSVLETIDAYCSQKEWAMNV-GDKKGQFLDAVVQEQQPSVLLELGAYCGYSAV
PIMT1_ARCFU     --------------------------------YGQTISAPHMVAIMCELLDLREGERVLEIGTGCGYHAT
DNAK2_PROMM     ---------------SPEEVSAQV-LRKLAEDAGKYLGENVTQAVITVPAYFNDSQRTKDAGKIAGLEVL
PIMT_THEON      ----------------PEHKKWAHVDEPLPIPGGQTISAPHMVAIMLELAELEEGMNVLDIGTGSGWNAA
PIMT2_POLSJ     ---------------------------------GQTISQPYIVALMTDLARVEPGHKVLEVGTGSGYQAA
COMT_PIG        --------------------------------------GRKKGQIVDTVVQEQRPSVLLELGAYCGYSAV
Y7326_OLICO     ----------------------------------------------------------------------
PIMT_IGNH4      ---------------------------------GQTISAPHMVAYMVEAAELRRGDKVLEVGTGSGYHAA
PIMT_DICT6      -----------------EYLSLSYENEALPIGYGQTISQPYIVALMTEALNLQGNEKVLEIGTGSGYQTA
Y1364_MYCA1     ---------------------------------------------------------IAEVGTGAGVSGL
PIMT1_PELPD     ----------------PRHIFVQEAMAAQASDSSLPISQPYTVALMTELLELTGREKVLEIGTGSGYQ-T
DNAK2_PROMA     ---------------SPEEVAAQV-LRKLSEDAGKYLGENINQAVITVPAYFNDSQRTKDAGKIAGLEVL
PRMA_BURVG      -------------------------------------------------------QSVLDYGCGSGILAI
COQ5_XENLA      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           WFLRGGADAVICAEFDEEEAKRGVQFAADGGYADSVTFEVGDAMETIERYDGPFDVVLIDHLKGRYADAY
YRRM_BACSU      RMLELPSAEIYTIERNEKRHEEAVNNIKEFQLDDRIHVFYGDALELADHVTAPYDVIFIDAAKGQYQNFF
CAMT_VITVI      ALALPDDGKILAMDINKENYELGLPVIQKAGVAHKIDFKEGPALPVLDKYHGSFDFIFVDADKDNYLNYH
CAMT_POPTM      ALAIPEDGKILAMDINRENYELGLPVIQKAGVAHKIDFKEGPALPVLDKYHGSFDFIFVDADKDNYINYH
CAMT_EUCGU      ALALPDDGKILAMDINRENYELGLPVIQKAGVADKIDFREGPALPILDQLQGSFDFIFVDADKDNYLNYH
CAMT1_EUCGL     ALALPDDGKILAMDINRENYELGLPVIQKAGVADKIDFREGPALPILDQLQGSFDFIFVDADKDNYLNYH
MDMC_STRMY      CMARAAGGRIVTCDISDKWPGIGAPFWQRAGVDGLIDLRIGDAARTLAELDGAFDLVFVDADKAGYLHYY
Y4520_MYCUA     WLLSGMSDVLTTIDIEPEHLRVAKQAFTEAGIGPSRTRLIGRAQEVLTRLDDSYDLVFVDADPIDQPDYV
CAMT4_ARATH     ALALPEDGKILAMDVNRENYELGLPIIEKAGVAHKIDFREGPALPVLEKNHGTYDFIFVDADKDNYINYH
CAMT2_TOBAC     AMALPDDGKILAMDINRENYEIGLPIIEKAGLAHKIVFREGPALPVLDKYHGSYDFIFVDADKDNYLNYH
CAMT1_POPTR     ALAIPEDGKILAMDINRENYELGLPVIQKAGVAHKIDFKEGPALPVLDQMHGSFDFIFVDADKDNYINYH
CAMT_SOLTU      AMALPDDGKILAMDINRENYEIGLPVIEKAGLAHKIDFREGPALPVLDKYHGSYDFIFVDADKDNYLNYH
CAMT4_TOBAC     AMALPDDGKILAMDINRENYEIGLPVIEKAGLAHKIEFKEGPALPVLDKYHGSYDFIFVDADKDNYLNYH
CAMT1_TOBAC     AMALPDDGKILAMDINRENYEIGLPVIEKAGLAHKIEFKEGPALPVLDKYHGSYDFIFVDADKDNYLNYH
CAMT3_TOBAC     AMALPDDGKILAMDINRDNYEIGLPVIEKAGLAHKIEFKEGPALPVLDKYHGSYDFIFVDADKDNYLNYH
CAMT5_TOBAC     ALAIPDDGKILAMDINRENYEIGLPIIEKAGVAHKIEFREGPALPVLDQLHGTYDFIFVDADKDNYINYH
CAMT_MEDSA      ALAIPEDGKILAMDINKENYELGLPVIKKAGVDHKIDFREGPALPVLEKNHGSYDFIFVDADKDNYLNYH
CAMT6_TOBAC     ALALPDDGKILAMDINKENYELGLPVIQKAGVAHKIDFREGPALPVLDNNHGTYDFIFVDADKDNYINYH
CAMT2_POPTR     ALAIPEDGKILAMDINRENYELGLPVIQKAGLEHKIEFKEGPALPVLDKYHGTYDFIFVDADKDNYINYH
CAMT_PETCR      ALALPDDGKILAMDINRENYEIGLPIIEKAGVGHKIDFREGPALPVLDKYHGTFDFVFVDADKDNYINYH
Y4497_MYCVP     WLLSGMREDGVLTTIDVEPEHQRIQAFSEAGVGPGRTRLIGRAQEVLTRLDESYDLVFIDAAPADQPHFV
Y2199_MYCGI     WLLSGMREDGVLTTIDVEPEHQRIQAFSEAGVGPGRTRLIGRAQEVLTRLDESYDLVFIDAAPADQPQFV
CAMT2_EUCGL     ALALPDDGKILAMDINRENFEIGLPVIEKAGLAHKIDFREGPALPLLEKNHGTYDFIFVDADKDNYINYH
Y1361_MYCA9     WLLSGMREDGVLTTIDEPEHQRSAKQASEASIAPSRTRLIGGAQEVLPRLDESYDLLVIDAAPADQPDFL
CAMT_MESCR      XXXXXXPDKILAMDINRENYELGLPVIQKAGVAHKIDFREGPALPVLDKNHGSFDFAFVDADKDNYGNYH
CAMT2_MAIZE     ALALPEDGTILAMDINRENYELGLPCINKAGVGHKIDFREGPALPVLDEQHGSFDFAFVDADKDNYLNYH
Y1280_MYCBP     WLLSGMRDVLTTIDIEPEHLRLARQAFAEAGIGPSRTRLIGRAQEVLTRLDASYDLVFIDADPIDQPDYV
Y1252_MYCBO     WLLSGMRDVLTTIDIEPEHLRLARQAFAEAGIGPSRTRLIGRAQEVLTRLDASYDLVFIDADPIDQPDYV
Y1229_MYCTA     WLLSGMRDVLTTIDIEPEHLRLARQAFAEAGIGPSRTRLIGRAQEVLTRLDASYDLVFIDADPIDQPDYV
Y1220_MYCTU     WLLSGMRDVLTTIDIEPEHLRLARQAFAEAGIGPSRTRLIGRAQEVLTRLDASYDLVFIDADPIDQPDYV
CAMT_PINTA      ALALPDDGKILAMDINRENYDIGLPIIEKAGVAHKIDFREGPALPVLEDMHGSFDFVFVDRDKDNYLNYH
CAMT1_ARATH     TALALPEDGRITADIDKEAYEVGLEFIKKAGVDHKINFIHSDGLKALDQLVNDFDFAFADADKSSYVNFH
Y4217_MYCMM     WLLSGMSDVLTTIDIEPEHLRVAKQAFTEAGIGPSRTRLIGRAQEVLTRLDDSYDLVFVDADPIDQPDYV
Y4009_MYCSJ     WLLSGMREDGVLTTIDVEPEHQRIQAFIEAGIGPSRTRLIGRAQEVLTRLDESYDLVFID---GDPADQP
Y5073_MYCS2     WLLSGMRDDGVLTTIDVEPAKQG--FSEAGVGPGRTRLISGRAQEVLTRLDESYDLVFIDADPVDQPQFV
CAMT_STELP      ALSIPDDGKITAVDIDREAYNVGLALIKKAGVESKISFIVSXXXXXXXRYQGSYDFAFVDADKTNYVNYH
CAMT2_DICDI     TLAMGDEGRVVACDVSTEYTQHALKFWAKAGVDHKINLKIQPASKTLQELENTYDFVFIDADKTGYDTYY
CAMT_CITNA      ALAIPDDGKILAMDINRENYEIGLPKIEKAGVAHRIQFREGPALPVLDQLHGTYDFIFVDADKDNYINYH
CAMT3_ARATH     ALTLPEDGKVIAIDMNRDSYEIGLPVIKKAGVEHKIDFKESEALPALDELEGGFDFAFVDADKLNYWNYH
Y4069_MYCSK     WLLSGMREDGVLTTIDVEPEHQRIQAFTEAGIGPGRTRLIGRAQDVLTRLDESYDLVFIDADPVDQPQFV
Y3995_MYCSS     WLLSGMREDGVLTTIDVEPEHQRIQAFTEAGIGPGRTRLIGRAQDVLTRLDESYDLVFIDADPVDQPQFV
CAMT1_DICDI     TLAMGDEGRVVACDVSTDYTQHALKFWAKAGVDHKINLKIQPASKTLQELENTYDFVFIDADKTGYDTYY
CMTD1_HUMAN     XXXXXXADGVVTCEVDAQPPELGRPLWRQAEAEHKIDLRLKPALETLDELAGTFDVAVVDADKENCSAYY
CAMT_POPKI      ALALPEDGQVTAIDKDRGAYEIGLPFIQKAGVEDKINFIQSEAPPILNEMQPEFDFAFVDADKSSYKHYH
CAMT1_MAIZE     ALALPEDGTILAMDINRENYELGLPCIEKAGVAHKIDFREGPALPVLEKNHGSFDFVFVDADKDNYLNYH
CMTD1_MOUSE     XXXXXXPEAVVTCEVDAEPPKLGRPMWKQAEVEQKIDLRLQPALQTLDELAGTFDIAVVDADKENCTAYY
CAMT_ZINEL      ALALPEDGKILALDINRENYEIGLPIIQKAGVAHKIDFREGPALPLLEKCHGSFDFIFVDADKDNYLNYH
COMT_BOVIN      RMARPGA-RLLTIEFNPDYAQRMVEFA---GLQDKVTVVLGASQDIIKKYDDTLDMVFLDHWKDRYXXXX
PIMT2_ARCFU     AEIVGKSGKVISIEYIPELAERARAILKALGY-DNVEVIVGDGSKGYEK-EAPYDKIYV-----------
PIMT_ROSS1      VLSRIVA-KVHTVECREALAERAVALIQALGYT-NITVHIGDGTQGLPDY-APFDAILVSPLREQLASSG
PIMT_PARUW      -ILSQLASHVYSMERYPKLAELAKKRLQEFGY-NNVTVSVGDGSLGWEEF-APYEVIIV-----------
PIMT_GLOVI      VLAEMGAE-VYTVEIVPELAKRAERTLEELGYR-SVRVRSGDGYQGWPQH-APFDAIVV-----------
SPEE1_THETN     EVLKSSVERVVLAEIDEAVIRNSKKYLPTISSAPRVEIMIGDGIKYVNEHKNEFDVVIVDSTDGLFSDFY
COMT_RAT        RMLQPGA-RLLTMEMNPDYAAITQQMLNFAGLQDKVTILNGASQDLIKKYDDTLDMVFLDHWKDRYLPD-
PIMT_PYRCJ      -------HAAVCAEAIERQGKELAIFAAQNGYLGVVEVYRGDGRRGLERH-APFDAVLV---TAAASEIP
PIMT2_SHESH     -VLSQVAKEVFTIEIKEKLCTKAGKLLDSLGYT-NIQARCGDGYFGWNK-EAPFDAIMIDHLLAQLKDGG
PIMT2_GEOUR     -ILAELADRVYTVERIRPLALRARKALDSLGYL-NVNLKIGDGTDGWAS-EAPFDAILV-----------
SPEE_THEPX      EVLKHSVERVVLAEIDEAVVRNSKKYLPTISQAPRVEIMIGDGIKYVNEHKNEFDVVIVDSTDGLFSDFY
SPEE_THEP3      EVLKHSVERVVLAEIDEAVVRNSKKYLPTISQAPRVEIMIGDGIKYVNEHKNEFDVVIVDSTDGLFSDFY
PIMT_ROSCS      VLSRIVA-KVHTIECREXXXXXXXXXXRTLGY-DNVTVHVGDGTQGLPDY-APFDAILVSPLREQLASSG
PIMT_OPITP      -VLAELCDEVYSIEIVEPLAHQAAATLKETGY-ERVHLRIGDG------YNGPFDAILV-----------
DNAK2_SYNPX     RIINEPTAAALAYGLDKKSNERILVFDLGGGTFDVSVLEVGDGVFEVLSTSGDFDKVIVDHL--------
COMT_MOUSE      RMARPGA-RLLTMEINPDYAAITQQMLDFAGLQDKVSILIGAPQDLIKKYDDTLDMVFLDHWKDRYLPDT
PIMT_CYTH3      VLLEMGVN-VFTIEYHKSLFEKSKKMLQSLGY--KAQFFCGDGSEGLARF-GPYDRILAT-AGAPYVP--
PIMT_SYNP2      -ILAEIAQEVFTVEVVPELARQARDRLEALGY-QNIHYKIGDGYQGWSEF-APYDAILV-----------
ERG6_YARLI      EIARFTGANIVGLNNNDYQVERGTHYSEVQGFGDQVTYVKGDFMQ-MDFPDNSFDAVYAIELEGVYSEIF
DNAK_PROMT      RIINEPTAAALAYGLDKKSNERILVFDLGGGTFDVSVLEVGDGVFEVLSTSGDFDRVIVDHLASTF----
COMT_HUMAN      RMARSPGARLITIEINPDCAQRMVDFA---GVKDKVTLVVGASQDIIKKYDDTLDMVFLDHWKDRYLPDT
COMT_HORSE      RMARPGA-RLLTIEINPDYAAITQRMLDFAGLQDRVTVVLGASQDIIKKYDDTLDVVFLDHWKDRYLPDT
PIMT1_ARCFU     AEIVGKRGLVVSVERIPELAEIAKRNLSALGY-ENVVVIVGDGSLGYEPM-APYDKI---YVTASAPDIP
DNAK2_PROMM     RIINEPTAAALAYGLDKKSNERILVFDLGGGTFDVSVLEVGDGVFEVLSTSGDFDKVIVDHLAATF----
PIMT_THEON      L----AAELVKTDVYTVERIPELVEFAEKAGYADRVHVIIGDGTKGFPP-KAPYDRILV-----------
PIMT2_POLSJ     -VMAHLARAVYTIEIIEPLGLQARQRLQKLGY-DNVQVRLGDGYHGWEEH-APYDAILV-----------
COMT_PIG        RMARLPSARLLTIELNPDNAAIAQQVVDFAGLQDRVTVVVGASQDIIKKYDDTLDMVFLDHWKDRYLPDT
Y7326_OLICO     ----------------------------------------------------------------------
PIMT_IGNH4      VMLVGPEGHVYTIERIPELAERARERLKALGY-NNVTVLVGDGSKGYPP-AAPYDKIIVTAAAKRVPE--
PIMT_DICT6      ILAELALEIYTVERIKEEEAKKRLRVL---GY-NNVYFKLGDGTLGWEEF-APYDRIIV---TAASYDIP
Y1364_MYCA1     WLLSGMSDVLTTIDIEPEYLRLAKQAFAEAGIGPSRTRLIGGAQEVLTRLDESYDLVFIDADPIDQPDYV
PIMT1_PELPD     AILAALADRVYTVERIRPLALR-ARKCLDSLRLFNVMLRINDSEGSPIGWDAPFDAIIV-----------
DNAK2_PROMA     RIINEPTAAALAYGLDRKSNERILVFDLGGGTFDVSVLEVGDGVFEVLSTSGDFDKVIVDHLAATF----
PRMA_BURVG      LARKCGADPVIGIDIDPQAVESARQ-NSERNHAD-VTYGLPDACP-----DGEFDIVVANILSNPLKLMA
COQ5_XENLA      -----GSRAVIC-DINKEMLKVGLQKSLRLGYSEGLSWVAGDA-EELPFGDDKFDVYTITHIEQALQEAY


                         +         .         .         .         .         *         .:210
query           RAVLPKVRTGGVIVADNITRGPIDFGDLVAHFEDGAPLPDPEVDGETRGIGEYVGTVRSDEAVETAILPV
YRRM_BACSU      HLYEPMLSPDGVIITDNVL-----FKGLVA--EDYSKIEPKRRRRLVAKIDEYNHWLMNHPDYQTAIIPV
CAMT_VITVI      KRLIDLVKVGGIIGYDNTLWN----GSVVAP-------PDAPLRKYVRYYRDFVKALAADPRIEICMLPV
CAMT_POPTM      KRLIELVKVGGLIGYDNTLWN----GSVVAP-------PDAPMRKYVRYYRDFVKALAADPRIEICMLPV
CAMT_EUCGU      KRLIELVKVGGLIGYDNTLWN----GSVVAP-------PDAPLRKYVRYYRDFVKALAADPRIEICMLPV
CAMT1_EUCGL     KRLIELVKVGGLIGYDNTLWN----GSVVAP-------PDAPLRKYVRYYRDFVKALAADPRIEICMLPV
MDMC_STRMY      EQALALVRPGGLVAIDN----TLFFGXXXXXXXXXXXXXXXXXLND---------LLRDDERVDIALLTV
Y4520_MYCUA     VEGVRLLRSGGVIVVHRAALG------------DRA--GDPAVDAEVTAVREAARLIAEDERLTPALVPL
CAMT4_ARATH     KRLIDLVKIGGVIGYDNTLWN----GSVVAP-------PDAPMRKYVRYYRDFVKALAADPRIEICMLPV
CAMT2_TOBAC     KRLIDLVKVGGLIGYDNTLWN----GSVVAP-------PDAPLRKYVRYYRDFVKALAADSRIEICQLPV
CAMT1_POPTR     KRLIELVKVGGLIGYDNTLWN----GSVVAP-------PDAPMRKYVRYYRDFVKALAADPRIEICMLPV
CAMT_SOLTU      KRLIDLVKVGGLIGYDNTLWN----GSVVAP-------PDAPLRKYVRYYRDFVKALAADPRIEICQLPV
CAMT4_TOBAC     KRLIDLVKIGGLIGYDNTLWN----GSVVAP-------PDAPLRKYVRYYRDFVKALAADSRIEICQLPV
CAMT1_TOBAC     KRLIDLVKIGGLIGYDNTLWN----GSVVAP-------PDAPLRKYVRYYRDFVKALAADSRIEICQLPV
CAMT3_TOBAC     KRLIDLVKVGGLIGYDNTLWN----GSVVAP-------PDAPLRKYVRYYRDFVKALAADSRIEICQLPV
CAMT5_TOBAC     KRIIDLVKVGGLIGYDNTLWN----GSVVAP-------PDAPMRKYVRYYRDFVKALAADPRIEICMLPV
CAMT_MEDSA      KRLIDLVKVGGVIGYDNTLWN----GSVVAP-------PDAPLRKYVRYYRDFVKALAVDPRIEICMLPV
CAMT6_TOBAC     KRIIELVKVGGVIGYDNTLWN----GSVVAP-------PDAPMRKYVRYYRDFVKALAADPRIEICMLPV
CAMT2_POPTR     KRLIELVKVGGLIGYDNTLWN----GSVVAPAD--APM-RKYVRYYRDFVLELNKALAADPRIEICMLPV
CAMT_PETCR      KRLIDLVKIGGLIGYDNTL-----WNGSVAQPAD-APM-RKYVRYYRDFVIELNKALAADPRIEICMLPV
Y4497_MYCVP     TEGVRLLRPGGAIVVHRAALGG-RAGDATAK------------DSEVAAVREAARLIAEDDRLTPVLIPL
Y2199_MYCGI     VEGVRLLRPGGAIVVHRAALGG-RAGDASAK------------DSEVSAVREAARLIAEDERLTPVLIPL
CAMT2_EUCGL     KRLIDLVKVGGLIGYDNTLWN----GSVVAPAD--APL-RKYVRYYRDFVLELNKALAVDPRVEICMLPV
Y1361_MYCA9     AGGIRLLRPGGAVVIHGASAGG-RAGDPSAN--------DPDV----VGVREAARIIADDGRFTAVLIPL
CAMT_MESCR      KRLIDLVKIGGVIGYDNTLWN----GSVAAPAD--APM-RKYVRYYRDFVMEFNKAIAADPRVEICQLPV
CAMT2_MAIZE     ERLLKLVRPGGLIGYDNTLWN----GSVV--LPDDAPMRK-----YIRFYRDFVSALAADDRVEICQLPV
Y1280_MYCBP     AEGVRLLRSGGVIVVH-------------XXXXXXXXXXXXXXXXEVIAVREAARLIAEDERLTPALVPL
Y1252_MYCBO     AEGVRLLRSGGVIVVH-------------XXXXXXXXXXXXXXXXEVIAVREAARLIAEDERLTPALVPL
Y1229_MYCTA     AEGVRLLRSGGVIVVH-------------XXXXXXXXXXXXXXXXEVIAVREAARLIAEDERLTPALVPL
Y1220_MYCTU     AEGVRLLRSGGVIVVH-------------XXXXXXXXXXXXXXXXEVIAVREAARLIAEDERLTPALVPL
CAMT_PINTA      KRLIDLVKVGGLIAYDNTLWN----GSVVAP-------PDAPLRKYVRYYRDFVMELNKDPRIEISQIPV
CAMT1_ARATH     ERLLKLVKVGGIIAFDN----TLWFG-FVAEDEDGVP---EHMREYRAALIEFNKKLALDPRVEVSQISI
Y4217_MYCMM     VEGVRLLRSGGVIVVH-------------XXXXXXXXXXXXXXXXEVTAVREAARLIAEDERLTPALVPL
Y4009_MYCSJ     QFVVEGVRPGGAIV--------------------------------------------------------
Y5073_MYCS2     VEGVRLLRSGGAIVVH-------------XXXXXXXXXXXXXXXXEVTAVREAARLIAEDERLTPVLIPL
CAMT_STELP      ERLIELVKVGGIIAYDNTL-----WGGTVA-------LPESEVPDFMKNLNEILG---SDARIDIAHLPV
CAMT2_DICDI     ELSLKLIRKGGIIAIDNV----LQHGRVAD--------PNANVEPNLVAIRALNDKILADKRVTKSLLPI
CAMT_CITNA      KRIIDLVKVGGLIGYDNTLWN----GSVVGP-------PDAPMRKYLRFVLELIKALAVDPRIEICMLPV
CAMT3_ARATH     ERLIRLIKVGGIIVYDNTL-----WGGSVAEPDSSTPEWRIEVKKATLELNK---KLSADQRVQISQAAL
Y4069_MYCSK     VEGVRLLRSGGAIVVHXXXXXXXXXXXXXXXXEVSA-------------VREAARLIAEDERLTPVLIPL
Y3995_MYCSS     VEGVRLLRSGGAIVVHXXXXXXXXXXXXXXXXEVSA-------------VREAARLIAEDERLTPVLIPL
CAMT1_DICDI     ELSLKLIRKGGIIAIDNV----LQHGRVAD--------PNANVEPNLVAIRALNDKILADKRVTKTMLPI
CMTD1_HUMAN     ERCLQLLRPGGILVLRVLWRGKV--------------LQPPKGDVAAECVRNLNERIRRDVRVYISLLPL
CAMT_POPKI      EQLLKLVKIGGIIAYDN----TLWYGLVAKEVDDEVPEPLRMV---RTVIMEFNKLLSSDLRVEISQISI
CAMT1_MAIZE     ERXXXXXXXXXXIGYDNTLWN----GSVV--LPDDAPMRK-----YIRFYRDFVKALAADDRVEICQLPV
CMTD1_MOUSE     ERCLQLLRPGGVLVLRVLWRG-----------EVLQPQPRNKTVECVRNLNE---RILRDARVYISLLPL
CAMT_ZINEL      KRLIDLVKFGGVIGYDNTLWN----GSLVAPAD--APL-RKYVRYYRDFVLELNKALAVDPRVEICQLPV
COMT_BOVIN      XXXXXXXXXGTVLLADNV----------------------------------------------------
PIMT2_ARCFU     ----------------------------------------------------------------------
PIMT_ROSS1      RLVIP-----------------------------------------------------------------
PIMT_PARUW      ----------------------------------------------------------------------
PIMT_GLOVI      ----------------------------------------------------------------------
SPEE1_THETN     RAVYECLREDGIIVAQ--TESPFIYGKLI-----------------------------------------
COMT_RAT        TLLLEKLRKGTVLLADNIVPGTPDF---------------------------------------------
PIMT_PYRCJ      KALVEQLREGGVMV--------------------------------------------------------
PIMT2_SHESH     RLVLP-----------------------------------------------------------------
PIMT2_GEOUR     ----------------------------------------------------------------------
SPEE_THEPX      KAVYECLKEDGIIVAQ--TESPFIYGKLI-----------------------------------------
SPEE_THEP3      KAVYECLKEDGIIVAQ--TESPFIYGKLI-----------------------------------------
PIMT_ROSCS      RLVIP-----------------------------------------------------------------
PIMT_OPITP      ----------------------------------------------------------------------
DNAK2_SYNPX     ----------------------------------------------------------------------
COMT_MOUSE      LLLCGLLRKGTVLLADNIVPGTPDF---------------------------------------------
PIMT_CYTH3      QKLLEQLKVGGILV--------------------------------------------------------
PIMT_SYNP2      ----------------------------------------------------------------------
ERG6_YARLI      RVLKP----GGVVMTDEYDESNPEHRDICYGIEKGDGIP-------------------------------
DNAK_PROMT      ----------------------------------------------------------------------
COMT_HUMAN      LLLCGLLRKGTVLLADNV----------------------------------------------------
COMT_HORSE      LLLCGLLRKGTVLLADNIVPGAPDF---------------------------------------------
PIMT1_ARCFU     KPLLEQLKIGGKMV--------------------------------------------------------
DNAK2_PROMM     ----------------------------------------------------------------------
PIMT_THEON      ----------------------------------------------------------------------
PIMT2_POLSJ     ----------------------------------------------------------------------
COMT_PIG        LLLCGLLRKGTVLLADNV----------------------------------------------------
Y7326_OLICO     ----------GIIV--NRPAGSIDFPQLLRQLDDGVPIQLPD-DGETVKIGGPVETSRSDYAIEDATLPI
PIMT_IGNH4      -ALLKQLKVGGIMV--------------------------------------------------------
PIMT_DICT6      EPLKEQLKDGGIMV--------------------------------------------------------
Y1364_MYCA1     VEGVRLLRPGGVIV--------------------------------------------------------
PIMT1_PELPD     ----------------------------------------------------------------------
DNAK2_PROMA     ----------------------------------------------------------------------
PRMA_BURVG      SMLASKVKPGGRIALSGV----------------------------------------------------
COQ5_XENLA      RVLKP-----------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           GSGIAVSTKVE
YRRM_BACSU      GDGLAISKK--
CAMT_VITVI      GDGITLCRRL-
CAMT_POPTM      GDGITLCRRIQ
CAMT_EUCGU      GDGITLCRRIQ
CAMT1_EUCGL     GDGITLCRRI-
MDMC_STRMY      ADGITLARRRE
Y4520_MYCUA     GDGVLAAVR--
CAMT4_ARATH     GDGITICRRI-
CAMT2_TOBAC     GDGITLCRRI-
CAMT1_POPTR     GDGITLCRRIQ
CAMT_SOLTU      GDGITLCRRI-
CAMT4_TOBAC     GDGITLCRRI-
CAMT1_TOBAC     GDGITLCRRI-
CAMT3_TOBAC     GDGITLCRRI-
CAMT5_TOBAC     GDGITLCRRI-
CAMT_MEDSA      GDGITICRRIK
CAMT6_TOBAC     GDGITLCRRI-
CAMT2_POPTR     GDGITLCRRIK
CAMT_PETCR      GDGVTLCRRI-
Y4497_MYCVP     GDGLLAAAR--
Y2199_MYCGI     GDGLLAAAR--
CAMT2_EUCGL     GDGITLCRRV-
Y1361_MYCA9     GDGLLAATR--
CAMT_MESCR      GDGITLCRRI-
CAMT2_MAIZE     GDGVTLCRRVK
Y1280_MYCBP     GDGVLAAVR--
Y1252_MYCBO     GDGVLAAVR--
Y1229_MYCTA     GDGVLAAVR--
Y1220_MYCTU     GDGVLAAVR--
CAMT_PINTA      LDGVTLCRRV-
CAMT1_ARATH     GDGITLCRRL-
Y4217_MYCMM     GDGVLAAVR--
Y4009_MYCSJ     -----------
Y5073_MYCS2     GDGLLAAVR--
CAMT_STELP      GDGITFCRRV-
CAMT2_DICDI     ADGITLITKI-
CAMT_CITNA      GDGITLSRRI-
CAMT3_ARATH     GDGITICRRL-
Y4069_MYCSK     GDGLLAAAR--
Y3995_MYCSS     GDGLLAAAR--
CAMT1_DICDI     ADGITLVTKI-
CMTD1_HUMAN     GDGLTLAFKI-
CAMT_POPKI      GDGVTLCRRL-
CAMT1_MAIZE     GDGVTLCRRVK
CMTD1_MOUSE     DDGLSLAFKI-
CAMT_ZINEL      GDGITLCRRI-
COMT_BOVIN      -----------
PIMT2_ARCFU     -----------
PIMT_ROSS1      -----------
PIMT_PARUW      -----------
PIMT_GLOVI      -----------
SPEE1_THETN     -----------
COMT_RAT        -----------
PIMT_PYRCJ      -----------
PIMT2_SHESH     -----------
PIMT2_GEOUR     -----------
SPEE_THEPX      -----------
SPEE_THEP3      -----------
PIMT_ROSCS      -----------
PIMT_OPITP      -----------
DNAK2_SYNPX     -----------
COMT_MOUSE      -----------
PIMT_CYTH3      -----------
PIMT_SYNP2      -----------
ERG6_YARLI      -----------
DNAK_PROMT      -----------
COMT_HUMAN      -----------
COMT_HORSE      -----------
PIMT1_ARCFU     -----------
DNAK2_PROMM     -----------
PIMT_THEON      -----------
PIMT2_POLSJ     -----------
COMT_PIG        -----------
Y7326_OLICO     DNGICLTATLD
PIMT_IGNH4      -----------
PIMT_DICT6      -----------
Y1364_MYCA1     -----------
PIMT1_PELPD     -----------
DNAK2_PROMA     -----------
PRMA_BURVG      -----------
COQ5_XENLA      -----------